Psyllid ID: psy2616

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--
MEPQQGLLEQLHSQSKNSNSSSSLQVAPKIKERMMKSGSMMITYQPIHALPNFFRLVLQNSALDHSDMDYFIDEIERLGHDL
ccccccHHHHHHccccccccHHHHcccHHHHHHHHHcccEEEEEEcccccccEEEEEEEcccccccHHHHHHHHHHHHcccc
ccccccccHHHccccccHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccEEEEEEEcccccHHHHHHHHHHHHHHcccc
MEPQQGLLEQLhsqsknsnsssslqVAPKIKERMMKsgsmmityqpihalpNFFRLVLQNsaldhsdmdYFIDEIERLGHDL
MEPQQGLLEQlhsqsknsnsssslqvAPKIKERMMKSGSMMITYQPIHALPNFFRLVLQNSALDHSDMDYFIDEIERLGHDL
MEPQQGLLEQLHsqsknsnssssLQVAPKIKERMMKSGSMMITYQPIHALPNFFRLVLQNSALDHSDMDYFIDEIERLGHDL
***************************************MMITYQPIHALPNFFRLVLQNSALDHSDMDYFIDEI*******
******L****HSQ*K*SNSSSSLQVAPKIKERMMKSGSMMITYQPIHALPNFFRLVLQNSALDHSDMDYFIDEIERLGHD*
**************************APKIKERMMKSGSMMITYQPIHALPNFFRLVLQNSALDHSDMDYFIDEIERLGHDL
****QGLLEQLHSQSKNSNSSSSLQVAPKIKERMMKSGSMMITYQPIHALPNFFRLVLQNSALDHSDMDYFIDEIERLGHDL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEPQQGLLEQLHSQSKNSNSSSSLQVAPKIKERMMKSGSMMITYQPIHALPNFFRLVLQNSALDHSDMDYFIDEIERLGHDL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query82 2.2.26 [Sep-21-2011]
P48321585 Glutamate decarboxylase 2 yes N/A 0.707 0.099 0.568 3e-14
Q9Y600493 Cysteine sulfinic acid de yes N/A 0.707 0.117 0.603 4e-14
P48320585 Glutamate decarboxylase 2 yes N/A 0.878 0.123 0.493 6e-14
Q05683585 Glutamate decarboxylase 2 yes N/A 0.707 0.099 0.551 1e-13
Q4PRC2585 Glutamate decarboxylase 2 no N/A 0.707 0.099 0.551 1e-13
Q05329585 Glutamate decarboxylase 2 no N/A 0.878 0.123 0.493 1e-13
Q5R7S7594 Glutamate decarboxylase 1 yes N/A 0.707 0.097 0.568 5e-13
Q99259594 Glutamate decarboxylase 1 no N/A 0.707 0.097 0.568 5e-13
P18088593 Glutamate decarboxylase 1 no N/A 0.707 0.097 0.568 6e-13
Q5IS68594 Glutamate decarboxylase 1 no N/A 0.707 0.097 0.568 6e-13
>sp|P48321|DCE2_PIG Glutamate decarboxylase 2 OS=Sus scrofa GN=GAD2 PE=2 SV=1 Back     alignment and function desciption
 Score = 77.4 bits (189), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 33/58 (56%), Positives = 44/58 (75%)

Query: 25  QVAPKIKERMMKSGSMMITYQPIHALPNFFRLVLQNSALDHSDMDYFIDEIERLGHDL 82
           +VAP IK RMM+SG+ M++YQP+    NFFR+V+ N A  H D+D+ I+EIERLG DL
Sbjct: 528 KVAPVIKARMMESGTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL 585
Catalyzes the production of GABA.
Sus scrofa (taxid: 9823)
EC: 4EC: .EC: 1EC: .EC: 1EC: .EC: 1EC: 5
>sp|Q9Y600|CSAD_HUMAN Cysteine sulfinic acid decarboxylase OS=Homo sapiens GN=CSAD PE=1 SV=2 Back     alignment and function description
>sp|P48320|DCE2_MOUSE Glutamate decarboxylase 2 OS=Mus musculus GN=Gad2 PE=2 SV=1 Back     alignment and function description
>sp|Q05683|DCE2_RAT Glutamate decarboxylase 2 OS=Rattus norvegicus GN=Gad2 PE=1 SV=1 Back     alignment and function description
>sp|Q4PRC2|DCE2_CANFA Glutamate decarboxylase 2 OS=Canis familiaris GN=GAD2 PE=2 SV=1 Back     alignment and function description
>sp|Q05329|DCE2_HUMAN Glutamate decarboxylase 2 OS=Homo sapiens GN=GAD2 PE=1 SV=1 Back     alignment and function description
>sp|Q5R7S7|DCE1_PONAB Glutamate decarboxylase 1 OS=Pongo abelii GN=GAD1 PE=2 SV=1 Back     alignment and function description
>sp|Q99259|DCE1_HUMAN Glutamate decarboxylase 1 OS=Homo sapiens GN=GAD1 PE=1 SV=1 Back     alignment and function description
>sp|P18088|DCE1_RAT Glutamate decarboxylase 1 OS=Rattus norvegicus GN=Gad1 PE=2 SV=1 Back     alignment and function description
>sp|Q5IS68|DCE1_PANTR Glutamate decarboxylase 1 OS=Pan troglodytes GN=GAD1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query82
158299554 567 AGAP008904-PA [Anopheles gambiae str. PE 0.707 0.102 0.827 9e-21
312381545 629 hypothetical protein AND_06142 [Anophele 0.707 0.092 0.810 1e-20
157116352 560 glutamate decarboxylase [Aedes aegypti] 0.707 0.103 0.810 2e-20
170047791 563 glutamate decarboxylase [Culex quinquefa 0.707 0.103 0.793 5e-20
193596571 537 PREDICTED: glutamate decarboxylase-like 0.707 0.108 0.775 5e-20
195437648 583 GK24391 [Drosophila willistoni] gi|19416 0.853 0.120 0.585 9e-18
195119061 580 GI18241 [Drosophila mojavensis] gi|19391 0.853 0.120 0.585 1e-17
195031471 588 GH11117 [Drosophila grimshawi] gi|193904 0.853 0.119 0.585 1e-17
195164738 589 GL21233 [Drosophila persimilis] gi|19410 0.707 0.098 0.724 1e-17
198473308 589 GA20603 [Drosophila pseudoobscura pseudo 0.707 0.098 0.724 2e-17
>gi|158299554|ref|XP_319650.4| AGAP008904-PA [Anopheles gambiae str. PEST] gi|157013574|gb|EAA14875.5| AGAP008904-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 48/58 (82%), Positives = 52/58 (89%)

Query: 25  QVAPKIKERMMKSGSMMITYQPIHALPNFFRLVLQNSALDHSDMDYFIDEIERLGHDL 82
           +VAPK+KERMMK GSMMITYQPIH  PNFFRLVLQNS+LD SDM+Y IDEIERLG DL
Sbjct: 510 KVAPKVKERMMKDGSMMITYQPIHDKPNFFRLVLQNSSLDKSDMNYIIDEIERLGKDL 567

Source: Anopheles gambiae str. PEST

Species: Anopheles gambiae

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|312381545|gb|EFR27272.1| hypothetical protein AND_06142 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|157116352|ref|XP_001658435.1| glutamate decarboxylase [Aedes aegypti] gi|108876522|gb|EAT40747.1| AAEL007542-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170047791|ref|XP_001851393.1| glutamate decarboxylase [Culex quinquefasciatus] gi|167870080|gb|EDS33463.1| glutamate decarboxylase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|193596571|ref|XP_001950847.1| PREDICTED: glutamate decarboxylase-like protein 1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|195437648|ref|XP_002066752.1| GK24391 [Drosophila willistoni] gi|194162837|gb|EDW77738.1| GK24391 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195119061|ref|XP_002004050.1| GI18241 [Drosophila mojavensis] gi|193914625|gb|EDW13492.1| GI18241 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195031471|ref|XP_001988345.1| GH11117 [Drosophila grimshawi] gi|193904345|gb|EDW03212.1| GH11117 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195164738|ref|XP_002023203.1| GL21233 [Drosophila persimilis] gi|194105288|gb|EDW27331.1| GL21233 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|198473308|ref|XP_001356242.2| GA20603 [Drosophila pseudoobscura pseudoobscura] gi|198139398|gb|EAL33304.2| GA20603 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query82
FB|FBgn0000153575 b "black" [Drosophila melanoga 0.707 0.100 0.706 1.3e-16
UNIPROTKB|F1NS42493 GAD2 "Uncharacterized protein" 0.719 0.119 0.559 9.8e-13
UNIPROTKB|Q9Y600493 CSAD "Cysteine sulfinic acid d 0.707 0.117 0.603 9.8e-13
UNIPROTKB|F1PKT4498 CSAD "Uncharacterized protein" 0.707 0.116 0.586 1e-12
UNIPROTKB|F1N6X2585 GAD2 "Uncharacterized protein" 0.707 0.099 0.568 1e-12
UNIPROTKB|J3KPG9519 CSAD "Cysteine sulfinic acid d 0.707 0.111 0.603 1.1e-12
UNIPROTKB|P48321585 GAD2 "Glutamate decarboxylase 0.707 0.099 0.568 1.3e-12
UNIPROTKB|J9NZT6215 GAD1 "Glutamate decarboxylase 0.707 0.269 0.568 1.9e-12
UNIPROTKB|E1BP41493 CSAD "Uncharacterized protein" 0.707 0.117 0.568 2.7e-12
UNIPROTKB|E1BP42582 CSAD "Uncharacterized protein" 0.707 0.099 0.568 3.6e-12
FB|FBgn0000153 b "black" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 214 (80.4 bits), Expect = 1.3e-16, P = 1.3e-16
 Identities = 41/58 (70%), Positives = 48/58 (82%)

Query:    25 QVAPKIKERMMKSGSMMITYQPIHALPNFFRLVLQNSALDHSDMDYFIDEIERLGHDL 82
             +VAPK+KE M+K GSMMITYQP+  LPNFFRLVLQNS L+ SDM YF+DEIE L  +L
Sbjct:   518 KVAPKVKEGMIKKGSMMITYQPLRQLPNFFRLVLQNSCLEESDMVYFLDEIESLAQNL 575
GO:0004351 "glutamate decarboxylase activity" evidence=ISS
GO:0004068 "aspartate 1-decarboxylase activity" evidence=ISS;IMP
GO:0006212 "uracil catabolic process" evidence=TAS
GO:0048066 "developmental pigmentation" evidence=TAS
GO:0019483 "beta-alanine biosynthetic process" evidence=TAS
GO:0019752 "carboxylic acid metabolic process" evidence=IEA
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0007632 "visual behavior" evidence=IMP
UNIPROTKB|F1NS42 GAD2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y600 CSAD "Cysteine sulfinic acid decarboxylase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PKT4 CSAD "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1N6X2 GAD2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J3KPG9 CSAD "Cysteine sulfinic acid decarboxylase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P48321 GAD2 "Glutamate decarboxylase 2" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZT6 GAD1 "Glutamate decarboxylase 1" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BP41 CSAD "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BP42 CSAD "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P48321DCE2_PIG4, ., 1, ., 1, ., 1, 50.56890.70730.0991yesN/A
Q05683DCE2_RAT4, ., 1, ., 1, ., 1, 50.55170.70730.0991yesN/A
Q5R7S7DCE1_PONAB4, ., 1, ., 1, ., 1, 50.56890.70730.0976yesN/A
Q9Y600CSAD_HUMAN4, ., 1, ., 1, ., 2, 90.60340.70730.1176yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
cd06450345 cd06450, DOPA_deC_like, DOPA decarboxylase family 1e-10
>gnl|CDD|99743 cd06450, DOPA_deC_like, DOPA decarboxylase family Back     alignment and domain information 
 Score = 54.9 bits (133), Expect = 1e-10
 Identities = 12/54 (22%), Positives = 24/54 (44%), Gaps = 1/54 (1%)

Query: 25  QVAPKIKERMMKSGSMMITYQPIHALPNFFRLVLQNSALDHSDMDYFIDEIERL 78
           ++   + +R+ + G   +    +   PN  R V+ N      D D  +++IER 
Sbjct: 293 ELNYDLSDRLNERGGWHVPATTLGG-PNVLRFVVTNPLTTRDDADALLEDIERA 345

This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to DOPA/tyrosine decarboxylase (DDC), histidine decarboxylase (HDC), and glutamate decarboxylase (GDC). DDC is active as a dimer and catalyzes the decarboxylation of tyrosine. GDC catalyzes the decarboxylation of glutamate and HDC catalyzes the decarboxylation of histidine. Length = 345

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 82
KOG0629|consensus510 99.94
PLN02590539 probable tyrosine decarboxylase 98.41
TIGR03799522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 98.2
PLN02880490 tyrosine decarboxylase 97.9
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 95.86
PRK06290410 aspartate aminotransferase; Provisional 92.21
KOG1359|consensus417 91.12
PF15217180 TSC21: TSC21 family 86.4
PRK05387353 histidinol-phosphate aminotransferase; Provisional 86.31
KOG0628|consensus511 85.54
cd06454349 KBL_like KBL_like; this family belongs to the pyri 85.31
KOG0634|consensus472 85.18
PRK13520371 L-tyrosine decarboxylase; Provisional 84.41
PRK08153369 histidinol-phosphate aminotransferase; Provisional 84.27
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 83.72
PRK09792421 4-aminobutyrate transaminase; Provisional 82.75
PRK02731367 histidinol-phosphate aminotransferase; Validated 82.02
TIGR01788431 Glu-decarb-GAD glutamate decarboxylase. This model 81.51
cd00617431 Tnase_like Tryptophanase family (Tnase). This fami 81.46
PRK09105370 putative aminotransferase; Provisional 81.21
PRK03158359 histidinol-phosphate aminotransferase; Provisional 81.01
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 81.0
PRK04635354 histidinol-phosphate aminotransferase; Provisional 80.68
PRK13392410 5-aminolevulinate synthase; Provisional 80.51
>KOG0629|consensus Back     alignment and domain information 
Probab=99.94  E-value=1.6e-27  Score=192.05  Aligned_cols=74  Identities=53%  Similarity=0.887  Sum_probs=70.7

Q ss_pred             HHHhcCCC-CchhhhhhcchHHHHHHHhhccccceeecCCCCCCCcceEeecCCCCChhhHHHHHHHHHHhcccC
Q psy2616           9 EQLHSQSK-NSNSSSSLQVAPKIKERMMKSGSMMITYQPIHALPNFFRLVLQNSALDHSDMDYFIDEIERLGHDL   82 (82)
Q Consensus         9 ~~l~~~~~-~e~~~kL~kVap~IKerM~~~Gs~MV~YqPl~~~~NFFR~V~~np~~t~~dmD~ll~eIerlG~dl   82 (82)
                      +.||+.+. +++|.+|+||||+||++|+++||+||+|||++.++||||+|++||++|.+|+||+||||+|||+||
T Consensus       436 ~~lR~~~~~~e~~~rL~kVaPkIK~~Mm~~Gt~Mi~YqPl~~~~nffr~v~sn~a~~~ad~dflldEIerlgq~l  510 (510)
T KOG0629|consen  436 PSLRGWQENPERDSRLVKVAPKIKERMMKKGTTMIGYQPLGDKPNFFRMVISNPALTEADLDFLLDEIERLGQDL  510 (510)
T ss_pred             hHhccCcccchhhhHHHhhCcHHHHHHHhccceeeEecccccccchhheecccchhhhhhHHHHHHHHHHhccCC
Confidence            46888877 779999999999999999999999999999999999999999999999999999999999999997

>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>KOG1359|consensus Back     alignment and domain information
>PF15217 TSC21: TSC21 family Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>KOG0628|consensus Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>KOG0634|consensus Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>PRK09792 4-aminobutyrate transaminase; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
2jis_A515 Human Cysteine Sulfinic Acid Decarboxylase (Csad) I 5e-15
2okj_A504 The X-Ray Crystal Structure Of The 67kda Isoform Of 6e-14
3vp6_A511 Structural Characterization Of Glutamic Acid Decarb 6e-14
2okk_A497 The X-Ray Crystal Structure Of The 65kda Isoform Of 7e-14
>pdb|2JIS|A Chain A, Human Cysteine Sulfinic Acid Decarboxylase (Csad) In Complex With Plp. Length = 515 Back     alignment and structure 
Iteration: 1

 Score = 76.3 bits (186), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 45/58 (77%)
Query: 25  QVAPKIKERMMKSGSMMITYQPIHALPNFFRLVLQNSALDHSDMDYFIDEIERLGHDL 82
           +VAP +KERM+K GSMMI YQP     NFFR+V+ NSAL  +DMD+ ++E+ERLG DL
Sbjct: 458 KVAPVLKERMVKEGSMMIGYQPHGTRGNFFRVVVANSALTCADMDFLLNELERLGQDL 515
>pdb|2OKJ|A Chain A, The X-Ray Crystal Structure Of The 67kda Isoform Of Glutamic Acid Decarboxylase (Gad67) Length = 504 Back     alignment and structure
>pdb|3VP6|A Chain A, Structural Characterization Of Glutamic Acid Decarboxylase; Insights Into The Mechanism Of Autoinactivation Length = 511 Back     alignment and structure
>pdb|2OKK|A Chain A, The X-Ray Crystal Structure Of The 65kda Isoform Of Glutamic Acid Decarboxylase (Gad65) Length = 497 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 2e-18
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 9e-18
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 1e-13
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 2e-11
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 4e-11
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 6e-10
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Length = 515 Back     alignment and structure
 Score = 76.7 bits (189), Expect = 2e-18
 Identities = 35/58 (60%), Positives = 45/58 (77%)

Query: 25  QVAPKIKERMMKSGSMMITYQPIHALPNFFRLVLQNSALDHSDMDYFIDEIERLGHDL 82
           +VAP +KERM+K GSMMI YQP     NFFR+V+ NSAL  +DMD+ ++E+ERLG DL
Sbjct: 458 KVAPVLKERMVKEGSMMIGYQPHGTRGNFFRVVVANSALTCADMDFLLNELERLGQDL 515
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Length = 504 Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Length = 497 Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} Length = 475 Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Length = 481 Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Length = 486 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query82
3vp6_A511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 98.97
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 98.38
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 98.33
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 97.58
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 97.34
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 96.93
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 96.78
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 93.22
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 91.21
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 91.15
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 90.68
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 90.52
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 90.33
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 89.57
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 89.55
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 89.12
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 88.59
1svv_A359 Threonine aldolase; structural genomics, structura 88.36
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 88.25
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 87.54
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 87.23
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 87.1
3aow_A448 Putative uncharacterized protein PH0207; protein-P 87.07
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 87.05
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 86.52
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 85.94
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 85.24
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 85.2
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 85.2
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 84.08
3ftb_A361 Histidinol-phosphate aminotransferase; structural 84.02
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 83.58
3f0h_A376 Aminotransferase; RER070207000802, structural geno 83.4
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 82.85
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 82.76
1vp4_A425 Aminotransferase, putative; structural genomics, j 82.72
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 82.57
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 82.24
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 81.86
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 81.23
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 80.91
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 80.85
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 80.83
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 80.72
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 80.15
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
Probab=98.97  E-value=2.5e-10  Score=88.17  Aligned_cols=64  Identities=52%  Similarity=0.836  Sum_probs=57.2

Q ss_pred             hhhhhhcchHHHHHHHhhccccceeecCCCCCCCcceEeecCCCCChhhHHHHHHHHHHhcccC
Q psy2616          19 NSSSSLQVAPKIKERMMKSGSMMITYQPIHALPNFFRLVLQNSALDHSDMDYFIDEIERLGHDL   82 (82)
Q Consensus        19 ~~~kL~kVap~IKerM~~~Gs~MV~YqPl~~~~NFFR~V~~np~~t~~dmD~ll~eIerlG~dl   82 (82)
                      +++.++++++.|+++|.++|.++++|.|.++..+|||+++.||.+|.+|||.++++|+++|+||
T Consensus       442 ~~~~l~~~~~~l~~~L~~~G~~~~~~~~~~~~~~~lRi~~~~~~~t~~di~~ll~~i~~~~~~~  505 (511)
T 3vp6_A          442 RREKLHKVAPKIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL  505 (511)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTSCEEEEEEETTEEEEEEECCCCTTCCHHHHHHHHHHHHHHHC--
T ss_pred             HHHHHHHHHHHHHHHHHhcCCEEEEEEEeCCceEEEEEEecCCCCCHHHHHHHHHHHHHHHHhh
Confidence            4557888899999999999999999999887778999998899999999999999999999986
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 82
d1js3a_476 c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) 3e-07
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 476 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Pyridoxal-dependent decarboxylase
domain: DOPA decarboxylase
species: Pig (Sus scrofa) [TaxId: 9823]

 Score = 43.7 bits (102), Expect = 3e-07
 Identities = 6/54 (11%), Positives = 19/54 (35%), Gaps = 1/54 (1%)

Query: 29  KIKERMMKSGSMMITYQPIHALPNFFRLVLQNSALDHSDMDYFIDEIERLGHDL 82
            + ER+  +  + +    +       R  + +  ++   +    + I  L  +L
Sbjct: 422 ALLERINSARKIHLVPCRLRGQF-VLRFAICSRKVESGHVRLAWEHIRGLAAEL 474

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query82
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 97.72
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 96.29
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 95.47
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 94.69
d1pmma_450 Glutamate decarboxylase beta, GadB {Escherichia co 93.51
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 89.77
d1c4ka2462 Ornithine decarboxylase major domain {Lactobacillu 85.58
d1c7ga_456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 84.96
d2v1pa1467 Tryptophan indol-lyase (tryptophanase) {Escherichi 83.53
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 83.36
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 82.47
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 82.34
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 81.87
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Pyridoxal-dependent decarboxylase
domain: DOPA decarboxylase
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=97.72  E-value=7.3e-06  Score=61.98  Aligned_cols=56  Identities=11%  Similarity=0.215  Sum_probs=48.4

Q ss_pred             chHHHHHHHhhccccceeecCCCCCCCcceEeecCCCCChhhHHHHHHHHHHhcccC
Q psy2616          26 VAPKIKERMMKSGSMMITYQPIHALPNFFRLVLQNSALDHSDMDYFIDEIERLGHDL   82 (82)
Q Consensus        26 Vap~IKerM~~~Gs~MV~YqPl~~~~NFFR~V~~np~~t~~dmD~ll~eIerlG~dl   82 (82)
                      +...+.+++..+|.++++...+.++ -.+|+++.||.+|++|+|.+++.|+++|++|
T Consensus       419 ~n~~l~~~l~~~G~~~~s~t~~~g~-~~lR~~i~n~~Tt~~did~~~~~i~~~a~~l  474 (476)
T d1js3a_         419 LNEALLERINSARKIHLVPCRLRGQ-FVLRFAICSRKVESGHVRLAWEHIRGLAAEL  474 (476)
T ss_dssp             HHHHHHHHHHHHTSCBCEEEEETTE-EEEEEECCCTTCCHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhcCCEEEeeeeECCE-EEEEEEeCCCCCCHHHHHHHHHHHHHHHHHH
Confidence            4467889999999999998776543 4889999999999999999999999999764
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure