Score = 46.6 bits (109), Expect = 5e-05, Method: Compositional matrix adjust.
Identities = 22/45 (48%), Positives = 34/45 (75%)
Query: 5 GTLVLLALELITPFFRFIPKATLSSILICAVIFLVDYQIVKPLWK 49
G LVLL+L+ +T F +IPK+ L++++I AV+ L D +IVK LW+
Sbjct: 381 GALVLLSLDYLTSLFYYIPKSALAAVIIMAVVPLFDTKIVKTLWR 425
Exhibits sodium-independent sulfate anion transporter activity that may cooperate with SLC26A2 to mediate DIDS-sensitive sulfate uptake into high endothelial venules endothelial cells (HEVEC). Bos taurus (taxid: 9913)
Score = 43.5 bits (101), Expect = 4e-04, Method: Compositional matrix adjust.
Identities = 20/47 (42%), Positives = 32/47 (68%)
Query: 3 ILGTLVLLALELITPFFRFIPKATLSSILICAVIFLVDYQIVKPLWK 49
+ G LVLL+L +T F +IPK+ L++++I AV L D +I + LW+
Sbjct: 366 VTGALVLLSLNYLTSLFSYIPKSALAAVIITAVTPLFDVKIFRSLWR 412
Exhibits sodium-independent sulfate anion transporter activity that may cooperate with SLC26A2 to mediate DIDS-sensitive sulfate uptake into high endothelial venules endothelial cells (HEVEC).
Mus musculus (taxid: 10090)
Close Homologs in the Non-Redundant Database Detected by BLAST
Score = 42.3 bits (100), Expect = 3e-06
Identities = 22/61 (36%), Positives = 38/61 (62%), Gaps = 1/61 (1%)
Query: 2 FILGTLVLLALELITPFFRFIPKATLSSILICAVIFLVDYQIVKPLWKFYSKLPILILVT 61
+ +VLL L ++TP F +IP+A L++I+I AV L+DY+ + LWK K+ ++ +
Sbjct: 337 VVTAIVVLLVLLVLTPLFYYIPQAALAAIIISAVRGLIDYKELYKLWK-ADKMDFVVWLV 395
Query: 62 A 62
Sbjct: 396 T 396
The SulP family is a large and ubiquitous family with over 30 sequenced members derived from bacteria, fungi, plants and animals. Many organisms including Bacillus subtilis, Synechocystis sp, Saccharomyces cerevisiae, Arabidopsis thaliana and Caenorhabditis elegans possess multiple SulP family paralogues. Many of these proteins are functionally characterized, and all are sulfate uptake transporters. Some transport their substrate with high affinities, while others transport it with relatively low affinities. Most function by SO42- :H+symport, but SO42- :HCO3- antiport has been reported for the rat protein (spP45380). The bacterial proteins vary in size from 434 residues to 566 residues with one exception, a Mycobacterium tuberculosis protein with 784 residues. The eukaryotic proteins vary in size from 611 residues to 893 residues with one exception, a protein designated "early nodulin 70 protein" from Glycine max which is reported to be of 485 residues. Thus, the eukaryotic proteins are almost without exception larger than the prokaryotic proteins. These proteins exhibit 10-13 putative transmembrane a-helical spanners (TMSs) depending on the protein. The phylogenetic tree for the SulP family reveals five principal branches. Three of these are bacterial specific as follows: one bears a single protein from M. tuberculosis; a second bears two proteins, one from M. tuberculosis, the other from Synechocystis sp, and the third bears all remaining prokaryotic proteins. The remaining two clusters bear only eukaryotic proteins with the animal proteins all localized to one branch and the plant and fungal proteins localized to the other. The generalized transport reactions catalyzed by SulP family proteins are: (1) SO42- (out) + nH+ (out) --> SO42- (in) + nH+ (in). (2) SO42- (out) + nHCO3- (in) SO42- (in) + nHCO3- (out) [Transport and binding proteins, Anions]. Length = 563
>gnl|CDD|223732 COG0659, SUL1, Sulfate permease and related transporters (MFS superfamily) [Inorganic ion transport and metabolism]
>PF00916 Sulfate_transp: Sulfate transporter family; InterPro: IPR011547 A number of proteins involved in the transport of sulphate across a membrane as well as some yet uncharacterised proteins have been shown [, ] to be evolutionary related
These proteins are: Neurospora crassa sulphate permease II (gene cys-14). Yeast sulphate permeases (genes SUL1 and SUL2). Rat sulphate anion transporter 1 (SAT-1). Mammalian DTDST, a probable sulphate transporter which, in human, is involved in the genetic disease, diastrophic dysplasia (DTD). Sulphate transporters 1, 2 and 3 from the legume Stylosanthes hamata. Human pendrin (gene PDS), which is involved in a number of hearing loss genetic diseases. Human protein DRA (Down-Regulated in Adenoma). Soybean early nodulin 70. Escherichia coli hypothetical protein ychM. Caenorhabditis elegans hypothetical protein F41D9.5. These proteins are highly hydrophobic and seem to contain about 12 transmembrane domains.; GO: 0005215 transporter activity, 0006810 transport, 0055085 transmembrane transport, 0016021 integral to membrane
This protein is observed in operons extremely similar to that characterized in E. coli K-12 responsible for the import and catabolism of pyrimidines, primarily uracil. This protein is a member of the uracil-xanthine permease family defined by TIGR00801. As well as the The Nucleobase:Cation Symporter-2 (NCS2) Family (TC 2.A.40).
All the seed members of this model are observed adjacent to genes for either xanthine phosphoribosyltransferase (for the conversion of xanthine to guanine, GenProp0696, ) or genes for the conversion of xanthine to urate and its concomitant catabolism (GenProp0640, GenProp0688, GenProp0686 and GenProp0687). A number of sequences scoring higher than trusted to this model are found in different genomic contexts, and the possibility exist that these transport related compounds in addition to or instead of xanthine itself. The outgroup to this family are sequences which are characterized as uracil permeases or are adjacent to established uracil phosphoribosyltransferases.
They preferentially catalyze anion exchange (antiport) reactions, typically acting as HCO3-:Cl- antiporters, but also transporting a range of other inorganic and organic anions. Additionally, renal Na+:HCO3- cotransporters have been found to be members of the AE family. They catalyze the reabsorption of HCO3- in the renal proximal tubule.
