Psyllid ID: psy2575

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-----
MPKEIKSKSQEDDNYQESLHKLVVSSDDEATDFANPTSDTAPSQACEHIHSNEIILTLGYSKIVELFLKNAAQHRKFQCIVMENSPENKGHELAVSLAKSKIQTVLIPDSAMFGLISRVNKIIIGTHTVMANGGLRSVCGTHAVALAAQHYSIPYPCTFLLNIGI
ccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHccccEEEEcHHHHHHHcccccEEEEcccEEEcccccHHHHHHHHHHHHHHHccccEEEEccccccc
cccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHccccEEEEEHHHHHHHHHHccEEEEEHHHHHHcccHHcHHHHHHHHHHHHHcccccHHHHHHHccc
mpkeiksksqeddnYQESLHKLVVssddeatdfanptsdtapsqacehihsNEIILTLGYSKIVELFLKNAAQHRKFQCIvmenspenkgHELAVSLAKSKIqtvlipdsamfGLISRVNKIIIGTHTvmangglrsvcGTHAVALAAqhysipypctFLLNIGI
mpkeiksksqeddnyQESLHKLVVSSDDEATDFANPTSDTAPSQACEHIHSNEIILTLGYSKIVELFLKNAAQHRKFQCIVMENSPENKGHELAVSLAKSKIQTVLIPDSAMFGLISRVNKIIIGTHTVMANGGLRSVCGTHAVALAAQHYSIPYPCTFLLNIGI
MPKEIKSKSQEDDNYQESLHKLVVSSDDEATDFANPTSDTAPSQACEHIHSNEIILTLGYSKIVELFLKNAAQHRKFQCIVMENSPENKGHELAVSLAKSKIQTVLIPDSAMFGLISRVNKIIIGTHTVMANGGLRSVCGTHAVALAAQHYSIPYPCTFLLNIGI
*********************************************CEHIHSNEIILTLGYSKIVELFLKNAAQHRKFQCIVME*******HELAVSLAKSKIQTVLIPDSAMFGLISRVNKIIIGTHTVMANGGLRSVCGTHAVALAAQHYSIPYPCTFLLNI**
*********************LVVSSDDEATDFANPTSDTAPSQACEHIHSNEIILTLGYSKIVELFLKNAAQHRKFQCIVMENSPENKGHELAVSLAKSKIQTVLIPDSAMFGLISRVNKIIIGTHTVMANGGLRSVCGTHAVALAAQHYSIPYPCTFLLNIGI
****************ESLHKLVVSSDD****************ACEHIHSNEIILTLGYSKIVELFLKNAAQHRKFQCIVMENSPENKGHELAVSLAKSKIQTVLIPDSAMFGLISRVNKIIIGTHTVMANGGLRSVCGTHAVALAAQHYSIPYPCTFLLNIGI
MPKEIKSKSQEDDNYQESLHKLVVSSDDEATDFANPTSDTAPSQACEHIHSNEIILTLGYSKIVELFLKNAAQHRKFQCIVMENSPENKGHELAVSLAKSKIQTVLIPDSAMFGLISRVNKIIIGTHTVMANGGLRSVCGTHAVALAAQHYSIPYPCTFLLNIGI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPKEIKSKSQEDDNYQESLHKLVVSSDDEATDFANPTSDTAPSQACEHIHSNEIILTLGYSKIVELFLKNAAQHRKFQCIVMENSPENKGHELAVSLAKSKIQTVLIPDSAMFGLISRVNKIIIGTHTVMANGGLRSVCGTHAVALAAQHYSIPYPCTFLLNIGI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query165 2.2.26 [Sep-21-2011]
Q99LD9351 Translation initiation fa yes N/A 0.903 0.424 0.482 8e-37
Q5E9B4351 Translation initiation fa yes N/A 0.903 0.424 0.464 1e-36
Q90511355 Translation initiation fa N/A N/A 0.884 0.411 0.485 3e-36
P49770351 Translation initiation fa yes N/A 0.903 0.424 0.464 9e-36
Q28690351 Translation initiation fa yes N/A 0.903 0.424 0.464 9e-36
Q62818351 Translation initiation fa yes N/A 0.903 0.424 0.458 1e-35
Q54EY2388 Translation initiation fa yes N/A 0.933 0.396 0.481 2e-34
Q9UT76393 Probable translation init yes N/A 0.824 0.346 0.420 9e-26
P32502381 Translation initiation fa yes N/A 0.666 0.288 0.422 4e-14
P14741305 Translation initiation fa no N/A 0.672 0.363 0.330 2e-12
>sp|Q99LD9|EI2BB_MOUSE Translation initiation factor eIF-2B subunit beta OS=Mus musculus GN=Eif2b2 PE=2 SV=1 Back     alignment and function desciption
 Score =  152 bits (385), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 113/170 (66%), Gaps = 21/170 (12%)

Query: 5   IKSKSQEDDNYQESLHKLVVS---SDDEATDFA-----------------NPTSDTAPSQ 44
           +  +S E D  QESLHKL+ S   S+D +  FA                   T +   +Q
Sbjct: 96  LHGRSDESDQ-QESLHKLLTSGGLSEDFSFHFAPLKANIIEAINELLVELEGTMENIAAQ 154

Query: 45  ACEHIHSNEIILTLGYSKIVELFLKNAAQHRKFQCIVMENSPENKGHELAVSLAKSKIQT 104
           A EHIHSNE+I+T+GYS+ VE FLK AA+ RKF  IV E +P  +GHE+AV+L+K  I+T
Sbjct: 155 ALEHIHSNEVIMTIGYSRTVEAFLKEAARKRKFHVIVAECAPFCQGHEMAVNLSKEGIET 214

Query: 105 VLIPDSAMFGLISRVNKIIIGTHTVMANGGLRSVCGTHAVALAAQHYSIP 154
            ++ D+A+F ++SRVNK+IIGT T++ANG LR+V GTH +ALAA+H+S P
Sbjct: 215 TVMTDAAIFAVMSRVNKVIIGTKTILANGSLRAVAGTHTLALAAKHHSTP 264
Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.
Mus musculus (taxid: 10090)
>sp|Q5E9B4|EI2BB_BOVIN Translation initiation factor eIF-2B subunit beta OS=Bos taurus GN=EIF2B2 PE=2 SV=1 Back     alignment and function description
>sp|Q90511|EI2BB_TAKRU Translation initiation factor eIF-2B subunit beta OS=Takifugu rubripes GN=eif2b2 PE=3 SV=1 Back     alignment and function description
>sp|P49770|EI2BB_HUMAN Translation initiation factor eIF-2B subunit beta OS=Homo sapiens GN=EIF2B2 PE=1 SV=3 Back     alignment and function description
>sp|Q28690|EI2BB_RABIT Translation initiation factor eIF-2B subunit beta OS=Oryctolagus cuniculus GN=EIF2B2 PE=1 SV=1 Back     alignment and function description
>sp|Q62818|EI2BB_RAT Translation initiation factor eIF-2B subunit beta OS=Rattus norvegicus GN=Eif2b2 PE=2 SV=1 Back     alignment and function description
>sp|Q54EY2|EI2BB_DICDI Translation initiation factor eIF-2B subunit beta OS=Dictyostelium discoideum GN=eif2b2 PE=3 SV=1 Back     alignment and function description
>sp|Q9UT76|EI2BB_SCHPO Probable translation initiation factor eIF-2B subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif222 PE=1 SV=1 Back     alignment and function description
>sp|P32502|EI2BB_YEAST Translation initiation factor eIF-2B subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCD7 PE=1 SV=1 Back     alignment and function description
>sp|P14741|EI2BA_YEAST Translation initiation factor eIF-2B subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query165
307191274 353 Translation initiation factor eIF-2B sub 0.909 0.424 0.511 3e-39
48097608 353 PREDICTED: translation initiation factor 0.909 0.424 0.505 7e-39
380024753 353 PREDICTED: translation initiation factor 0.909 0.424 0.505 7e-39
383862501 353 PREDICTED: translation initiation factor 0.909 0.424 0.505 7e-39
321469197 350 hypothetical protein DAPPUDRAFT_304186 [ 0.909 0.428 0.470 9e-39
307209221 353 Translation initiation factor eIF-2B sub 0.909 0.424 0.505 1e-38
332019810 354 Translation initiation factor eIF-2B sub 0.890 0.415 0.514 2e-38
156552890 352 PREDICTED: translation initiation factor 0.884 0.414 0.488 3e-38
291242163 351 PREDICTED: eukaryotic translation initia 0.890 0.418 0.505 7e-38
157111327 353 translation initiation factor eif-2b bet 0.872 0.407 0.487 1e-37
>gi|307191274|gb|EFN74921.1| Translation initiation factor eIF-2B subunit beta [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  166 bits (420), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 114/172 (66%), Gaps = 22/172 (12%)

Query: 4   EIKSKSQEDDNYQESLHKLVVSSDDEATDFAN--PTSDTA-------------------P 42
           E+K+K++E D  QESLHK++ + +D+  DF    P+  +A                    
Sbjct: 93  ELKNKTEETDP-QESLHKILTAENDQQIDFNTSVPSLKSALLEHIVEFETELETCLENIT 151

Query: 43  SQACEHIHSNEIILTLGYSKIVELFLKNAAQHRKFQCIVMENSPENKGHELAVSLAKSKI 102
            QA EHIHSNEII+T+G SK+VE F K AA  R F  IV E  P   GHE+AV+LAK+KI
Sbjct: 152 EQASEHIHSNEIIMTIGKSKLVEEFFKKAASTRAFDVIVAEGGPFLNGHEMAVNLAKAKI 211

Query: 103 QTVLIPDSAMFGLISRVNKIIIGTHTVMANGGLRSVCGTHAVALAAQHYSIP 154
           +T LI D A+F ++SRVNK+IIGTHTVMANGGLR++ G H VA AA+HYS+P
Sbjct: 212 KTTLISDVAIFAMMSRVNKVIIGTHTVMANGGLRAISGVHTVAQAAKHYSVP 263

Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|48097608|ref|XP_393835.1| PREDICTED: translation initiation factor eIF-2B subunit beta [Apis mellifera] Back     alignment and taxonomy information
>gi|380024753|ref|XP_003696156.1| PREDICTED: translation initiation factor eIF-2B subunit beta-like [Apis florea] Back     alignment and taxonomy information
>gi|383862501|ref|XP_003706722.1| PREDICTED: translation initiation factor eIF-2B subunit beta-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|321469197|gb|EFX80178.1| hypothetical protein DAPPUDRAFT_304186 [Daphnia pulex] Back     alignment and taxonomy information
>gi|307209221|gb|EFN86328.1| Translation initiation factor eIF-2B subunit beta [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332019810|gb|EGI60271.1| Translation initiation factor eIF-2B subunit beta [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|156552890|ref|XP_001600995.1| PREDICTED: translation initiation factor eIF-2B subunit beta [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|291242163|ref|XP_002740976.1| PREDICTED: eukaryotic translation initiation factor 2B, subunit 2 beta, 39kDa-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|157111327|ref|XP_001651487.1| translation initiation factor eif-2b beta subunit [Aedes aegypti] gi|94469338|gb|ABF18518.1| translation initiation factor 2B beta subunit [Aedes aegypti] gi|108878428|gb|EAT42653.1| AAEL005825-PA [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query165
MGI|MGI:2145118351 Eif2b2 "eukaryotic translation 0.715 0.336 0.567 1.3e-36
ZFIN|ZDB-GENE-040426-2605355 eif2b2 "eukaryotic translation 0.921 0.428 0.503 4e-35
UNIPROTKB|F1NAP1351 EIF2B2 "Uncharacterized protei 0.830 0.390 0.525 4.1e-33
UNIPROTKB|F1S2R7351 EIF2B2 "Uncharacterized protei 0.884 0.415 0.472 6.7e-33
UNIPROTKB|Q90511355 eif2b2 "Translation initiation 0.921 0.428 0.477 6.7e-33
DICTYBASE|DDB_G0291271388 eif2b2 "translation initiation 0.933 0.396 0.481 8.5e-33
UNIPROTKB|Q5E9B4351 EIF2B2 "Translation initiation 0.884 0.415 0.465 1.1e-32
UNIPROTKB|P49770351 EIF2B2 "Translation initiation 0.872 0.410 0.482 1.8e-32
UNIPROTKB|Q28690351 EIF2B2 "Translation initiation 0.872 0.410 0.482 4.7e-32
RGD|620820351 Eif2b2 "eukaryotic translation 0.872 0.410 0.468 6e-32
MGI|MGI:2145118 Eif2b2 "eukaryotic translation initiation factor 2B, subunit 2 beta" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 357 (130.7 bits), Expect = 1.3e-36, Sum P(2) = 1.3e-36
 Identities = 67/118 (56%), Positives = 93/118 (78%)

Query:    37 TSDTAPSQACEHIHSNEIILTLGYSKIVELFLKNAAQHRKFQCIVMENSPENKGHELAVS 96
             T +   +QA EHIHSNE+I+T+GYS+ VE FLK AA+ RKF  IV E +P  +GHE+AV+
Sbjct:   147 TMENIAAQALEHIHSNEVIMTIGYSRTVEAFLKEAARKRKFHVIVAECAPFCQGHEMAVN 206

Query:    97 LAKSKIQTVLIPDSAMFGLISRVNKIIIGTHTVMANGGLRSVCGTHAVALAAQHYSIP 154
             L+K  I+T ++ D+A+F ++SRVNK+IIGT T++ANG LR+V GTH +ALAA+H+S P
Sbjct:   207 LSKEGIETTVMTDAAIFAVMSRVNKVIIGTKTILANGSLRAVAGTHTLALAAKHHSTP 264
GO:0001541 "ovarian follicle development" evidence=ISO
GO:0003743 "translation initiation factor activity" evidence=IEA
GO:0005085 "guanyl-nucleotide exchange factor activity" evidence=ISO;IBA
GO:0005524 "ATP binding" evidence=ISO
GO:0005525 "GTP binding" evidence=ISO
GO:0005737 "cytoplasm" evidence=ISO;IBA
GO:0005851 "eukaryotic translation initiation factor 2B complex" evidence=ISO;IBA
GO:0006412 "translation" evidence=IEA
GO:0006413 "translational initiation" evidence=ISO
GO:0006446 "regulation of translational initiation" evidence=IBA
GO:0007417 "central nervous system development" evidence=ISO
GO:0009408 "response to heat" evidence=ISO
GO:0009749 "response to glucose stimulus" evidence=ISO
GO:0014003 "oligodendrocyte development" evidence=ISO
GO:0042552 "myelination" evidence=ISO
GO:0043434 "response to peptide hormone stimulus" evidence=ISO
GO:0044237 "cellular metabolic process" evidence=IEA
GO:0051716 "cellular response to stimulus" evidence=ISO
ZFIN|ZDB-GENE-040426-2605 eif2b2 "eukaryotic translation initiation factor 2B, subunit 2 beta" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NAP1 EIF2B2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1S2R7 EIF2B2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q90511 eif2b2 "Translation initiation factor eIF-2B subunit beta" [Takifugu rubripes (taxid:31033)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0291271 eif2b2 "translation initiation factor eIF-2B beta subunit" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q5E9B4 EIF2B2 "Translation initiation factor eIF-2B subunit beta" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P49770 EIF2B2 "Translation initiation factor eIF-2B subunit beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q28690 EIF2B2 "Translation initiation factor eIF-2B subunit beta" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
RGD|620820 Eif2b2 "eukaryotic translation initiation factor 2B, subunit 2 beta" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query165
pfam01008281 pfam01008, IF-2B, Initiation factor 2 subunit fami 4e-31
COG1184301 COG1184, GCD2, Translation initiation factor 2B su 6e-29
PRK06372253 PRK06372, PRK06372, translation initiation factor 4e-10
PRK08535310 PRK08535, PRK08535, translation initiation factor 1e-09
PRK08335275 PRK08335, PRK08335, translation initiation factor 7e-09
TIGR00511301 TIGR00511, ribulose_e2b2, ribose-1,5-bisphosphate 5e-08
TIGR00524303 TIGR00524, eIF-2B_rel, eIF-2B alpha/beta/delta-rel 1e-06
COG0182346 COG0182, COG0182, Predicted translation initiation 6e-06
TIGR00512331 TIGR00512, salvage_mtnA, S-methyl-5-thioribose-1-p 7e-06
PRK05720344 PRK05720, mtnA, methylthioribose-1-phosphate isome 4e-04
>gnl|CDD|216240 pfam01008, IF-2B, Initiation factor 2 subunit family Back     alignment and domain information 
 Score =  112 bits (283), Expect = 4e-31
 Identities = 39/117 (33%), Positives = 65/117 (55%), Gaps = 2/117 (1%)

Query: 44  QACEHIHSNEIILTLGYSKIVELFLKNAAQH-RKFQCIVMENSPENKGHELAVSLAKSKI 102
            A E I   + ILT   S  V   L+ A +  ++F+ IV E+ P  +G   A  L ++ I
Sbjct: 100 IAAELIKDGDTILTHCNSGTVLGVLRAAHKEGKRFRVIVTESRPRLQGRLTAKELVQAGI 159

Query: 103 QTVLIPDSAMFGLISRVNKIIIGTHTVMANGGLRSVCGTHAVALAAQHYSIP-YPCT 158
              LI DSA+  ++  V+K+I+G   ++ANGG+ +  GT+ +AL A+ +++P Y   
Sbjct: 160 PVTLITDSAVGYVMQEVDKVIVGADRILANGGIANKIGTYQLALLAKAHNVPFYVVA 216

This family includes initiation factor 2B alpha, beta and delta subunits from eukaryotes, initiation factor 2B subunits 1 and 2 from archaebacteria and some proteins of unknown function from prokaryotes. Initiation factor 2 binds to Met-tRNA, GTP and the small ribosomal subunit. Members of this family have also been characterized as 5-methylthioribose- 1-phosphate isomerases, an enzyme of the methionine salvage pathway. The crystal structure of Ypr118w, a non-essential, low-copy number gene product from Saccharomyces cerevisiae, reveals a dimeric protein with two domains and a putative active site cleft. Length = 281
>gnl|CDD|224105 COG1184, GCD2, Translation initiation factor 2B subunit, eIF-2B alpha/beta/delta family [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|235788 PRK06372, PRK06372, translation initiation factor IF-2B subunit delta; Provisional Back     alignment and domain information
>gnl|CDD|236282 PRK08535, PRK08535, translation initiation factor IF-2B subunit delta; Provisional Back     alignment and domain information
>gnl|CDD|169387 PRK08335, PRK08335, translation initiation factor IF-2B subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|188057 TIGR00511, ribulose_e2b2, ribose-1,5-bisphosphate isomerase, e2b2 family Back     alignment and domain information
>gnl|CDD|233008 TIGR00524, eIF-2B_rel, eIF-2B alpha/beta/delta-related uncharacterized proteins Back     alignment and domain information
>gnl|CDD|223260 COG0182, COG0182, Predicted translation initiation factor 2B subunit, eIF-2B alpha/beta/delta family [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|233003 TIGR00512, salvage_mtnA, S-methyl-5-thioribose-1-phosphate isomerase Back     alignment and domain information
>gnl|CDD|235578 PRK05720, mtnA, methylthioribose-1-phosphate isomerase; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 165
PRK08335275 translation initiation factor IF-2B subunit alpha; 100.0
TIGR00511301 ribulose_e2b2 ribose-1,5-bisphosphate isomerase, e 100.0
PRK08535310 translation initiation factor IF-2B subunit delta; 100.0
PF01008282 IF-2B: Initiation factor 2 subunit family; InterPr 100.0
COG1184301 GCD2 Translation initiation factor 2B subunit, eIF 100.0
TIGR00524303 eIF-2B_rel eIF-2B alpha/beta/delta-related unchara 100.0
KOG1465|consensus353 100.0
KOG1466|consensus313 100.0
PRK05720344 mtnA methylthioribose-1-phosphate isomerase; Revie 100.0
TIGR00512331 salvage_mtnA S-methyl-5-thioribose-1-phosphate iso 100.0
PRK06036339 translation initiation factor IF-2B subunit alpha; 100.0
PRK06371329 translation initiation factor IF-2B subunit alpha; 100.0
PRK06372253 translation initiation factor IF-2B subunit delta; 100.0
PRK05772363 translation initiation factor IF-2B subunit alpha; 100.0
PRK08334356 translation initiation factor IF-2B subunit beta; 100.0
KOG1467|consensus556 100.0
COG0182346 Predicted translation initiation factor 2B subunit 99.97
KOG1468|consensus354 99.92
PRK00702220 ribose-5-phosphate isomerase A; Provisional 97.95
TIGR00021218 rpiA ribose 5-phosphate isomerase. This model desc 97.89
cd01398213 RPI_A RPI_A: Ribose 5-phosphate isomerase type A ( 97.86
PF00455161 DeoRC: DeoR C terminal sensor domain; InterPro: IP 97.86
PRK10434256 srlR DNA-bindng transcriptional repressor SrlR; Pr 97.75
PRK09802269 DNA-binding transcriptional regulator AgaR; Provis 97.57
PRK10906252 DNA-binding transcriptional repressor GlpR; Provis 97.54
PRK10681252 DNA-binding transcriptional repressor DeoR; Provis 97.33
PRK13509251 transcriptional repressor UlaR; Provisional 97.26
PRK10411240 DNA-binding transcriptional activator FucR; Provis 97.06
COG1349253 GlpR Transcriptional regulators of sugar metabolis 96.79
PLN02384 264 ribose-5-phosphate isomerase 96.46
PRK13978 228 ribose-5-phosphate isomerase A; Provisional 96.4
KOG0259|consensus 447 95.04
COG0120 227 RpiA Ribose 5-phosphate isomerase [Carbohydrate tr 95.02
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 94.49
PF1008797 DUF2325: Uncharacterized protein conserved in bact 91.09
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.63
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.24
PRK09496 453 trkA potassium transporter peripheral membrane com 89.08
PRK09136245 5'-methylthioadenosine phosphorylase; Validated 87.7
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.56
PF01073 280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 87.24
cd00287196 ribokinase_pfkB_like ribokinase/pfkB superfamily: 86.92
PRK05839 374 hypothetical protein; Provisional 86.78
PF05368 233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 86.32
COG4635175 HemG Flavodoxin [Energy production and conversion 86.21
TIGR03235 353 DNA_S_dndA cysteine desulfurase DndA. This model d 85.46
PF00535169 Glycos_transf_2: Glycosyl transferase family 2; In 85.06
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 84.94
TIGR01140 330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 84.61
cd01424110 MGS_CPS_II Methylglyoxal synthase-like domain from 84.57
PRK00025380 lpxB lipid-A-disaccharide synthase; Reviewed 84.31
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 84.29
PRK07582 366 cystathionine gamma-lyase; Validated 84.09
TIGR03539 357 DapC_actino succinyldiaminopimelate transaminase. 84.02
PLN02651 364 cysteine desulfurase 83.47
CHL00144327 odpB pyruvate dehydrogenase E1 component beta subu 83.27
PTZ00433 412 tyrosine aminotransferase; Provisional 82.91
COG2057225 AtoA Acyl CoA:acetate/3-ketoacid CoA transferase, 82.59
cd06451 356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 82.4
TIGR01979 403 sufS cysteine desulfurases, SufS subfamily. This m 82.24
cd06453 373 SufS_like Cysteine desulfurase (SufS)-like. This f 82.17
PRK10874 401 cysteine sulfinate desulfinase; Provisional 82.11
PRK13520 371 L-tyrosine decarboxylase; Provisional 81.96
cd01989146 STK_N The N-terminal domain of Eukaryotic Serine T 81.94
PRK07810 403 O-succinylhomoserine sulfhydrylase; Provisional 81.89
cd00613 398 GDC-P Glycine cleavage system P-protein, alpha- an 81.82
PRK08133 390 O-succinylhomoserine sulfhydrylase; Validated 81.62
PRK00421 461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 81.36
PLN02206 442 UDP-glucuronate decarboxylase 81.35
PRK03803 448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 81.14
PRK05764 393 aspartate aminotransferase; Provisional 80.97
PRK07765 214 para-aminobenzoate synthase component II; Provisio 80.85
COG0373 414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 80.73
TIGR02006 402 IscS cysteine desulfurase IscS. This model represe 80.65
PRK08134 433 O-acetylhomoserine aminocarboxypropyltransferase; 80.58
PRK07568 397 aspartate aminotransferase; Provisional 80.47
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 80.3
PRK05613 437 O-acetylhomoserine aminocarboxypropyltransferase; 80.03
>PRK08335 translation initiation factor IF-2B subunit alpha; Validated Back     alignment and domain information 
Probab=100.00  E-value=4.3e-41  Score=283.21  Aligned_cols=129  Identities=22%  Similarity=0.316  Sum_probs=125.2

Q ss_pred             ChHHHHHHHHHHhcccCCCCEEEEecCCHHHHHHHHHHHh-CCceEEEEecCCCCChHHHHHHHHhhcCCceEEEccchH
Q psy2575          34 ANPTSDTAPSQACEHIHSNEIILTLGYSKIVELFLKNAAQ-HRKFQCIVMENSPENKGHELAVSLAKSKIQTVLIPDSAM  112 (165)
Q Consensus        34 ~~~~~~~Ia~~a~~~I~~~~~ILT~g~S~tV~~~L~~A~~-~~~f~ViV~Es~P~~eG~~la~~L~~~GI~v~~I~dsav  112 (165)
                      ..+++++|++++.++|++|++|||||+|+||+++|..|++ +++|+|||+||||.+||.+||++|.+.||||++|+|+++
T Consensus        92 ~~~~~~~I~~~a~~~I~~g~~ILTh~~S~tv~~~l~~A~~~gk~~~V~v~EsrP~~qG~~la~eL~~~GI~vtlI~Dsa~  171 (275)
T PRK08335         92 MEEAKREIGNIGSELIDDGDVIITHSFSSAVLEILKTAKRKGKRFKVILTESAPDYEGLALANELEFLGIEFEVITDAQL  171 (275)
T ss_pred             HHHHHHHHHHHHHHHcCCCCEEEEECCcHHHHHHHHHHHHcCCceEEEEecCCCchhHHHHHHHHHHCCCCEEEEeccHH
Confidence            4677999999999999999999999999999999999997 899999999999999999999999999999999999999


Q ss_pred             HHhchhCCEEEEccceeecCCCeeehhcHHHHHHHHhhCCCcEEEEeecc
Q psy2575         113 FGLISRVNKIIIGTHTVMANGGLRSVCGTHAVALAAQHYSIPYPCTFLLN  162 (165)
Q Consensus       113 ~~~m~~v~~VllGAd~V~~nG~vvnk~GT~~lAl~Ak~~~vPv~V~~~~~  162 (165)
                      +++|+++|+|++|||+|++||+++||+|||++|++||+|+|||||+||+.
T Consensus       172 ~~~m~~vd~VivGAD~I~~nG~v~NKiGT~~lA~~Ak~~~vPfyV~a~~~  221 (275)
T PRK08335        172 GLFAKEATLALVGADNVTRDGYVVNKAGTYLLALACHDNGVPFYVAAETF  221 (275)
T ss_pred             HHHHHhCCEEEECccEEecCCCEeehhhHHHHHHHHHHcCCCEEEECccc
Confidence            99999999999999999999999999999999999999999999999863

>TIGR00511 ribulose_e2b2 ribose-1,5-bisphosphate isomerase, e2b2 family Back     alignment and domain information
>PRK08535 translation initiation factor IF-2B subunit delta; Provisional Back     alignment and domain information
>PF01008 IF-2B: Initiation factor 2 subunit family; InterPro: IPR000649 Initiation factor 2 binds to Met-tRNA, GTP and the small ribosomal subunit Back     alignment and domain information
>COG1184 GCD2 Translation initiation factor 2B subunit, eIF-2B alpha/beta/delta family [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00524 eIF-2B_rel eIF-2B alpha/beta/delta-related uncharacterized proteins Back     alignment and domain information
>KOG1465|consensus Back     alignment and domain information
>KOG1466|consensus Back     alignment and domain information
>PRK05720 mtnA methylthioribose-1-phosphate isomerase; Reviewed Back     alignment and domain information
>TIGR00512 salvage_mtnA S-methyl-5-thioribose-1-phosphate isomerase Back     alignment and domain information
>PRK06036 translation initiation factor IF-2B subunit alpha; Provisional Back     alignment and domain information
>PRK06371 translation initiation factor IF-2B subunit alpha; Provisional Back     alignment and domain information
>PRK06372 translation initiation factor IF-2B subunit delta; Provisional Back     alignment and domain information
>PRK05772 translation initiation factor IF-2B subunit alpha; Provisional Back     alignment and domain information
>PRK08334 translation initiation factor IF-2B subunit beta; Validated Back     alignment and domain information
>KOG1467|consensus Back     alignment and domain information
>COG0182 Predicted translation initiation factor 2B subunit, eIF-2B alpha/beta/delta family [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1468|consensus Back     alignment and domain information
>PRK00702 ribose-5-phosphate isomerase A; Provisional Back     alignment and domain information
>TIGR00021 rpiA ribose 5-phosphate isomerase Back     alignment and domain information
>cd01398 RPI_A RPI_A: Ribose 5-phosphate isomerase type A (RPI_A) subfamily; RPI catalyzes the reversible conversion of ribose-5-phosphate to ribulose 5-phosphate, the first step of the non-oxidative branch of the pentose phosphate pathway Back     alignment and domain information
>PF00455 DeoRC: DeoR C terminal sensor domain; InterPro: IPR014036 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information
>PRK10434 srlR DNA-bindng transcriptional repressor SrlR; Provisional Back     alignment and domain information
>PRK09802 DNA-binding transcriptional regulator AgaR; Provisional Back     alignment and domain information
>PRK10906 DNA-binding transcriptional repressor GlpR; Provisional Back     alignment and domain information
>PRK10681 DNA-binding transcriptional repressor DeoR; Provisional Back     alignment and domain information
>PRK13509 transcriptional repressor UlaR; Provisional Back     alignment and domain information
>PRK10411 DNA-binding transcriptional activator FucR; Provisional Back     alignment and domain information
>COG1349 GlpR Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02384 ribose-5-phosphate isomerase Back     alignment and domain information
>PRK13978 ribose-5-phosphate isomerase A; Provisional Back     alignment and domain information
>KOG0259|consensus Back     alignment and domain information
>COG0120 RpiA Ribose 5-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK09136 5'-methylthioadenosine phosphorylase; Validated Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>cd00287 ribokinase_pfkB_like ribokinase/pfkB superfamily: Kinases that accept a wide variety of substrates, including carbohydrates and aromatic small molecules, all are phosphorylated at a hydroxyl group Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>COG4635 HemG Flavodoxin [Energy production and conversion / Coenzyme metabolism] Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>PF00535 Glycos_transf_2: Glycosyl transferase family 2; InterPro: IPR001173 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>cd01424 MGS_CPS_II Methylglyoxal synthase-like domain from type II glutamine-dependent carbamoyl phosphate synthetase (CSP) Back     alignment and domain information
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>CHL00144 odpB pyruvate dehydrogenase E1 component beta subunit; Validated Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>COG2057 AtoA Acyl CoA:acetate/3-ketoacid CoA transferase, beta subunit [Lipid metabolism] Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>cd01989 STK_N The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07765 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query165
1vb5_A276 Crystal Structure Analysis Of The Pyrococcus Horiko 1e-07
3ecs_A315 Crystal Structure Of Human Eif2b Alpha Length = 315 3e-07
3vm6_A338 Crystal Structure Of Ribose-1,5-Bisphosphate Isomer 2e-06
3a11_A338 Crystal Structure Of Ribose-1,5-Bisphosphate Isomer 4e-06
3a9c_F323 Crystal Structure Of Ribose-1,5-Bisphosphate Isomer 4e-05
3a9c_A321 Crystal Structure Of Ribose-1,5-Bisphosphate Isomer 4e-05
3a9c_E322 Crystal Structure Of Ribose-1,5-Bisphosphate Isomer 4e-05
3a9c_B326 Crystal Structure Of Ribose-1,5-Bisphosphate Isomer 4e-05
1t5o_A351 Crystal Structure Of The Translation Initiation Fac 5e-05
>pdb|1VB5|A Chain A, Crystal Structure Analysis Of The Pyrococcus Horikoshii Ot3 Translation Initiation Factor Eif-2b Length = 276 Back     alignment and structure 
Iteration: 1

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 62/115 (53%), Gaps = 3/115 (2%)
Query: 43  SQACEHIHSNEIILTLGYSKIVELFLKNAAQHRK-FQCIVMENSPENKGHELAVSLAKSK 101
           S   + I   ++I+T  +S  V   ++ A + +K F+ I+ E+SP+ +G  LA  L  S 
Sbjct: 101 SIGAQLIDDGDVIITHSFSSTVLEIIRTAKERKKRFKVILTESSPDYEGLHLARELEFSG 160
Query: 102 IQTVLIPDSAMFGLISRVNKI-IIGTHTVMANGGLRSVCGTHAVALAAQHYSIPY 155
           I+  +I D+ M GL  R   I I+G   +  +G + +  GT+ +ALA    +IP+
Sbjct: 161 IEFEVITDAQM-GLFCREASIAIVGADMITKDGYVVNKAGTYLLALACHENAIPF 214
>pdb|3ECS|A Chain A, Crystal Structure Of Human Eif2b Alpha Length = 315 Back     alignment and structure
>pdb|3VM6|A Chain A, Crystal Structure Of Ribose-1,5-Bisphosphate Isomerase From Thermococcus Kodakarensis Kod1 In Complex With Alpha-D-Ribose-1,5- Bisphosphate Length = 338 Back     alignment and structure
>pdb|3A11|A Chain A, Crystal Structure Of Ribose-1,5-Bisphosphate Isomerase From Thermococcus Kodakaraensis Kod1 Length = 338 Back     alignment and structure
>pdb|1T5O|A Chain A, Crystal Structure Of The Translation Initiation Factor Eif-2b, Subunit Delta, From A. Fulgidus Length = 351 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query165
3ecs_A315 Translation initiation factor EIF-2B subunit alpha 3e-37
1vb5_A276 Translation initiation factor EIF-2B; 2.20A {Pyroc 3e-13
3a11_A338 Translation initiation factor EIF-2B, delta subun; 9e-10
1t9k_A347 Probable methylthioribose-1-phosphate isomerase; s 5e-07
2yvk_A374 Methylthioribose-1-phosphate isomerase; methionine 6e-07
1t5o_A351 EIF2BD, translation initiation factor EIF2B, subun 7e-07
2a0u_A383 Initiation factor 2B; SGPP, structural genomics, P 2e-05
1w2w_B191 5-methylthioribose-1-phosphate isomerase; EIF2B, m 7e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>3ecs_A Translation initiation factor EIF-2B subunit alpha; eukaryotic translation initiation factor 2balpha (EIF2balpha); 2.65A {Homo sapiens} Length = 315 Back     alignment and structure
 Score =  129 bits (325), Expect = 3e-37
 Identities = 29/112 (25%), Positives = 58/112 (51%), Gaps = 1/112 (0%)

Query: 44  QACEHIHSNEIILTLGYSKIVELFLKNAA-QHRKFQCIVMENSPENKGHELAVSLAKSKI 102
                I     ILT  YS++V   L+ A    ++F   V E+ P+  G ++A +L    +
Sbjct: 114 LCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNV 173

Query: 103 QTVLIPDSAMFGLISRVNKIIIGTHTVMANGGLRSVCGTHAVALAAQHYSIP 154
              ++ D+A+  ++ + + +I+G   V+ NGG+ +  GT+ +A+ A+  + P
Sbjct: 174 PVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKP 225
>1vb5_A Translation initiation factor EIF-2B; 2.20A {Pyrococcus horikoshii} SCOP: c.124.1.5 Length = 276 Back     alignment and structure
>3a11_A Translation initiation factor EIF-2B, delta subun; isomerase, hexamer, rossmann fold; 2.50A {Thermococcus kodakaraensis} PDB: 3a9c_A* 3vm6_A* Length = 338 Back     alignment and structure
>1t9k_A Probable methylthioribose-1-phosphate isomerase; structural genomics, translation initiation factor, AIF-2B subunit, PSI; 2.60A {Thermotoga maritima} SCOP: c.124.1.5 Length = 347 Back     alignment and structure
>2yvk_A Methylthioribose-1-phosphate isomerase; methionine salvage pathway,; HET: MRU; 2.40A {Bacillus subtilis} PDB: 2yrf_A* Length = 374 Back     alignment and structure
>1t5o_A EIF2BD, translation initiation factor EIF2B, subunit DELT; subunit delta, structural GEN PSI, protein structure initiative; 1.90A {Archaeoglobus fulgidus} SCOP: c.124.1.5 Length = 351 Back     alignment and structure
>2a0u_A Initiation factor 2B; SGPP, structural genomics, PSI, protein structure initiative eukaryotic initiation factor; 2.10A {Leishmania major} SCOP: c.124.1.5 Length = 383 Back     alignment and structure
>1w2w_B 5-methylthioribose-1-phosphate isomerase; EIF2B, methionine salvage pathway, translation initiation, oxidoreductase; 1.75A {Saccharomyces cerevisiae} SCOP: c.124.1.5 Length = 191 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query165
3a11_A338 Translation initiation factor EIF-2B, delta subun; 100.0
3ecs_A315 Translation initiation factor EIF-2B subunit alpha 100.0
1t9k_A347 Probable methylthioribose-1-phosphate isomerase; s 100.0
2yvk_A374 Methylthioribose-1-phosphate isomerase; methionine 100.0
1t5o_A351 EIF2BD, translation initiation factor EIF2B, subun 100.0
2a0u_A383 Initiation factor 2B; SGPP, structural genomics, P 100.0
1vb5_A276 Translation initiation factor EIF-2B; 2.20A {Pyroc 100.0
1w2w_B191 5-methylthioribose-1-phosphate isomerase; EIF2B, m 99.97
2f8m_A 244 Ribose 5-phosphate isomerase; structural genomics, 98.34
1uj6_A227 Ribose 5-phosphate isomerase; enzyme-inhibitor com 98.33
1lk5_A 229 D-ribose-5-phosphate isomerase; alpha/beta structu 98.27
1m0s_A219 Ribose-5-phosphate isomerase A; D-ribose 5-phospha 98.24
3kwm_A224 Ribose-5-phosphate isomerase A; structural genomic 98.01
1xtz_A 264 Ribose-5-phosphate isomerase; yeast; 2.10A {Saccha 97.96
3hhe_A 255 Ribose-5-phosphate isomerase A; niaid, ssgcid, dec 97.95
3l7o_A 225 Ribose-5-phosphate isomerase A; RPIA; 1.70A {Strep 97.89
1o8b_A219 Ribose 5-phosphate isomerase; RPIA, PSI, protein S 97.89
2pjm_A 226 Ribose-5-phosphate isomerase A; 3D-structure, stru 97.86
3uw1_A 239 Ribose-5-phosphate isomerase A; ssgcid, seattle st 97.49
1w2w_A211 5-methylthioribose-1-phosphate isomerase; EIF2B, m 96.8
4gmk_A228 Ribose-5-phosphate isomerase A; D-ribose-5-phospha 96.27
3ixq_A 226 Ribose-5-phosphate isomerase A; structural genomic 93.71
4dq6_A 391 Putative pyridoxal phosphate-dependent transferas; 92.55
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 90.89
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 89.98
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 89.7
3nbm_A108 PTS system, lactose-specific IIBC components; PTS_ 89.68
3dqp_A 219 Oxidoreductase YLBE; alpha-beta protein., structur 89.62
1o1y_A 239 Conserved hypothetical protein TM1158; flavodoxin- 89.29
3e8x_A 236 Putative NAD-dependent epimerase/dehydratase; stru 89.27
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 89.22
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 88.37
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 88.0
2w48_A315 Sorbitol operon regulator; SORC, activator, repres 87.99
3s3t_A146 Nucleotide-binding protein, universal stress PROT 87.98
3g0t_A 437 Putative aminotransferase; NP_905498.1, putative a 87.83
3dzz_A 391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 87.82
2h1q_A270 Hypothetical protein; ZP_00559375.1, structural ge 87.76
3eag_A 326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 86.37
3h14_A 391 Aminotransferase, classes I and II; YP_167802.1, S 86.21
3la8_A303 SMU.1229, putative purine nucleoside phosphorylase 86.19
3fdb_A 377 Beta C-S lyase, putative PLP-dependent beta-cystat 86.06
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 85.91
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 85.87
1yaa_A 412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 85.75
1qz9_A 416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 85.66
3npg_A249 Uncharacterized DUF364 family protein; protein wit 85.5
3rrl_A235 Succinyl-COA:3-ketoacid-coenzyme A transferase SU; 85.42
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 85.18
3isl_A 416 Purine catabolism protein PUCG; pyridoxalphosphate 84.81
1kmj_A 406 Selenocysteine lyase; persulfide perselenide NIFS 84.71
4adb_A 406 Succinylornithine transaminase; transferase, PLP e 84.65
2z61_A 370 Probable aspartate aminotransferase 2; amino acid 84.44
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 83.88
1eg5_A 384 Aminotransferase; PLP-dependent enzymes, iron-sulf 83.84
2aef_A 234 Calcium-gated potassium channel MTHK; rossmann fol 83.81
1c7n_A 399 Cystalysin; transferase, aminotransferase, pyridox 83.76
3c85_A183 Putative glutathione-regulated potassium-efflux S 83.35
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 83.34
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 83.32
3kax_A 383 Aminotransferase, classes I and II; PLP, C-S lyase 83.28
3ftb_A 361 Histidinol-phosphate aminotransferase; structural 83.23
1t3i_A 420 Probable cysteine desulfurase; PLP-binding enzyme, 83.22
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 83.12
2q7w_A 396 Aspartate aminotransferase; mechanism-based inhibi 83.1
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 82.95
2yvq_A143 Carbamoyl-phosphate synthase; conserved hypothetic 82.88
3dlo_A155 Universal stress protein; unknown function, struct 82.46
3ezs_A 376 Aminotransferase ASPB; NP_207418.1, structural gen 82.46
1k6d_A220 Acetate COA-transferase alpha subunit; structural 82.46
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 82.31
2ay1_A 394 Aroat, aromatic amino acid aminotransferase; HET: 82.27
4f4e_A 420 Aromatic-amino-acid aminotransferase; ssgcid, stru 82.18
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 82.16
7aat_A 401 Aspartate aminotransferase; transferase(aminotrans 81.96
3l8a_A 421 METC, putative aminotransferase, probable beta-cys 81.88
1lc5_A 364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 81.27
3qhx_A 392 Cystathionine gamma-synthase METB (CGS); structura 81.11
2a8y_A270 5'-methylthioadenosine phosphorylase (MTAP); alpha 80.75
1jeo_A180 MJ1247, hypothetical protein MJ1247; RUMP pathway, 80.52
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 80.26
1lnq_A 336 MTHK channels, potassium channel related protein; 80.06
2zc0_A 407 Alanine glyoxylate transaminase; alanine:glyoxylat 80.05
2z08_A137 Universal stress protein family; uncharacterized c 80.03
3jtx_A 396 Aminotransferase; NP_283882.1, structural genomics 80.02
>3a11_A Translation initiation factor EIF-2B, delta subun; isomerase, hexamer, rossmann fold; 2.50A {Thermococcus kodakaraensis} PDB: 3a9c_A* 3vm6_A* Back     alignment and structure
Probab=100.00  E-value=7e-41  Score=287.79  Aligned_cols=129  Identities=22%  Similarity=0.268  Sum_probs=125.0

Q ss_pred             ChHHHHHHHHHHhcccCCCCEEEEecCCHHHHHHHHHHHh-CCceEEEEecCCCCChHHHHHHHHhhcCCceEEEccchH
Q psy2575          34 ANPTSDTAPSQACEHIHSNEIILTLGYSKIVELFLKNAAQ-HRKFQCIVMENSPENKGHELAVSLAKSKIQTVLIPDSAM  112 (165)
Q Consensus        34 ~~~~~~~Ia~~a~~~I~~~~~ILT~g~S~tV~~~L~~A~~-~~~f~ViV~Es~P~~eG~~la~~L~~~GI~v~~I~dsav  112 (165)
                      ...++++|++++.++|++|++|||||+|+||+.+|+.|++ |++|+|||+||||.+||+.+|++|.+.||||++|+|+++
T Consensus       124 ~~~~~~~I~~~g~~~I~~g~~ILTh~~S~tvl~~l~~A~~~gk~~~V~v~EtRP~~qGrltA~eL~~~GI~vtlI~Dsa~  203 (338)
T 3a11_A          124 SEKALERIGEFGAKRIEDGDVIMTHCHSKAAISVMKTAWEQGKDIKVIVTETRPKWQGKITAKELASYGIPVIYVVDSAA  203 (338)
T ss_dssp             HHHHHHHHHHHHHTTCCTTCEEEECSCCHHHHHHHHHHHHTTCCCEEEEECCTTTTHHHHHHHHHHHTTCCEEEECGGGT
T ss_pred             HHHHHHHHHHHHHHHhCCCCEEEEeCCcHHHHHHHHHHHHCCCeEEEEEeCCCCchhhHHHHHHHHhCCCCEEEEehHHH
Confidence            3567999999999999999999999999999999999998 799999999999999999999999999999999999999


Q ss_pred             HHhchhCCEEEEccceeecCCCeeehhcHHHHHHHHhhCCCcEEEEeecc
Q psy2575         113 FGLISRVNKIIIGTHTVMANGGLRSVCGTHAVALAAQHYSIPYPCTFLLN  162 (165)
Q Consensus       113 ~~~m~~v~~VllGAd~V~~nG~vvnk~GT~~lAl~Ak~~~vPv~V~~~~~  162 (165)
                      +++|++||+|++|||+|++||+++||+|||++|++||+|+|||||+||+.
T Consensus       204 ~~~M~~Vd~VivGAd~V~anG~v~NKiGT~~lAl~Ak~~~vPfyV~a~~~  253 (338)
T 3a11_A          204 RHYMKMTDKVVMGADSITVNGAVINKIGTALIALTAKEHRVWTMIAAETY  253 (338)
T ss_dssp             TTTGGGCSEEEECCSEECTTSCEEEETTHHHHHHHHHHTTCEEEEECCGG
T ss_pred             HHHHHhCCEEEECccEEecCCCEeecccHHHHHHHHHHcCCCEEEecccc
Confidence            99999999999999999999999999999999999999999999999974
>3ecs_A Translation initiation factor EIF-2B subunit alpha; eukaryotic translation initiation factor 2balpha (EIF2balpha); 2.65A {Homo sapiens} Back     alignment and structure
>1t9k_A Probable methylthioribose-1-phosphate isomerase; structural genomics, translation initiation factor, AIF-2B subunit, PSI; 2.60A {Thermotoga maritima} SCOP: c.124.1.5 Back     alignment and structure
>2yvk_A Methylthioribose-1-phosphate isomerase; methionine salvage pathway,; HET: MRU; 2.40A {Bacillus subtilis} PDB: 2yrf_A* Back     alignment and structure
>1t5o_A EIF2BD, translation initiation factor EIF2B, subunit DELT; subunit delta, structural GEN PSI, protein structure initiative; 1.90A {Archaeoglobus fulgidus} SCOP: c.124.1.5 Back     alignment and structure
>2a0u_A Initiation factor 2B; SGPP, structural genomics, PSI, protein structure initiative eukaryotic initiation factor; 2.10A {Leishmania major} SCOP: c.124.1.5 Back     alignment and structure
>1vb5_A Translation initiation factor EIF-2B; 2.20A {Pyrococcus horikoshii} SCOP: c.124.1.5 Back     alignment and structure
>1w2w_B 5-methylthioribose-1-phosphate isomerase; EIF2B, methionine salvage pathway, translation initiation, oxidoreductase; 1.75A {Saccharomyces cerevisiae} SCOP: c.124.1.5 Back     alignment and structure
>2f8m_A Ribose 5-phosphate isomerase; structural genomics, PSI, protein structure initiative, STRU genomics of pathogenic protozoa consortium; 2.09A {Plasmodium falciparum} Back     alignment and structure
>1uj6_A Ribose 5-phosphate isomerase; enzyme-inhibitor complex, riken structural genomics/proteomi initiative, RSGI, structural genomics; HET: A5P; 1.74A {Thermus thermophilus} SCOP: c.124.1.4 d.58.40.1 PDB: 1uj5_A* 1uj4_A* Back     alignment and structure
>1lk5_A D-ribose-5-phosphate isomerase; alpha/beta structure; 1.75A {Pyrococcus horikoshii} SCOP: c.124.1.4 d.58.40.1 PDB: 1lk7_A* Back     alignment and structure
>1m0s_A Ribose-5-phosphate isomerase A; D-ribose 5-phosphate isomerase, northeast structural genomics consortium, IR21, structural genomics, PSI; HET: CIT; 1.90A {Haemophilus influenzae} SCOP: c.124.1.4 d.58.40.1 Back     alignment and structure
>3kwm_A Ribose-5-phosphate isomerase A; structural genomics, IDP02119, center for structu genomics of infectious diseases, csgid; 2.32A {Francisella tularensis subsp} Back     alignment and structure
>1xtz_A Ribose-5-phosphate isomerase; yeast; 2.10A {Saccharomyces cerevisiae} Back     alignment and structure
>3hhe_A Ribose-5-phosphate isomerase A; niaid, ssgcid, decode, SBRI, UW, STRU genomics, seattle structural genomics center for infectious; HET: 5RP; 2.30A {Bartonella henselae} Back     alignment and structure
>3l7o_A Ribose-5-phosphate isomerase A; RPIA; 1.70A {Streptococcus mutans} Back     alignment and structure
>1o8b_A Ribose 5-phosphate isomerase; RPIA, PSI, protein ST initiative, MCSG, midwest center for structural genomics; HET: ABF; 1.25A {Escherichia coli} SCOP: c.124.1.4 d.58.40.1 PDB: 1lkz_A 1ks2_A* 3enq_A 3env_A* 3enw_A* Back     alignment and structure
>3uw1_A Ribose-5-phosphate isomerase A; ssgcid, seattle structural genomics center for infectious DI isomerase, ribose isomerase; HET: R5P; 1.71A {Burkholderia thailandensis} PDB: 3u7j_A* Back     alignment and structure
>1w2w_A 5-methylthioribose-1-phosphate isomerase; EIF2B, methionine salvage pathway, translation initiation, oxidoreductase; 1.75A {Saccharomyces cerevisiae} SCOP: c.124.1.5 Back     alignment and structure
>4gmk_A Ribose-5-phosphate isomerase A; D-ribose-5-phosphate isomerase family, ribose 5-phosphate isomerisation; 1.72A {Lactobacillus salivarius} Back     alignment and structure
>3ixq_A Ribose-5-phosphate isomerase A; structural genomics, pentose phosphate pathway, carbon fixation, NPPSFA; HET: PGO; 1.78A {Methanocaldococcus jannaschii} Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3nbm_A PTS system, lactose-specific IIBC components; PTS_IIB_LACTOSE, phosphoenolpyruvate:carbohydrate system, P- phosphorylation; HET: MSE; 1.30A {Streptococcus pneumoniae} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} SCOP: c.26.2.0 Back     alignment and structure
>2w48_A Sorbitol operon regulator; SORC, activator, repressor, DNA-binding, transcription, transcription regulator, transcription regulation; 3.20A {Klebsiella pneumoniae} Back     alignment and structure
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} SCOP: c.26.2.0 Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>2h1q_A Hypothetical protein; ZP_00559375.1, structural genomics, PSI-2, protein structure initiative; 2.01A {Desulfitobacterium hafniense dcb-2} PDB: 3l5o_A Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3la8_A SMU.1229, putative purine nucleoside phosphorylase; PUNA, glycosyltransferase, transferase; 1.80A {Streptococcus mutans} PDB: 3lba_A* Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>3npg_A Uncharacterized DUF364 family protein; protein with unknown function from DUF364 family, structural genomics; 2.70A {Pyrococcus horikoshii} Back     alignment and structure
>3rrl_A Succinyl-COA:3-ketoacid-coenzyme A transferase SU; MCSG,PSI-biology, structural genomics, midwest center for ST genomics; 2.29A {Helicobacter pylori} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>2yvq_A Carbamoyl-phosphate synthase; conserved hypothetical protein, structural genomics, NPPSFA; 1.98A {Homo sapiens} Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>1k6d_A Acetate COA-transferase alpha subunit; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: c.124.1.2 Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>2a8y_A 5'-methylthioadenosine phosphorylase (MTAP); alpha/beta, beta sheet, beta barrel, transferase; HET: MTA; 1.45A {Sulfolobus solfataricus} PDB: 3t94_A* 1v4n_A Back     alignment and structure
>1jeo_A MJ1247, hypothetical protein MJ1247; RUMP pathway, phosphosugar, 3-hexulose-6-phosphate isomerase structural genomics; HET: CME CIT; 2.00A {Methanocaldococcus jannaschii} SCOP: c.80.1.3 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 165
d1vb5a_274 c.124.1.5 (A:) Putative eIF-2B subunit 2-like prot 3e-22
d2a0ua1374 c.124.1.5 (A:10-383) Initiation factor 2b {Leishma 3e-11
d1t9ka_340 c.124.1.5 (A:) Probable methylthioribose-1-phospha 4e-09
>d1vb5a_ c.124.1.5 (A:) Putative eIF-2B subunit 2-like protein PH0440 {Pyrococcus horikoshii [TaxId: 53953]} Length = 274 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NagB/RpiA/CoA transferase-like
superfamily: NagB/RpiA/CoA transferase-like
family: IF2B-like
domain: Putative eIF-2B subunit 2-like protein PH0440
species: Pyrococcus horikoshii [TaxId: 53953]

 Score = 87.7 bits (217), Expect = 3e-22
 Identities = 30/114 (26%), Positives = 58/114 (50%), Gaps = 1/114 (0%)

Query: 45  ACEHIHSNEIILTLGYSKIVELFLKNAA-QHRKFQCIVMENSPENKGHELAVSLAKSKIQ 103
             + I   ++I+T  +S  V   ++ A  + ++F+ I+ E+SP+ +G  LA  L  S I+
Sbjct: 102 GAQLIDDGDVIITHSFSSTVLEIIRTAKERKKRFKVILTESSPDYEGLHLARELEFSGIE 161

Query: 104 TVLIPDSAMFGLISRVNKIIIGTHTVMANGGLRSVCGTHAVALAAQHYSIPYPC 157
             +I D+ M       +  I+G   +  +G + +  GT+ +ALA    +IP+  
Sbjct: 162 FEVITDAQMGLFCREASIAIVGADMITKDGYVVNKAGTYLLALACHENAIPFYV 215
>d2a0ua1 c.124.1.5 (A:10-383) Initiation factor 2b {Leishmania major [TaxId: 5664]} Length = 374 Back     information, alignment and structure
>d1t9ka_ c.124.1.5 (A:) Probable methylthioribose-1-phosphate isomerase TM0911 {Thermotoga maritima [TaxId: 2336]} Length = 340 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query165
d1vb5a_274 Putative eIF-2B subunit 2-like protein PH0440 {Pyr 100.0
d1t5oa_340 Putative eIF-2B delta-subunit {Archaeon Archaeoglo 100.0
d1t9ka_340 Probable methylthioribose-1-phosphate isomerase TM 100.0
g1w2w.1402 Putative methylthioribose-1-phosphate isomerase Yp 100.0
d2a0ua1374 Initiation factor 2b {Leishmania major [TaxId: 566 100.0
d1m0sa1147 D-ribose-5-phosphate isomerase (RpiA), catalytic d 97.73
d1uj4a1151 D-ribose-5-phosphate isomerase (RpiA), catalytic d 97.56
d1lk5a1149 D-ribose-5-phosphate isomerase (RpiA), catalytic d 97.26
d1id1a_153 Rck domain from putative potassium channel Kch {Es 91.92
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 90.83
d1zgza1120 TorCAD operon transcriptional regulator TorD, N-te 90.4
d1p3wa_ 391 Cysteine desulfurase IscS {Escherichia coli [TaxId 89.61
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 89.22
d2a9va1 196 GMP synthase subunit A, GuaAA {Archaeon Thermoplas 87.24
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 86.98
d2ozlb2138 E1-beta subunit of pyruvate dehydrogenase, C-domai 86.58
d2g39a1221 Acetyl-CoA hydrolase (PA5445) {Pseudomonas aerugin 85.34
d1w85b2132 Pyruvate dehydrogenase E1-beta, PdhB, C-terminal d 84.82
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 83.85
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 83.51
d1a9xa2138 Carbamoyl phosphate synthetase, large subunit allo 83.44
d2o8ra3188 Polyphosphate kinase, PPK {Porphyromonas gingivali 82.91
d1o1ya_ 230 Hypothetical protein TM1158 {Thermotoga maritima [ 82.86
d1umdb2137 Branched-chain alpha-keto acid dehydrogenase {Ther 82.66
d2gnpa1262 Transcriptional regulator SP0247 {Streptococcus pn 82.24
d1k6da_219 Acetate:CoA transferase alpha {Escherichia coli [T 81.67
d1qo0d_189 Positive regulator of the amidase operon AmiR {Pse 81.43
d1gsoa2105 Glycinamide ribonucleotide synthetase (GAR-syn), N 81.12
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 80.9
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 80.21
>d1vb5a_ c.124.1.5 (A:) Putative eIF-2B subunit 2-like protein PH0440 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NagB/RpiA/CoA transferase-like
superfamily: NagB/RpiA/CoA transferase-like
family: IF2B-like
domain: Putative eIF-2B subunit 2-like protein PH0440
species: Pyrococcus horikoshii [TaxId: 53953]

Probab=100.00  E-value=7e-41  Score=278.68  Aligned_cols=128  Identities=24%  Similarity=0.353  Sum_probs=124.6

Q ss_pred             hHHHHHHHHHHhcccCCCCEEEEecCCHHHHHHHHHHHh-CCceEEEEecCCCCChHHHHHHHHhhcCCceEEEccchHH
Q psy2575          35 NPTSDTAPSQACEHIHSNEIILTLGYSKIVELFLKNAAQ-HRKFQCIVMENSPENKGHELAVSLAKSKIQTVLIPDSAMF  113 (165)
Q Consensus        35 ~~~~~~Ia~~a~~~I~~~~~ILT~g~S~tV~~~L~~A~~-~~~f~ViV~Es~P~~eG~~la~~L~~~GI~v~~I~dsav~  113 (165)
                      .+++++|++++.++|++|++|||||+|+||+++|..|++ +++|+|||+||||.+||++|+++|.+.||+|++|+|++++
T Consensus        92 ~~a~~~i~~~~~~~i~~g~~ILT~~~S~tv~~~l~~a~~~gk~~~V~v~EsrP~~eG~~la~~L~~~GI~vtlI~Dsa~~  171 (274)
T d1vb5a_          92 EEAKRELASIGAQLIDDGDVIITHSFSSTVLEIIRTAKERKKRFKVILTESSPDYEGLHLARELEFSGIEFEVITDAQMG  171 (274)
T ss_dssp             HHHHHHHHHHHHHHCCTTEEEECCSCCHHHHHHHHHHHHTTCCEEEEEECCTTTTHHHHHHHHHHHTTCCEEEECGGGHH
T ss_pred             HHHHHHHHHHhHHhcCCCCEEEEeCchHHHHHHHHHHHHcCCCeEEEEeCCCcccchHHHHHHHHHcCCceEEecchHHH
Confidence            566999999999999999999999999999999999988 8999999999999999999999999999999999999999


Q ss_pred             HhchhCCEEEEccceeecCCCeeehhcHHHHHHHHhhCCCcEEEEeecc
Q psy2575         114 GLISRVNKIIIGTHTVMANGGLRSVCGTHAVALAAQHYSIPYPCTFLLN  162 (165)
Q Consensus       114 ~~m~~v~~VllGAd~V~~nG~vvnk~GT~~lAl~Ak~~~vPv~V~~~~~  162 (165)
                      ++|+++|+|++|||+|++||+++||+||+++|++||+|+|||||+||+.
T Consensus       172 ~~m~~~d~VivGAd~v~~nG~v~nkiGT~~~A~~Ak~~~vP~~V~a~~~  220 (274)
T d1vb5a_         172 LFCREASIAIVGADMITKDGYVVNKAGTYLLALACHENAIPFYVAAETY  220 (274)
T ss_dssp             HHHTTCSEEEECCSEECTTSCEEEETTHHHHHHHHHHTTCCEEEECCGG
T ss_pred             HHhhcCCEEEEeeeEEecCCCEEeccchhHHHHHHHHcCCCceEecccc
Confidence            9999999999999999999999999999999999999999999999874
>d1t5oa_ c.124.1.5 (A:) Putative eIF-2B delta-subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t9ka_ c.124.1.5 (A:) Probable methylthioribose-1-phosphate isomerase TM0911 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a0ua1 c.124.1.5 (A:10-383) Initiation factor 2b {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1m0sa1 c.124.1.4 (A:1-126,A:199-219) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uj4a1 c.124.1.4 (A:3-131,A:206-227) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lk5a1 c.124.1.4 (A:1-130,A:211-229) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ozlb2 c.48.1.2 (B:192-329) E1-beta subunit of pyruvate dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g39a1 c.124.1.2 (A:3-223) Acetyl-CoA hydrolase (PA5445) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1w85b2 c.48.1.2 (B:193-324) Pyruvate dehydrogenase E1-beta, PdhB, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1a9xa2 c.24.1.1 (A:936-1073) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o8ra3 d.136.1.4 (A:318-505) Polyphosphate kinase, PPK {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1umdb2 c.48.1.2 (B:188-324) Branched-chain alpha-keto acid dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gnpa1 c.124.1.8 (A:56-317) Transcriptional regulator SP0247 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1k6da_ c.124.1.2 (A:) Acetate:CoA transferase alpha {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure