Score = 44.7 bits (104), Expect = 2e-04, Method: Compositional matrix adjust.
Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 1/58 (1%)
Query: 3 IMRQVETVGQVYMAVSGAPEETPHHACNISDLSLSFIETVENMKEGSDNNIQIRIDEG 60
+ +VETVG VYMAVSGAP+ P HA + DL+L ++ + G D I++ I+ G
Sbjct: 533 FVYKVETVGMVYMAVSGAPDVNPLHAEHACDLALRVMKKFKAHDMG-DVAIRVGINSG 589
Heterodimers with Gyc-89Da and Gyc-89Db are activated in response to changing oxygen concentrations, alerting flies to hypoxic environments. Under normal oxygen concentrations, oxygen binds to the heme group and results in low levels of guanylyl cyclase activity. When exposed to reduced oxygen concentrations, the oxygen dissociates from the heme group resulting in activation of the enzyme. Drosophila melanogaster (taxid: 7227) EC: 4EC: .EC: 6EC: .EC: 1EC: .EC: 2
Heterodimers with Gyc-89Da and Gyc-89Db are activated in response to changing oxygen concentrations, alerting flies to hypoxic environments. Under normal oxygen concentrations, oxygen binds to the heme group and results in low levels of guanylyl cyclase activity. When exposed to reduced oxygen concentrations, the oxygen dissociates from the heme group resulting in activation of the enzyme.
Drosophila melanogaster (taxid: 7227)
EC: 4
EC: .
EC: 6
EC: .
EC: 1
EC: .
EC: 2
>sp|P40146|ADCY8_RAT Adenylate cyclase type 8 OS=Rattus norvegicus GN=Adcy8 PE=2 SV=1
Heterodimers with Gyc88E are activated in response to changing oxygen concentrations, alerting flies to hypoxic environments. Under normal oxygen concentrations, oxygen binds to the heme group and results in low levels of guanylyl cyclase activity. When exposed to reduced oxygen concentrations, the oxygen dissociates from the heme group resulting in activation of the enzyme.
Drosophila melanogaster (taxid: 7227)
EC: 4
EC: .
EC: 6
EC: .
EC: 1
EC: .
EC: 2
Close Homologs in the Non-Redundant Database Detected by BLAST
Present in two copies in mammalian adenylyl cyclases. Eubacterial homologues are known. Two residues (Asn, Arg) are thought to be involved in catalysis. These cyclases have important roles in a diverse range of cellular processes. Length = 194
Score = 39.1 bits (92), Expect = 2e-05
Identities = 14/53 (26%), Positives = 22/53 (41%), Gaps = 2/53 (3%)
Query: 7 VETVGQVYMAVSGAPEETPHHACNISDLSLSFIETVE--NMKEGSDNNIQIRI 57
+T+G MAV G P HA +L E + N + +++RI
Sbjct: 47 DKTIGDAVMAVFGLPGAHEDHAERAVRAALEMQEALAELNAEREGGPPLRLRI 99
Catalytic domains of the mononucleotidyl cyclases (MNC's), also called cyclase homology domains (CHDs), are part of the class III nucleotidyl cyclases. This class includes eukaryotic and prokaryotic adenylate cyclases (AC's) and guanylate cyclases (GC's). They seem to share a common catalytic mechanism in their requirement for two magnesium ions to bind the polyphosphate moiety of the nucleotide. Length = 177
6.1.2 from EC) catalyse the formation of cyclic GMP (cGMP) from GTP. cGMP acts as an intracellular messenger, activating cGMP-dependent kinases and regulating cGMP-sensitive ion channels. The role of cGMP as a second messenger in vascular smooth muscle relaxation and retinal photo-transduction is well established. Guanylate cyclase is found both in the soluble and particulate fractions of eukaryotic cells. The soluble and plasma membrane-bound forms differ in structure, regulation and other properties [, , , ]. Most currently known plasma membrane-bound forms are receptors for small polypeptides. The soluble forms of guanylate cyclase are cytoplasmic heterodimers having alpha and beta subunits. In all characterised eukaryote guanylyl- and adenylyl cyclases, cyclic nucleotide synthesis is carried out by the conserved class III cyclase domain. ; GO: 0016849 phosphorus-oxygen lyase activity, 0009190 cyclic nucleotide biosynthetic process, 0035556 intracellular signal transduction; PDB: 3UVJ_A 1FX4_A 1WC4_B 2BW7_D 1WC1_A 1WC0_A 1WC3_A 1WC5_A 1WC6_A 3ET6_B ....
Catalytic domains of the mononucleotidyl cyclases (MNC's), also called cyclase homology domains (CHDs), are part of the class III nucleotidyl cyclases. This class includes eukaryotic and prokaryotic adenylate cyclases (AC's) and guanylate cyclases (GC's). They seem to share a common catalytic mechanism in their requirement for two magnesium ions to bind the polyphosphate moiety of the nucleotide.
Present in two copies in mammalian adenylyl cyclases. Eubacterial homologues are known. Two residues (Asn, Arg) are thought to be involved in catalysis. These cyclases have important roles in a diverse range of cellular processes.
Class III nucleotidyl cyclases are the largest, most diverse group of nucleotidyl cyclases (NC's) containing prokaryotic and eukaryotic proteins. They can be divided into two major groups; the mononucleotidyl cyclases (MNC's) and the diguanylate cyclases (DGC's). The MNC's, which include the adenylate cyclases (AC's) and the guanylate cyclases (GC's), have a conserved cyclase homology domain (CHD), while the DGC's have a conserved GGDEF domain, named after a conserved motif within this subgroup. Their products, cyclic guanylyl and adenylyl nucleotides, are second messengers that play important roles in eukaryotic signal transduction and prokaryotic sensory pathways.
