Psyllid ID: psy2646


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MRLLLPYQTLQNKKEERTRTLIVIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQETFNNLKQWLEEIDRYACDNVNKLLVGNKNDQTSKKAVDYQVAKEYADHLKIPFLETSAKNGANVEQAFLTMATEIKKRVTKDEKPSSESDAKKLNLNSGKPVDAPRSGGCC
cccccccccEEEEEEccEEEEEEEEEccccccHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccccccccHHHHHHHHHHccccEEEccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccc
cEEEEEEEEEEEEEEcccEEEEEEEEEcccHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHHHHHHcccccEEEEEEEcHHHHHHccccHHHHHHHHHHcccEEEEccccccccHHHHHHHHHHHcccHHccccccccccccccEEcccccccccccccccc
mrlllpyqtlqnkkeERTRTLIVIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQETFNNLKQWLEEIDRYACDNVNKllvgnkndqtskkAVDYQVAKEYAdhlkipfletsakngaNVEQAFLTMATEIKKRvtkdekpssesdakklnlnsgkpvdaprsggcc
mrlllpyqtlqnkkeertrtliviwdtagqerfRTITSSYYRGAHGIIVVYDCTDQETFNNLKQWLEEIDRYACDNVNKLlvgnkndqtskkAVDYQVAKEYADHLKIPFLETSAKNGANVEQAFLTMATEIKkrvtkdekpssesdakklnlnsgkpvdaprsggcc
MRLLLPYQTLQNKKEERTRTLIVIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQETFNNLKQWLEEIDRYACDNVNKLLVGNKNDQTSKKAVDYQVAKEYADHLKIPFLETSAKNGANVEQAFLTMATEIKKRVTKDEKPSSESDAKKLNLNSGKPVDAPRSGGCC
*****************TRTLIVIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQETFNNLKQWLEEIDRYACDNVNKLLVGNKNDQTSKKAVDYQVAKEYADHLKIPFLETSAKNGANVEQAFLTMA***************************************
*RLLLPYQTLQNKKEERTRTLIVIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQETFNNLKQWLEEIDRYACDNVNKLLVGNKNDQTSKKAVDYQVAKEYADHLKIPFLETSAKNGANVEQAFLTMATEI*******************************SGGCC
MRLLLPYQTLQNKKEERTRTLIVIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQETFNNLKQWLEEIDRYACDNVNKLLVGNKNDQTSKKAVDYQVAKEYADHLKIPFLETSAKNGANVEQAFLTMATEIKK***************KLNLNS*************
MRLLLPYQTLQNKKEERTRTLIVIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQETFNNLKQWLEEIDRYACDNVNKLLVGNKNDQTSKKAVDYQVAKEYADHLKIPFLETSAKNGANVEQAFLTMATEIKKRVT*******************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRLLLPYQTLQNKKEERTRTLIVIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQETFNNLKQWLEEIDRYACDNVNKLLVGNKNDQTSKKAVDYQVAKEYADHLKIPFLETSAKNGANVEQAFLTMATEIKKRVTKDEKPSSESDAKKLNLNSGKPVDAPRSGGCC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query168 2.2.26 [Sep-21-2011]
Q05974205 Ras-related protein Rab-1 N/A N/A 0.815 0.668 0.7 4e-55
P22125202 Ras-related protein ORAB- N/A N/A 0.845 0.702 0.710 4e-53
Q9D1G1201 Ras-related protein Rab-1 yes N/A 0.839 0.701 0.682 1e-52
Q39571203 GTP-binding protein YPTC1 N/A N/A 0.851 0.704 0.675 1e-52
Q5RE13201 Ras-related protein Rab-1 yes N/A 0.839 0.701 0.682 2e-52
Q9H0U4201 Ras-related protein Rab-1 yes N/A 0.839 0.701 0.682 2e-52
P34139202 Ras-related protein Rab-1 yes N/A 0.845 0.702 0.668 5e-52
Q6NYB7205 Ras-related protein Rab-1 no N/A 0.845 0.692 0.682 7e-52
P62821205 Ras-related protein Rab-1 no N/A 0.845 0.692 0.682 7e-52
P62820205 Ras-related protein Rab-1 no N/A 0.845 0.692 0.682 7e-52
>sp|Q05974|RAB1A_LYMST Ras-related protein Rab-1A OS=Lymnaea stagnalis GN=RAB1A PE=2 SV=1 Back     alignment and function desciption
 Score =  213 bits (542), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 117/150 (78%), Gaps = 13/150 (8%)

Query: 24  IWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQETFNNLKQWLEEIDRYACDNVNKLLVG 83
           IWDTAGQERFRTITSSYYRGAHGIIVVYD TDQE+FNN+KQWL+EIDRYA +NVNKLLVG
Sbjct: 64  IWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVG 123

Query: 84  NKNDQTSKKAVDYQVAKEYADHLKIPFLETSAKNGANVEQAFLTMATEIKKRV-----TK 138
           NK+D T+KK VD+  AKEYAD L IPFLETSAKN  NVEQAF+TMA EIK R+       
Sbjct: 124 NKSDLTTKKVVDFTTAKEYADQLGIPFLETSAKNATNVEQAFMTMAAEIKNRMGPITAAS 183

Query: 139 DEKPSSESDAKKLNLNSGKPVDAPRSGGCC 168
           D KPS       + +NS  PV A + GGCC
Sbjct: 184 DSKPS-------VKINSSTPVSANK-GGCC 205




Probably required for transit of protein from the ER through Golgi compartment.
Lymnaea stagnalis (taxid: 6523)
>sp|P22125|RAB1_DIPOM Ras-related protein ORAB-1 OS=Diplobatis ommata PE=2 SV=1 Back     alignment and function description
>sp|Q9D1G1|RAB1B_MOUSE Ras-related protein Rab-1B OS=Mus musculus GN=Rab1b PE=1 SV=1 Back     alignment and function description
>sp|Q39571|YPTC1_CHLRE GTP-binding protein YPTC1 OS=Chlamydomonas reinhardtii GN=YPTC1 PE=3 SV=1 Back     alignment and function description
>sp|Q5RE13|RAB1B_PONAB Ras-related protein Rab-1B OS=Pongo abelii GN=RAB1B PE=2 SV=1 Back     alignment and function description
>sp|Q9H0U4|RAB1B_HUMAN Ras-related protein Rab-1B OS=Homo sapiens GN=RAB1B PE=1 SV=1 Back     alignment and function description
>sp|P34139|RAB1A_DICDI Ras-related protein Rab-1A OS=Dictyostelium discoideum GN=rab1A PE=2 SV=2 Back     alignment and function description
>sp|Q6NYB7|RAB1A_RAT Ras-related protein Rab-1A OS=Rattus norvegicus GN=Rab1A PE=1 SV=3 Back     alignment and function description
>sp|P62821|RAB1A_MOUSE Ras-related protein Rab-1A OS=Mus musculus GN=Rab1A PE=1 SV=3 Back     alignment and function description
>sp|P62820|RAB1A_HUMAN Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1A PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query168
91087113202 PREDICTED: similar to Rab-protein 1 CG33 0.839 0.698 0.744 1e-57
307198018206 Ras-related protein Rab-1A [Harpegnathos 0.851 0.694 0.736 2e-56
332027975208 Ras-related protein Rab-1A [Acromyrmex e 0.851 0.687 0.736 4e-56
307187151208 Ras-related protein Rab-1A [Camponotus f 0.851 0.687 0.736 5e-56
322786717206 hypothetical protein SINV_00792 [Solenop 0.851 0.694 0.736 5e-56
340713998206 PREDICTED: ras-related protein Rab-1A-li 0.851 0.694 0.736 7e-56
195053856205 GH18937 [Drosophila grimshawi] gi|193895 0.839 0.687 0.724 3e-55
125773595205 GA17362 [Drosophila pseudoobscura pseudo 0.839 0.687 0.724 4e-55
195113911205 GI10837 [Drosophila mojavensis] gi|19391 0.839 0.687 0.724 8e-55
194741692205 GF17263 [Drosophila ananassae] gi|190626 0.839 0.687 0.724 9e-55
>gi|91087113|ref|XP_975150.1| PREDICTED: similar to Rab-protein 1 CG3320-PA [Tribolium castaneum] gi|270010550|gb|EFA06998.1| hypothetical protein TcasGA2_TC009965 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 123/145 (84%), Gaps = 4/145 (2%)

Query: 24  IWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQETFNNLKQWLEEIDRYACDNVNKLLVG 83
           IWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQ++FNN+KQWLEEIDRYACDNVNKLLVG
Sbjct: 61  IWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQDSFNNVKQWLEEIDRYACDNVNKLLVG 120

Query: 84  NKNDQTSKKAVDYQVAKEYADHLKIPFLETSAKNGANVEQAFLTMATEIKKRVTKDEKPS 143
           NK+D T+KK VDY  AKEYAD L IPFLETSAKN +NVEQAF+TMA EIK RV     PS
Sbjct: 121 NKSDLTTKKVVDYTTAKEYADQLGIPFLETSAKNASNVEQAFMTMAAEIKNRVG---PPS 177

Query: 144 SESD-AKKLNLNSGKPVDAPRSGGC 167
           S +D A K+ ++ G+P++  +SG C
Sbjct: 178 SAADQASKVKIDQGRPIETTKSGCC 202




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307198018|gb|EFN79078.1| Ras-related protein Rab-1A [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332027975|gb|EGI68026.1| Ras-related protein Rab-1A [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307187151|gb|EFN72394.1| Ras-related protein Rab-1A [Camponotus floridanus] Back     alignment and taxonomy information
>gi|322786717|gb|EFZ13086.1| hypothetical protein SINV_00792 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|340713998|ref|XP_003395520.1| PREDICTED: ras-related protein Rab-1A-like [Bombus terrestris] gi|350418865|ref|XP_003491994.1| PREDICTED: ras-related protein Rab-1A-like [Bombus impatiens] gi|380024902|ref|XP_003696227.1| PREDICTED: ras-related protein Rab-1A-like [Apis florea] Back     alignment and taxonomy information
>gi|195053856|ref|XP_001993842.1| GH18937 [Drosophila grimshawi] gi|193895712|gb|EDV94578.1| GH18937 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|125773595|ref|XP_001358056.1| GA17362 [Drosophila pseudoobscura pseudoobscura] gi|195166166|ref|XP_002023906.1| GL27164 [Drosophila persimilis] gi|54637791|gb|EAL27193.1| GA17362 [Drosophila pseudoobscura pseudoobscura] gi|194106066|gb|EDW28109.1| GL27164 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|195113911|ref|XP_002001511.1| GI10837 [Drosophila mojavensis] gi|193918105|gb|EDW16972.1| GI10837 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|194741692|ref|XP_001953321.1| GF17263 [Drosophila ananassae] gi|190626380|gb|EDV41904.1| GF17263 [Drosophila ananassae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query168
FB|FBgn0016700205 Rab1 "Rab1" [Drosophila melano 0.839 0.687 0.719 9.2e-52
ZFIN|ZDB-GENE-090312-110201 si:ch73-131e21.5 "si:ch73-131e 0.833 0.696 0.712 2e-49
ZFIN|ZDB-GENE-030616-564201 rab1a "RAB1A, member RAS oncog 0.839 0.701 0.710 3.2e-49
WB|WBGene00004266205 rab-1 [Caenorhabditis elegans 0.845 0.692 0.682 8.5e-49
UNIPROTKB|F1NNL7205 RAB1A "Uncharacterized protein 0.839 0.687 0.698 2.3e-48
ZFIN|ZDB-GENE-040426-873201 rab1ba "zRAB1B, member RAS onc 0.833 0.696 0.698 2.3e-48
ZFIN|ZDB-GENE-040625-133201 rab1bb "RAB1B, member RAS onco 0.833 0.696 0.691 2.3e-48
MGI|MGI:1923558201 Rab1b "RAB1B, member RAS oncog 0.833 0.696 0.691 2.9e-48
DICTYBASE|DDB_G0283757202 rab1A "Rab GTPase" [Dictyostel 0.845 0.702 0.668 3.7e-48
UNIPROTKB|A1L528205 RAB1A "RAB1A, member RAS oncog 0.839 0.687 0.691 6e-48
FB|FBgn0016700 Rab1 "Rab1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 537 (194.1 bits), Expect = 9.2e-52, P = 9.2e-52
 Identities = 105/146 (71%), Positives = 121/146 (82%)

Query:    24 IWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQETFNNLKQWLEEIDRYACDNVNKLLVG 83
             IWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQE+FNN+KQWLEEI+RYAC+NVNKLLVG
Sbjct:    64 IWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVG 123

Query:    84 NKNDQTSKKAVDYQVAKEYADHLKIPFLETSAKNGANVEQAFLTMATEIKKRVTKDEKPS 143
             NK+D T+KK VD+  A EYA  L IPFLETSAK+  NVEQAF+TMA EIK RV     PS
Sbjct:   124 NKSDLTTKKVVDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVGP---PS 180

Query:   144 SESD-AKKLNLNSGKPVDAPRSGGCC 168
             S +D A K+ ++ G+PV+  +SG CC
Sbjct:   181 SATDNASKVKIDQGRPVENTKSG-CC 205




GO:0003924 "GTPase activity" evidence=ISS
GO:0006888 "ER to Golgi vesicle-mediated transport" evidence=TAS
GO:0008360 "regulation of cell shape" evidence=IMP
GO:0007015 "actin filament organization" evidence=IMP
GO:0007155 "cell adhesion" evidence=IMP
GO:0007264 "small GTPase mediated signal transduction" evidence=IEA
GO:0005525 "GTP binding" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
GO:0050774 "negative regulation of dendrite morphogenesis" evidence=IMP
GO:0031982 "vesicle" evidence=ISS
GO:0009306 "protein secretion" evidence=IMP
GO:0030334 "regulation of cell migration" evidence=IMP
ZFIN|ZDB-GENE-090312-110 si:ch73-131e21.5 "si:ch73-131e21.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030616-564 rab1a "RAB1A, member RAS oncogene family" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00004266 rab-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNL7 RAB1A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-873 rab1ba "zRAB1B, member RAS oncogene family a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040625-133 rab1bb "RAB1B, member RAS oncogene family b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1923558 Rab1b "RAB1B, member RAS oncogene family" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0283757 rab1A "Rab GTPase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|A1L528 RAB1A "RAB1A, member RAS oncogene family" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9TVU5RAB1_THEPANo assigned EC number0.45800.89880.6863yesN/A
Q9D1G1RAB1B_MOUSENo assigned EC number0.68270.83920.7014yesN/A
Q92928RAB1C_HUMANNo assigned EC number0.64820.83920.7014yesN/A
P28188RAD2A_ARATHNo assigned EC number0.60680.83920.6945yesN/A
Q9H0U4RAB1B_HUMANNo assigned EC number0.68270.83920.7014yesN/A
P11620YPT1_SCHPONo assigned EC number0.63440.85110.7044yesN/A
P01123YPT1_YEASTNo assigned EC number0.58780.85110.6941yesN/A
Q4UB16RAB1_THEANNo assigned EC number0.46400.8750.6681yesN/A
Q5RE13RAB1B_PONABNo assigned EC number0.68270.83920.7014yesN/A
P34139RAB1A_DICDINo assigned EC number0.66890.84520.7029yesN/A
P22125RAB1_DIPOMNo assigned EC number0.71030.84520.7029N/AN/A
Q2HJH2RAB1B_BOVINNo assigned EC number0.67580.83920.7014yesN/A
Q52NJ2RAB1A_PIGNo assigned EC number0.67580.84520.6926yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query168
cd01869166 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes t 6e-77
smart00175164 smart00175, RAB, Rab subfamily of small GTPases 2e-60
cd01867167 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase familie 6e-60
cd00154159 cd00154, Rab, Ras-related in brain (Rab) family of 1e-57
pfam00071162 pfam00071, Ras, Ras family 7e-56
cd01868165 cd01868, Rab11_like, Rab GTPase family 11 (Rab11)- 3e-47
cd01863161 cd01863, Rab18, Rab GTPase family 18 (Rab18) 1e-44
cd04110199 cd04110, Rab35, Rab GTPase family 35 (Rab35) 7e-44
cd01864165 cd01864, Rab19, Rab GTPase family 19 (Rab19) 3e-43
cd01866168 cd01866, Rab2, Rab GTPase family 2 (Rab2) 5e-41
cd04114169 cd04114, Rab30, Rab GTPase family 30 (Rab30) 1e-39
cd01860163 cd01860, Rab5_related, Rab-related GTPase family i 2e-39
PLN03108210 PLN03108, PLN03108, Rab family protein; Provisiona 7e-39
cd04111211 cd04111, Rab39, Rab GTPase family 39 (Rab39) 6e-37
cd04122166 cd04122, Rab14, Rab GTPase family 14 (Rab14) 8e-37
cd04123162 cd04123, Rab21, Rab GTPase family 21 (Rab21) 2e-36
cd04112191 cd04112, Rab26, Rab GTPase family 26 (Rab26) 1e-35
cd01861161 cd01861, Rab6, Rab GTPase family 6 (Rab6) 3e-35
PLN03118211 PLN03118, PLN03118, Rab family protein; Provisiona 3e-35
cd04113161 cd04113, Rab4, Rab GTPase family 4 (Rab4) 3e-35
cd01865165 cd01865, Rab3, Rab GTPase family 3 contains Rab3A, 3e-34
cd04120202 cd04120, Rab12, Rab GTPase family 12 (Rab12) 2e-33
PLN03110216 PLN03110, PLN03110, Rab GTPase; Provisional 2e-33
cd04127180 cd04127, Rab27A, Rab GTPase family 27a (Rab27a) 3e-32
cd01862172 cd01862, Rab7, Rab GTPase family 7 (Rab7) 5e-31
cd00876160 cd00876, Ras, Rat sarcoma (Ras) family of small gu 6e-31
cd04115170 cd04115, Rab33B_Rab33A, Rab GTPase family 33 inclu 7e-29
cd04117164 cd04117, Rab15, Rab GTPase family 15 (Rab15) 3e-27
smart00173164 smart00173, RAS, Ras subfamily of RAS small GTPase 2e-24
smart00010166 smart00010, small_GTPase, Small GTPase of the Ras 5e-24
cd04118193 cd04118, Rab24, Rab GTPase family 24 (Rab24) 1e-23
cd04107201 cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab1 4e-23
cd04121189 cd04121, Rab40, Rab GTPase family 40 (Rab40) conta 5e-23
cd04106162 cd04106, Rab23_like, Rab GTPase family 23 (Rab23)- 5e-23
cd04139163 cd04139, RalA_RalB, Ral (Ras-like) family containi 5e-23
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G 7e-23
cd04138162 cd04138, H_N_K_Ras_like, Ras GTPase family contain 2e-22
cd04145164 cd04145, M_R_Ras_like, R-Ras2/TC21, M-Ras/R-Ras3 2e-22
PTZ00369189 PTZ00369, PTZ00369, Ras-like protein; Provisional 1e-21
cd04119168 cd04119, RJL, Rab GTPase family J-like (RabJ-like) 1e-21
cd04137180 cd04137, RheB, Ras Homolog Enriched in Brain (RheB 2e-21
cd04108170 cd04108, Rab36_Rab34, Rab GTPase families 34 (Rab3 5e-21
cd04124161 cd04124, RabL2, Rab GTPase-like family 2 (Rab-like 8e-21
cd04101167 cd04101, RabL4, Rab GTPase-like family 4 (Rab-like 6e-20
cd04175164 cd04175, Rap1, Rap1 family GTPase consists of Rap1 1e-19
PTZ00099176 PTZ00099, PTZ00099, rab6; Provisional 1e-19
cd04176163 cd04176, Rap2, Rap2 family GTPase consists of Rap2 2e-19
cd04116170 cd04116, Rab9, Rab GTPase family 9 (Rab9) 5e-19
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 5e-19
cd00877166 cd00877, Ran, Ras-related nuclear proteins (Ran)/T 5e-18
cd00157171 cd00157, Rho, Ras homology family (Rho) of small g 3e-17
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 1e-16
cd04136164 cd04136, Rap_like, Rap-like family consists of Rap 5e-16
cd04144190 cd04144, Ras2, Rat sarcoma (Ras) family 2 of small 2e-15
PTZ00132215 PTZ00132, PTZ00132, GTP-binding nuclear protein Ra 3e-15
cd04177168 cd04177, RSR1, RSR1/Bud1p family GTPase 9e-15
PLN03071219 PLN03071, PLN03071, GTP-binding nuclear protein Ra 1e-14
smart00174174 smart00174, RHO, Rho (Ras homology) subfamily of R 3e-14
cd04141172 cd04141, Rit_Rin_Ric, Ras-like protein in all tiss 6e-14
smart00176200 smart00176, RAN, Ran (Ras-related nuclear proteins 9e-14
cd04132197 cd04132, Rho4_like, Ras homology family 4 (Rho4) o 1e-13
cd04140165 cd04140, ARHI_like, A Ras homolog member I (ARHI) 2e-13
cd04109213 cd04109, Rab28, Rab GTPase family 28 (Rab28) 6e-13
cd04126220 cd04126, Rab20, Rab GTPase family 20 (Rab20) 6e-12
cd04146166 cd04146, RERG_RasL11_like, Ras-related and Estroge 1e-11
cd04160168 cd04160, Arfrp1, Arf-related protein 1 (Arfrp1) 6e-11
cd00878158 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf 6e-11
cd04129190 cd04129, Rho2, Ras homology family 2 (Rho2) of sma 1e-10
cd04128182 cd04128, Spg1, Septum-promoting GTPase (Spg1) 2e-10
cd04159159 cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl 4e-10
cd04130173 cd04130, Wrch_1, Wnt-1 responsive Cdc42 homolog (W 7e-09
cd09914161 cd09914, RocCOR, Ras of complex proteins (Roc) C-t 3e-08
pfam08477116 pfam08477, Miro, Miro-like protein 3e-08
cd01870175 cd01870, RhoA_like, Ras homology family A (RhoA)-l 4e-08
cd04133173 cd04133, Rop_like, Rho-related protein from plants 5e-08
cd04134185 cd04134, Rho3, Ras homology family 3 (Rho3) of sma 9e-08
cd04153174 cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8) 2e-07
cd04148219 cd04148, RGK, Rem, Rem2, Rad, Gem/Kir (RGK) subfam 6e-07
cd01893168 cd01893, Miro1, Mitochondrial Rho family 1 (Miro1) 1e-06
smart00177175 smart00177, ARF, ARF-like small GTPases; ARF, ADP- 1e-06
cd04172182 cd04172, Rnd3_RhoE_Rho8, Rnd3/RhoE/Rho8 GTPases 2e-06
cd04152183 cd04152, Arl4_Arl7, Arf-like 4 (Arl4) and 7 (Arl7) 2e-06
PLN00023 334 PLN00023, PLN00023, GTP-binding protein; Provision 3e-06
cd04131176 cd04131, Rnd, Rho family GTPase subfamily Rnd incl 4e-06
pfam00025174 pfam00025, Arf, ADP-ribosylation factor family 5e-06
cd04157162 cd04157, Arl6, Arf-like 6 (Arl6) GTPase 5e-06
cd04147197 cd04147, Ras_dva, Ras - dorsal-ventral anterior lo 6e-06
cd04149168 cd04149, Arf6, ADP ribosylation factor 6 (Arf6) 2e-05
PTZ00133182 PTZ00133, PTZ00133, ADP-ribosylation factor; Provi 2e-05
cd04150159 cd04150, Arf1_5_like, ADP-ribosylation factor-1 (A 3e-05
COG2229187 COG2229, COG2229, Predicted GTPase [General functi 4e-05
cd04143247 cd04143, Rhes_like, Ras homolog enriched in striat 6e-05
cd01875191 cd01875, RhoG, Ras homolog family, member G (RhoG) 8e-05
cd04155174 cd04155, Arl3, Arf-like 3 (Arl3) GTPase 9e-05
cd04102204 cd04102, RabL3, Rab GTPase-like family 3 (Rab-like 9e-05
cd04156160 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 1e-04
cd04174232 cd04174, Rnd1_Rho6, Rnd1/Rho6 GTPases 1e-04
cd00879191 cd00879, Sar1, Sar1 is an essential component of C 7e-04
cd04173221 cd04173, Rnd2_Rho7, Rnd2/Rho7 GTPases 0.001
PRK05291449 PRK05291, trmE, tRNA modification GTPase TrmE; Rev 0.002
cd04163168 cd04163, Era, E 0.004
>gnl|CDD|206661 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes the yeast homolog Ypt1 Back     alignment and domain information
 Score =  226 bits (578), Expect = 6e-77
 Identities = 91/112 (81%), Positives = 99/112 (88%)

Query: 24  IWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQETFNNLKQWLEEIDRYACDNVNKLLVG 83
           IWDTAGQERFRTITSSYYRGAHGII+VYD TDQE+FNN+KQWL+EIDRYA +NVNKLLVG
Sbjct: 55  IWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVG 114

Query: 84  NKNDQTSKKAVDYQVAKEYADHLKIPFLETSAKNGANVEQAFLTMATEIKKR 135
           NK D T KK VDY  AKE+AD L IPFLETSAKN  NVE+AF+TMA EIKKR
Sbjct: 115 NKCDLTDKKVVDYTEAKEFADELGIPFLETSAKNATNVEEAFMTMAREIKKR 166


Rab1/Ypt1 subfamily. Rab1 is found in every eukaryote and is a key regulatory component for the transport of vesicles from the ER to the Golgi apparatus. Studies on mutations of Ypt1, the yeast homolog of Rab1, showed that this protein is necessary for the budding of vesicles of the ER as well as for their transport to, and fusion with, the Golgi apparatus. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation. Length = 166

>gnl|CDD|197555 smart00175, RAB, Rab subfamily of small GTPases Back     alignment and domain information
>gnl|CDD|206659 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase families 8, 10, 13 (Rab8, Rab10, Rab13) Back     alignment and domain information
>gnl|CDD|206640 cd00154, Rab, Ras-related in brain (Rab) family of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|215692 pfam00071, Ras, Ras family Back     alignment and domain information
>gnl|CDD|206660 cd01868, Rab11_like, Rab GTPase family 11 (Rab11)-like includes Rab11a, Rab11b, and Rab25 Back     alignment and domain information
>gnl|CDD|206656 cd01863, Rab18, Rab GTPase family 18 (Rab18) Back     alignment and domain information
>gnl|CDD|133310 cd04110, Rab35, Rab GTPase family 35 (Rab35) Back     alignment and domain information
>gnl|CDD|133267 cd01864, Rab19, Rab GTPase family 19 (Rab19) Back     alignment and domain information
>gnl|CDD|206658 cd01866, Rab2, Rab GTPase family 2 (Rab2) Back     alignment and domain information
>gnl|CDD|133314 cd04114, Rab30, Rab GTPase family 30 (Rab30) Back     alignment and domain information
>gnl|CDD|206653 cd01860, Rab5_related, Rab-related GTPase family includes Rab5 and Rab22; regulates early endosome fusion Back     alignment and domain information
>gnl|CDD|178655 PLN03108, PLN03108, Rab family protein; Provisional Back     alignment and domain information
>gnl|CDD|133311 cd04111, Rab39, Rab GTPase family 39 (Rab39) Back     alignment and domain information
>gnl|CDD|133322 cd04122, Rab14, Rab GTPase family 14 (Rab14) Back     alignment and domain information
>gnl|CDD|133323 cd04123, Rab21, Rab GTPase family 21 (Rab21) Back     alignment and domain information
>gnl|CDD|206695 cd04112, Rab26, Rab GTPase family 26 (Rab26) Back     alignment and domain information
>gnl|CDD|206654 cd01861, Rab6, Rab GTPase family 6 (Rab6) Back     alignment and domain information
>gnl|CDD|215587 PLN03118, PLN03118, Rab family protein; Provisional Back     alignment and domain information
>gnl|CDD|206696 cd04113, Rab4, Rab GTPase family 4 (Rab4) Back     alignment and domain information
>gnl|CDD|206657 cd01865, Rab3, Rab GTPase family 3 contains Rab3A, Rab3B, Rab3C and Rab3D Back     alignment and domain information
>gnl|CDD|206699 cd04120, Rab12, Rab GTPase family 12 (Rab12) Back     alignment and domain information
>gnl|CDD|178657 PLN03110, PLN03110, Rab GTPase; Provisional Back     alignment and domain information
>gnl|CDD|206700 cd04127, Rab27A, Rab GTPase family 27a (Rab27a) Back     alignment and domain information
>gnl|CDD|206655 cd01862, Rab7, Rab GTPase family 7 (Rab7) Back     alignment and domain information
>gnl|CDD|206642 cd00876, Ras, Rat sarcoma (Ras) family of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|133315 cd04115, Rab33B_Rab33A, Rab GTPase family 33 includes Rab33A and Rab33B Back     alignment and domain information
>gnl|CDD|206698 cd04117, Rab15, Rab GTPase family 15 (Rab15) Back     alignment and domain information
>gnl|CDD|214541 smart00173, RAS, Ras subfamily of RAS small GTPases Back     alignment and domain information
>gnl|CDD|197466 smart00010, small_GTPase, Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>gnl|CDD|133318 cd04118, Rab24, Rab GTPase family 24 (Rab24) Back     alignment and domain information
>gnl|CDD|206692 cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab18) and 32 (Rab32) Back     alignment and domain information
>gnl|CDD|133321 cd04121, Rab40, Rab GTPase family 40 (Rab40) contains Rab40a, Rab40b and Rab40c Back     alignment and domain information
>gnl|CDD|133306 cd04106, Rab23_like, Rab GTPase family 23 (Rab23)-like Back     alignment and domain information
>gnl|CDD|206710 cd04139, RalA_RalB, Ral (Ras-like) family containing highly homologous RalA and RalB Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|133338 cd04138, H_N_K_Ras_like, Ras GTPase family containing H-Ras,N-Ras and K-Ras4A/4B Back     alignment and domain information
>gnl|CDD|133345 cd04145, M_R_Ras_like, R-Ras2/TC21, M-Ras/R-Ras3 Back     alignment and domain information
>gnl|CDD|240385 PTZ00369, PTZ00369, Ras-like protein; Provisional Back     alignment and domain information
>gnl|CDD|133319 cd04119, RJL, Rab GTPase family J-like (RabJ-like) Back     alignment and domain information
>gnl|CDD|206709 cd04137, RheB, Ras Homolog Enriched in Brain (RheB) is a small GTPase Back     alignment and domain information
>gnl|CDD|206693 cd04108, Rab36_Rab34, Rab GTPase families 34 (Rab34) and 36 (Rab36) Back     alignment and domain information
>gnl|CDD|133324 cd04124, RabL2, Rab GTPase-like family 2 (Rab-like2) Back     alignment and domain information
>gnl|CDD|206688 cd04101, RabL4, Rab GTPase-like family 4 (Rab-like4) Back     alignment and domain information
>gnl|CDD|133375 cd04175, Rap1, Rap1 family GTPase consists of Rap1a and Rap1b isoforms Back     alignment and domain information
>gnl|CDD|185444 PTZ00099, PTZ00099, rab6; Provisional Back     alignment and domain information
>gnl|CDD|133376 cd04176, Rap2, Rap2 family GTPase consists of Rap2a, Rap2b, and Rap2c Back     alignment and domain information
>gnl|CDD|206697 cd04116, Rab9, Rab GTPase family 9 (Rab9) Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206643 cd00877, Ran, Ras-related nuclear proteins (Ran)/TC4 family of small GTPases Back     alignment and domain information
>gnl|CDD|206641 cd00157, Rho, Ras homology family (Rho) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|206708 cd04136, Rap_like, Rap-like family consists of Rap1, Rap2 and RSR1 Back     alignment and domain information
>gnl|CDD|133344 cd04144, Ras2, Rat sarcoma (Ras) family 2 of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|240284 PTZ00132, PTZ00132, GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>gnl|CDD|133377 cd04177, RSR1, RSR1/Bud1p family GTPase Back     alignment and domain information
>gnl|CDD|178620 PLN03071, PLN03071, GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>gnl|CDD|197554 smart00174, RHO, Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>gnl|CDD|206712 cd04141, Rit_Rin_Ric, Ras-like protein in all tissues (Rit), Ras-like protein in neurons (Rin) and Ras-related protein which interacts with calmodulin (Ric) Back     alignment and domain information
>gnl|CDD|128473 smart00176, RAN, Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>gnl|CDD|206704 cd04132, Rho4_like, Ras homology family 4 (Rho4) of small guanosine triphosphatases (GTPases)-like Back     alignment and domain information
>gnl|CDD|206711 cd04140, ARHI_like, A Ras homolog member I (ARHI) Back     alignment and domain information
>gnl|CDD|206694 cd04109, Rab28, Rab GTPase family 28 (Rab28) Back     alignment and domain information
>gnl|CDD|133326 cd04126, Rab20, Rab GTPase family 20 (Rab20) Back     alignment and domain information
>gnl|CDD|206713 cd04146, RERG_RasL11_like, Ras-related and Estrogen-Regulated Growth inhibitor (RERG) and Ras-like 11 (RasL11)-like families Back     alignment and domain information
>gnl|CDD|206725 cd04160, Arfrp1, Arf-related protein 1 (Arfrp1) Back     alignment and domain information
>gnl|CDD|206644 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf-like (Arl) small GTPases Back     alignment and domain information
>gnl|CDD|206702 cd04129, Rho2, Ras homology family 2 (Rho2) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206701 cd04128, Spg1, Septum-promoting GTPase (Spg1) Back     alignment and domain information
>gnl|CDD|206724 cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl10) GTPases Back     alignment and domain information
>gnl|CDD|133330 cd04130, Wrch_1, Wnt-1 responsive Cdc42 homolog (Wrch-1) is a Rho family GTPase similar to Cdc42 Back     alignment and domain information
>gnl|CDD|206741 cd09914, RocCOR, Ras of complex proteins (Roc) C-terminal of Roc (COR) domain family Back     alignment and domain information
>gnl|CDD|219856 pfam08477, Miro, Miro-like protein Back     alignment and domain information
>gnl|CDD|206662 cd01870, RhoA_like, Ras homology family A (RhoA)-like includes RhoA, RhoB and RhoC Back     alignment and domain information
>gnl|CDD|206705 cd04133, Rop_like, Rho-related protein from plants (Rop)-like Back     alignment and domain information
>gnl|CDD|206706 cd04134, Rho3, Ras homology family 3 (Rho3) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|133353 cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8) GTPases Back     alignment and domain information
>gnl|CDD|206715 cd04148, RGK, Rem, Rem2, Rad, Gem/Kir (RGK) subfamily of Ras GTPases Back     alignment and domain information
>gnl|CDD|206680 cd01893, Miro1, Mitochondrial Rho family 1 (Miro1), N-terminal Back     alignment and domain information
>gnl|CDD|128474 smart00177, ARF, ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>gnl|CDD|206735 cd04172, Rnd3_RhoE_Rho8, Rnd3/RhoE/Rho8 GTPases Back     alignment and domain information
>gnl|CDD|206719 cd04152, Arl4_Arl7, Arf-like 4 (Arl4) and 7 (Arl7) GTPases Back     alignment and domain information
>gnl|CDD|177661 PLN00023, PLN00023, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|206703 cd04131, Rnd, Rho family GTPase subfamily Rnd includes Rnd1/Rho6, Rnd2/Rho7, and Rnd3/RhoE/Rho8 Back     alignment and domain information
>gnl|CDD|200938 pfam00025, Arf, ADP-ribosylation factor family Back     alignment and domain information
>gnl|CDD|206722 cd04157, Arl6, Arf-like 6 (Arl6) GTPase Back     alignment and domain information
>gnl|CDD|206714 cd04147, Ras_dva, Ras - dorsal-ventral anterior localization (Ras-dva) family Back     alignment and domain information
>gnl|CDD|206716 cd04149, Arf6, ADP ribosylation factor 6 (Arf6) Back     alignment and domain information
>gnl|CDD|173423 PTZ00133, PTZ00133, ADP-ribosylation factor; Provisional Back     alignment and domain information
>gnl|CDD|206717 cd04150, Arf1_5_like, ADP-ribosylation factor-1 (Arf1) and ADP-ribosylation factor-5 (Arf5) Back     alignment and domain information
>gnl|CDD|225138 COG2229, COG2229, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|133343 cd04143, Rhes_like, Ras homolog enriched in striatum (Rhes) and activator of G-protein signaling 1 (Dexras1/AGS1) Back     alignment and domain information
>gnl|CDD|133277 cd01875, RhoG, Ras homolog family, member G (RhoG) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206721 cd04155, Arl3, Arf-like 3 (Arl3) GTPase Back     alignment and domain information
>gnl|CDD|206689 cd04102, RabL3, Rab GTPase-like family 3 (Rab-like3) Back     alignment and domain information
>gnl|CDD|133356 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 (ARLTS1 or Arl11) Back     alignment and domain information
>gnl|CDD|206737 cd04174, Rnd1_Rho6, Rnd1/Rho6 GTPases Back     alignment and domain information
>gnl|CDD|206645 cd00879, Sar1, Sar1 is an essential component of COPII vesicle coats Back     alignment and domain information
>gnl|CDD|206736 cd04173, Rnd2_Rho7, Rnd2/Rho7 GTPases Back     alignment and domain information
>gnl|CDD|235392 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>gnl|CDD|206726 cd04163, Era, E Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 168
KOG0084|consensus205 100.0
KOG0092|consensus200 100.0
KOG0078|consensus207 100.0
KOG0094|consensus221 100.0
KOG0098|consensus216 99.98
KOG0088|consensus218 99.97
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.97
KOG0087|consensus222 99.97
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.97
KOG0079|consensus198 99.97
PTZ00099176 rab6; Provisional 99.97
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.97
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.97
KOG0080|consensus209 99.97
KOG0093|consensus193 99.97
KOG0394|consensus210 99.97
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.96
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.96
KOG0091|consensus213 99.96
PLN03110216 Rab GTPase; Provisional 99.96
KOG0083|consensus192 99.96
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.96
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.96
KOG0095|consensus213 99.96
KOG0086|consensus214 99.95
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.95
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.95
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.95
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.95
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.95
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.95
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.95
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.95
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.95
KOG0081|consensus219 99.95
PTZ00369189 Ras-like protein; Provisional 99.95
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.95
PLN03108210 Rab family protein; Provisional 99.94
KOG0097|consensus215 99.94
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.94
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.94
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.94
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.94
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.94
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.94
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.94
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.94
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.94
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.94
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.94
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.94
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.94
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.93
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.93
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 99.93
PLN03118211 Rab family protein; Provisional 99.93
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.93
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.93
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.93
KOG0395|consensus196 99.93
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.93
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.93
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.92
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.92
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.92
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.92
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.92
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.92
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.92
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.92
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.92
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.92
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.92
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.92
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.92
KOG0393|consensus198 99.92
PLN00223181 ADP-ribosylation factor; Provisional 99.91
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.91
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.91
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.91
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.91
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.91
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.91
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.91
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.91
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.91
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.91
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.91
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.91
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.91
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.91
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.91
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.91
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.9
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.9
PTZ00133182 ADP-ribosylation factor; Provisional 99.9
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.89
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.89
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.89
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.89
KOG0070|consensus181 99.89
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.89
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.89
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.88
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.88
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.88
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.88
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.88
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.88
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.88
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.87
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.87
KOG0073|consensus185 99.87
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.87
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.87
KOG0075|consensus186 99.87
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.86
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.86
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.85
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.85
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.84
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.84
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.84
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.84
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 99.83
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.83
KOG0071|consensus180 99.82
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.82
KOG4252|consensus246 99.81
KOG0072|consensus182 99.81
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.8
KOG0076|consensus197 99.79
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.78
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.78
KOG3883|consensus198 99.77
PLN00023334 GTP-binding protein; Provisional 99.76
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.76
PRK12299335 obgE GTPase CgtA; Reviewed 99.75
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.73
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.73
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.71
KOG4423|consensus229 99.7
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.7
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.7
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.69
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.69
KOG1673|consensus205 99.69
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.68
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.68
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.67
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.66
PRK05433 600 GTP-binding protein LepA; Provisional 99.64
COG1100219 GTPase SAR1 and related small G proteins [General 99.64
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.64
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.64
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.63
COG2229187 Predicted GTPase [General function prediction only 99.63
KOG0074|consensus185 99.63
PRK04213201 GTP-binding protein; Provisional 99.62
PRK03003472 GTP-binding protein Der; Reviewed 99.62
cd00881189 GTP_translation_factor GTP translation factor fami 99.61
KOG0096|consensus216 99.6
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.6
PRK12297424 obgE GTPase CgtA; Reviewed 99.6
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.59
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.59
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.59
PRK15494339 era GTPase Era; Provisional 99.58
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.58
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.58
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.58
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 99.57
PRK12296 500 obgE GTPase CgtA; Reviewed 99.57
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.57
PRK03003 472 GTP-binding protein Der; Reviewed 99.57
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 99.56
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 99.56
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.55
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 99.54
PRK05306 787 infB translation initiation factor IF-2; Validated 99.54
CHL00189 742 infB translation initiation factor 2; Provisional 99.54
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 99.53
TIGR00483 426 EF-1_alpha translation elongation factor EF-1 alph 99.52
cd00066317 G-alpha G protein alpha subunit. The alpha subunit 99.52
PRK11058426 GTPase HflX; Provisional 99.52
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.5
smart00275342 G_alpha G protein alpha subunit. Subunit of G prot 99.48
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.47
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.47
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.47
PRK12317 425 elongation factor 1-alpha; Reviewed 99.47
PRK10218 607 GTP-binding protein; Provisional 99.46
TIGR03680 406 eif2g_arch translation initiation factor 2 subunit 99.46
PRK12298390 obgE GTPase CgtA; Reviewed 99.46
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.45
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.45
PRK00093 435 GTP-binding protein Der; Reviewed 99.45
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.45
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.44
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.44
PRK04000 411 translation initiation factor IF-2 subunit gamma; 99.44
PRK00093435 GTP-binding protein Der; Reviewed 99.43
KOG0462|consensus 650 99.42
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.42
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 99.42
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.4
PRK00089292 era GTPase Era; Reviewed 99.4
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.39
PRK04004 586 translation initiation factor IF-2; Validated 99.36
cd04105203 SR_beta Signal recognition particle receptor, beta 99.36
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.35
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.35
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.32
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.31
cd01896233 DRG The developmentally regulated GTP-binding prot 99.31
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 99.3
PRK12736 394 elongation factor Tu; Reviewed 99.29
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.29
TIGR00485 394 EF-Tu translation elongation factor TU. This align 99.28
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase 99.28
PLN00043 447 elongation factor 1-alpha; Provisional 99.27
PRK14845 1049 translation initiation factor IF-2; Provisional 99.27
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesi 99.27
KOG0077|consensus193 99.25
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.23
KOG0082|consensus354 99.22
PRK12735 396 elongation factor Tu; Reviewed 99.22
PRK09866 741 hypothetical protein; Provisional 99.21
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 99.21
TIGR02034 406 CysN sulfate adenylyltransferase, large subunit. H 99.2
COG1159298 Era GTPase [General function prediction only] 99.19
PRK00741 526 prfC peptide chain release factor 3; Provisional 99.19
KOG1489|consensus366 99.19
PRK13351 687 elongation factor G; Reviewed 99.18
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 99.17
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 99.16
COG1217 603 TypA Predicted membrane GTPase involved in stress 99.14
PTZ00327 460 eukaryotic translation initiation factor 2 gamma s 99.14
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 99.12
COG1160 444 Predicted GTPases [General function prediction onl 99.12
KOG1145|consensus 683 99.12
PRK12289 352 GTPase RsgA; Reviewed 99.11
COG1160444 Predicted GTPases [General function prediction onl 99.1
PRK12740 668 elongation factor G; Reviewed 99.09
CHL00071 409 tufA elongation factor Tu 99.08
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 99.08
PRK00049 396 elongation factor Tu; Reviewed 99.08
PTZ00141 446 elongation factor 1- alpha; Provisional 99.07
PRK00098298 GTPase RsgA; Reviewed 99.07
PLN03126 478 Elongation factor Tu; Provisional 99.06
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 99.06
PLN03127 447 Elongation factor Tu; Provisional 99.05
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 99.05
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 99.02
COG0486454 ThdF Predicted GTPase [General function prediction 99.02
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.01
COG2262411 HflX GTPases [General function prediction only] 99.0
PRK13768253 GTPase; Provisional 98.99
KOG0090|consensus238 98.99
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 98.99
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 98.97
PRK12288 347 GTPase RsgA; Reviewed 98.97
COG0536369 Obg Predicted GTPase [General function prediction 98.96
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 98.93
PRK12739 691 elongation factor G; Reviewed 98.93
PF00503389 G-alpha: G-protein alpha subunit; InterPro: IPR001 98.91
COG2895 431 CysN GTPases - Sulfate adenylate transferase subun 98.91
TIGR00503 527 prfC peptide chain release factor 3. This translat 98.91
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 98.89
KOG1707|consensus 625 98.87
TIGR03597 360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 98.87
COG5256 428 TEF1 Translation elongation factor EF-1alpha (GTPa 98.86
COG0218200 Predicted GTPase [General function prediction only 98.85
COG1084346 Predicted GTPase [General function prediction only 98.83
PF09439181 SRPRB: Signal recognition particle receptor beta s 98.79
KOG1423|consensus379 98.78
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.75
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 98.7
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 98.67
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 98.61
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 98.6
KOG1144|consensus 1064 98.6
PRK00007 693 elongation factor G; Reviewed 98.57
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 98.57
COG5257 415 GCD11 Translation initiation factor 2, gamma subun 98.56
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 98.56
KOG0458|consensus 603 98.56
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 98.51
TIGR00101199 ureG urease accessory protein UreG. This model rep 98.49
PRK01889 356 GTPase RsgA; Reviewed 98.49
COG1163365 DRG Predicted GTPase [General function prediction 98.46
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 98.43
COG3276 447 SelB Selenocysteine-specific translation elongatio 98.42
TIGR03596 276 GTPase_YlqF ribosome biogenesis GTP-binding protei 98.4
KOG1532|consensus366 98.4
KOG0085|consensus359 98.38
KOG1490|consensus 620 98.38
PRK13796 365 GTPase YqeH; Provisional 98.37
PRK09435332 membrane ATPase/protein kinase; Provisional 98.37
PRK09602396 translation-associated GTPase; Reviewed 98.37
COG4108 528 PrfC Peptide chain release factor RF-3 [Translatio 98.36
KOG1707|consensus625 98.33
KOG0099|consensus379 98.31
PRK09563 287 rbgA GTPase YlqF; Reviewed 98.3
COG3596296 Predicted GTPase [General function prediction only 98.27
KOG0705|consensus 749 98.26
COG1162301 Predicted GTPases [General function prediction onl 98.24
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 98.22
PLN00116 843 translation elongation factor EF-2 subunit; Provis 98.2
PRK07560 731 elongation factor EF-2; Reviewed 98.17
PTZ00416 836 elongation factor 2; Provisional 98.15
KOG1191|consensus531 98.14
COG4917148 EutP Ethanolamine utilization protein [Amino acid 98.14
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 98.12
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 98.12
COG0480 697 FusA Translation elongation factors (GTPases) [Tra 98.1
KOG3886|consensus295 98.1
KOG3905|consensus 473 97.94
KOG0461|consensus 522 97.93
KOG0468|consensus 971 97.91
smart00010124 small_GTPase Small GTPase of the Ras superfamily; 97.91
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 97.91
PF0685858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte 97.84
PF05783 472 DLIC: Dynein light intermediate chain (DLIC); Inte 97.74
COG5258 527 GTPBP1 GTPase [General function prediction only] 97.71
COG0050 394 TufB GTPases - translation elongation factors [Tra 97.64
cd03110179 Fer4_NifH_child This protein family's function is 97.64
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 97.63
KOG0466|consensus 466 97.61
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 97.55
TIGR02836 492 spore_IV_A stage IV sporulation protein A. A compa 97.46
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 97.41
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 97.31
KOG0465|consensus 721 97.26
KOG0464|consensus 753 97.26
KOG1424|consensus 562 97.24
KOG3887|consensus 347 97.22
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 97.21
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 97.16
KOG1143|consensus 591 97.12
PTZ00258390 GTP-binding protein; Provisional 97.07
KOG0467|consensus 887 96.96
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 96.94
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 96.92
KOG1954|consensus 532 96.88
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 96.78
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 96.76
KOG0460|consensus 449 96.66
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 96.57
KOG0459|consensus 501 96.57
TIGR00064272 ftsY signal recognition particle-docking protein F 96.49
PRK09601364 GTP-binding protein YchF; Reviewed 96.34
KOG1486|consensus364 96.27
COG1161 322 Predicted GTPases [General function prediction onl 96.22
KOG0448|consensus 749 96.14
PRK10416318 signal recognition particle-docking protein FtsY; 96.13
KOG0463|consensus 641 96.08
PF11111176 CENP-M: Centromere protein M (CENP-M); InterPro: I 96.03
PF05049 376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 95.85
cd02038139 FleN-like FleN is a member of the Fer4_NifH superf 95.81
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 95.73
KOG0410|consensus410 95.52
PHA02518211 ParA-like protein; Provisional 95.5
COG1149284 MinD superfamily P-loop ATPase containing an inser 95.41
KOG2423|consensus 572 95.33
cd03111106 CpaE_like This protein family consists of proteins 95.29
COG4963366 CpaE Flp pilus assembly protein, ATPase CpaE [Intr 95.26
KOG2486|consensus320 95.15
KOG2484|consensus 435 95.08
PRK14974336 cell division protein FtsY; Provisional 95.07
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 95.05
cd02036179 MinD Bacterial cell division requires the formatio 94.88
KOG0469|consensus 842 94.86
PF14331266 ImcF-related_N: ImcF-related N-terminal domain 94.39
KOG0447|consensus 980 94.36
TIGR01968261 minD_bact septum site-determining protein MinD. Th 93.79
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 93.77
TIGR01969251 minD_arch cell division ATPase MinD, archaeal. Thi 93.73
PRK00771 437 signal recognition particle protein Srp54; Provisi 93.44
cd02117212 NifH_like This family contains the NifH (iron prot 93.42
TIGR03371246 cellulose_yhjQ cellulose synthase operon protein Y 93.41
TIGR00959 428 ffh signal recognition particle protein. This mode 93.25
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 93.2
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of 93.16
PRK13505557 formate--tetrahydrofolate ligase; Provisional 93.13
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 93.05
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 92.86
PRK13185270 chlL protochlorophyllide reductase iron-sulfur ATP 92.67
CHL00175281 minD septum-site determining protein; Validated 92.58
KOG4273|consensus 418 92.56
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 92.54
PRK13849231 putative crown gall tumor protein VirC1; Provision 92.11
KOG1547|consensus336 91.9
cd03112158 CobW_like The function of this protein family is u 91.87
COG5019 373 CDC3 Septin family protein [Cell division and chro 91.57
PRK10818270 cell division inhibitor MinD; Provisional 91.15
PRK10867 433 signal recognition particle protein; Provisional 90.96
PF01656195 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai 90.82
PF07015231 VirC1: VirC1 protein; InterPro: IPR009744 This fam 90.65
cd02042104 ParA ParA and ParB of Caulobacter crescentus belon 90.59
cd02032267 Bchl_like This family of proteins contains bchL an 90.53
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 89.86
cd03115173 SRP The signal recognition particle (SRP) mediates 89.54
cd03114148 ArgK-like The function of this protein family is u 89.51
TIGR01007204 eps_fam capsular exopolysaccharide family. This mo 89.42
COG0523323 Putative GTPases (G3E family) [General function pr 88.13
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 87.98
cd02040270 NifH NifH gene encodes component II (iron protein) 87.21
COG0552340 FtsY Signal recognition particle GTPase [Intracell 87.15
TIGR01281268 DPOR_bchL light-independent protochlorophyllide re 86.9
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 86.89
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 86.66
cd02033329 BchX Chlorophyllide reductase converts chlorophyll 86.62
KOG2655|consensus 366 86.58
PF09547 492 Spore_IV_A: Stage IV sporulation protein A (spore_ 86.16
KOG3929|consensus363 85.7
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 85.67
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 84.56
CHL00072290 chlL photochlorophyllide reductase subunit L 83.95
PRK11670369 antiporter inner membrane protein; Provisional 83.48
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 83.32
PF09419168 PGP_phosphatase: Mitochondrial PGP phosphatase; In 83.25
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 82.99
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 82.77
TIGR02016296 BchX chlorophyllide reductase iron protein subunit 82.08
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 82.07
PF01268557 FTHFS: Formate--tetrahydrofolate ligase; InterPro: 81.25
cd00477524 FTHFS Formyltetrahydrofolate synthetase (FTHFS) ca 81.13
KOG3022|consensus300 80.07
>KOG0084|consensus Back     alignment and domain information
Probab=100.00  E-value=4.5e-36  Score=207.39  Aligned_cols=163  Identities=55%  Similarity=0.842  Sum_probs=141.3

Q ss_pred             ccccccc----eeeeeeCCeEEEEEEEeCCCchhhcccchhhhcCCcEEEEEEeCCChhhHHHHHHHHHHHHHhcCCCCc
Q psy2646           3 LLLPYQT----LQNKKEERTRTLIVIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQETFNNLKQWLEEIDRYACDNVN   78 (168)
Q Consensus         3 ~~~~t~~----~~~~~~~~~~~~l~l~Dt~G~~~~~~~~~~~~~~~d~~i~v~d~~~~~s~~~~~~~~~~i~~~~~~~~p   78 (168)
                      .+..|+|    .+++.++++.+.||||||+||+||+.+...||++|+|+|+|||+++..||+.+..|+.++.++...++|
T Consensus        37 ~~~sTIGVDf~~rt~e~~gk~iKlQIWDTAGQERFrtit~syYR~ahGii~vyDiT~~~SF~~v~~Wi~Ei~~~~~~~v~  116 (205)
T KOG0084|consen   37 SYISTIGVDFKIRTVELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIFVYDITKQESFNNVKRWIQEIDRYASENVP  116 (205)
T ss_pred             hhcceeeeEEEEEEeeecceEEEEEeeeccccHHHhhhhHhhccCCCeEEEEEEcccHHHhhhHHHHHHHhhhhccCCCC
Confidence            4566777    567778999999999999999999999999999999999999999999999999999999998877899


Q ss_pred             EEEEEecCCCCCCcccCHHHHHHHHHhcCCC-EEEEeccCCCCHHHHHHHHHHHHHHHhccCCCCCCchhhhhhccCCCC
Q psy2646          79 KLLVGNKNDQTSKKAVDYQVAKEYADHLKIP-FLETSAKNGANVEQAFLTMATEIKKRVTKDEKPSSESDAKKLNLNSGK  157 (168)
Q Consensus        79 iivv~nK~Dl~~~~~v~~~~~~~~~~~~~~~-~~~vSa~~~~~i~~i~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  157 (168)
                      .++||||+|+.+.+.++.++++.|+..++++ ++++||+++.|++++|..|...+..+.......+.  .....-+..++
T Consensus       117 ~lLVGNK~Dl~~~~~v~~~~a~~fa~~~~~~~f~ETSAK~~~NVe~~F~~la~~lk~~~~~~~~~~~--~~~~~~ql~~~  194 (205)
T KOG0084|consen  117 KLLVGNKCDLTEKRVVSTEEAQEFADELGIPIFLETSAKDSTNVEDAFLTLAKELKQRKGLHVKWST--ASLESVQLKGT  194 (205)
T ss_pred             eEEEeeccccHhheecCHHHHHHHHHhcCCcceeecccCCccCHHHHHHHHHHHHHHhcccCCCCCc--CCCCceeeCCC
Confidence            9999999999999999999999999999998 99999999999999999999999999887777664  22222233333


Q ss_pred             CCCCCCCCCCC
Q psy2646         158 PVDAPRSGGCC  168 (168)
Q Consensus       158 ~~~~~~~~~c~  168 (168)
                      +. ....++||
T Consensus       195 p~-~~~~~~~C  204 (205)
T KOG0084|consen  195 PV-KKSNGGCC  204 (205)
T ss_pred             Cc-ccccCCCC
Confidence            33 35666688



>KOG0092|consensus Back     alignment and domain information
>KOG0078|consensus Back     alignment and domain information
>KOG0094|consensus Back     alignment and domain information
>KOG0098|consensus Back     alignment and domain information
>KOG0088|consensus Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>KOG0087|consensus Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>KOG0079|consensus Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>KOG0080|consensus Back     alignment and domain information
>KOG0093|consensus Back     alignment and domain information
>KOG0394|consensus Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>KOG0091|consensus Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>KOG0083|consensus Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>KOG0095|consensus Back     alignment and domain information
>KOG0086|consensus Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>KOG0081|consensus Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>KOG0097|consensus Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>KOG0395|consensus Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>KOG0393|consensus Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>KOG0070|consensus Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>KOG0073|consensus Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>KOG0075|consensus Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>KOG0071|consensus Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>KOG4252|consensus Back     alignment and domain information
>KOG0072|consensus Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>KOG0076|consensus Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>KOG3883|consensus Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>KOG4423|consensus Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>KOG1673|consensus Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0074|consensus Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>KOG0096|consensus Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>cd00066 G-alpha G protein alpha subunit Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>smart00275 G_alpha G protein alpha subunit Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>KOG0462|consensus Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG0077|consensus Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>KOG0082|consensus Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG1145|consensus Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>KOG0090|consensus Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) [] Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>KOG1144|consensus Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>KOG0458|consensus Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>KOG1532|consensus Back     alignment and domain information
>KOG0085|consensus Back     alignment and domain information
>KOG1490|consensus Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>KOG0099|consensus Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3886|consensus Back     alignment and domain information
>KOG3905|consensus Back     alignment and domain information
>KOG0461|consensus Back     alignment and domain information
>KOG0468|consensus Back     alignment and domain information
>smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1) Back     alignment and domain information
>PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>KOG0466|consensus Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>KOG0465|consensus Back     alignment and domain information
>KOG0464|consensus Back     alignment and domain information
>KOG1424|consensus Back     alignment and domain information
>KOG3887|consensus Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1143|consensus Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>KOG0467|consensus Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>KOG1954|consensus Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>KOG0460|consensus Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0459|consensus Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>KOG1486|consensus Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG0448|consensus Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>KOG0463|consensus Back     alignment and domain information
>PF11111 CENP-M: Centromere protein M (CENP-M); InterPro: IPR020987 The prime candidate for specifying centromere identity is the array of nucleosomes assembles associated with CENP-A [] Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>KOG0410|consensus Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>KOG2423|consensus Back     alignment and domain information
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>COG4963 CpaE Flp pilus assembly protein, ATPase CpaE [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2486|consensus Back     alignment and domain information
>KOG2484|consensus Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>KOG0469|consensus Back     alignment and domain information
>PF14331 ImcF-related_N: ImcF-related N-terminal domain Back     alignment and domain information
>KOG0447|consensus Back     alignment and domain information
>TIGR01968 minD_bact septum site-determining protein MinD Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>TIGR01969 minD_arch cell division ATPase MinD, archaeal Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03348 VI_IcmF type VI secretion protein IcmF Back     alignment and domain information
>PRK13505 formate--tetrahydrofolate ligase; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional Back     alignment and domain information
>CHL00175 minD septum-site determining protein; Validated Back     alignment and domain information
>KOG4273|consensus Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>PRK13849 putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>KOG1547|consensus Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>PRK10818 cell division inhibitor MinD; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases Back     alignment and domain information
>PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>cd02032 Bchl_like This family of proteins contains bchL and chlL Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>TIGR01007 eps_fam capsular exopolysaccharide family Back     alignment and domain information
>COG0523 Putative GTPases (G3E family) [General function prediction only] Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd02033 BchX Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring Back     alignment and domain information
>KOG2655|consensus Back     alignment and domain information
>PF09547 Spore_IV_A: Stage IV sporulation protein A (spore_IV_A); InterPro: IPR014201 This entry is designated stage IV sporulation protein A Back     alignment and domain information
>KOG3929|consensus Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>CHL00072 chlL photochlorophyllide reductase subunit L Back     alignment and domain information
>PRK11670 antiporter inner membrane protein; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02016 BchX chlorophyllide reductase iron protein subunit X Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF01268 FTHFS: Formate--tetrahydrofolate ligase; InterPro: IPR000559 Formate--tetrahydrofolate ligase (6 Back     alignment and domain information
>cd00477 FTHFS Formyltetrahydrofolate synthetase (FTHFS) catalyzes the ATP-dependent activation of formate ion via its addition to the N10 position of tetrahydrofolate Back     alignment and domain information
>KOG3022|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query168
3tkl_A196 Crystal Structure Of The Gtp-Bound Rab1a In Complex 9e-52
4fmd_F164 Espg-Rab1 Complex Structure At 3.05 A Length = 164 1e-51
3sfv_A181 Crystal Structure Of The Gdp-Bound Rab1a S25n Mutan 1e-51
4fmb_B171 Vira-Rab1 Complex Structure Length = 171 1e-51
2fol_A191 Crystal Structure Of Human Rab1a In Complex With Gd 1e-51
4fmc_B171 Espg-Rab1 Complex Length = 171 1e-51
2wwx_A175 Crystal Structure Of The SidmDRRA(GEFGDF DOMAIN)-Ra 2e-50
4i1o_A181 Crystal Structure Of The Legionella Pneumophila Gap 3e-50
3jza_A175 Crystal Structure Of Human Rab1b In Complex With Th 4e-50
3l0i_B199 Complex Structure Of Sidm/drra With The Wild Type R 7e-50
2bcg_Y206 Structure Of Doubly Prenylated Ypt1:gdi Complex Len 4e-45
1ukv_Y206 Structure Of Rabgdp-Dissociation Inhibitor In Compl 1e-44
2rhd_A175 Crystal Structure Of Cryptosporidium Parvum Small G 4e-43
1yzn_A185 Gppnhp-Bound Ypt1p Gtpase Length = 185 1e-42
3tw8_B181 Gef Domain Of Dennd 1b In Complex With Rab Gtpase R 1e-30
4fmc_F117 Espg-Rab1 Complex Length = 117 2e-30
1g17_A170 Crystal Structure Of Sec4-Guanosine-5'-(Beta,Gamma) 7e-30
3cph_A213 Crystal Structure Of Sec4 In Complex With Rab-Gdi L 8e-30
2eqb_A174 Crystal Structure Of The Rab Gtpase Sec4p, The Sec2 1e-29
1g16_A170 Crystal Structure Of Sec4-Gdp Length = 170 1e-29
2fu5_C183 Structure Of Rab8 In Complex With Mss4 Length = 183 2e-29
2ocy_C170 Complex Of The Guanine Exchange Factor Sec2p And Th 2e-29
3qbt_A174 Crystal Structure Of Ocrl1 540-678 In Complex With 7e-29
2g6b_A180 Crystal Structure Of Human Rab26 In Complex With A 7e-28
2hup_A201 Crystal Structure Of Human Rab43 In Complex With Gd 1e-27
2a5j_A191 Crystal Structure Of Human Rab2b Length = 191 2e-27
3rab_A169 Gppnhp-bound Rab3a At 2.0 A Resolution Length = 169 8e-27
1n6n_A170 Crystal Structure Of Human Rab5a A30r Mutant Comple 2e-26
1n6o_A170 Crystal Structure Of Human Rab5a A30k Mutant Comple 2e-26
1tu3_A171 Crystal Structure Of Rab5 Complex With Rabaptin5 C- 3e-26
1n6i_A170 Crystal Structure Of Human Rab5a A30p Mutant Comple 3e-26
1n6h_A170 Crystal Structure Of Human Rab5a Length = 170 3e-26
1n6p_A170 Crystal Structure Of Human Rab5a A30e Mutant Comple 3e-26
1n6r_A170 Crystal Structure Of Human Rab5a A30l Mutant Comple 3e-26
1z0a_A174 Gdp-Bound Rab2a Gtpase Length = 174 3e-26
2ew1_A201 Crystal Structure Of Rab30 In Complex With A Gtp An 7e-26
1z07_A166 Gppnhp-Bound Rab5c G55q Mutant Gtpase Length = 166 1e-25
1zbd_A203 Structural Basis Of Rab Effector Specificity: Cryst 1e-25
2o52_A200 Crystal Structure Of Human Rab4b In Complex With Gd 1e-25
1huq_A164 1.8a Crystal Structure Of The Monomeric Gtpase Rab5 1e-25
2hei_A179 Crystal Structure Of Human Rab5b In Complex With Gd 1e-25
2il1_A192 Crystal Structure Of A Predicted Human Gtpase In Co 2e-25
1tu4_A171 Crystal Structure Of Rab5-Gdp Complex Length = 171 2e-25
3mjh_A168 Crystal Structure Of Human Rab5a In Complex With Th 2e-25
1z0f_A179 Gdp-Bound Rab14 Gtpase Length = 179 3e-25
2bmd_A186 High Resolution Structure Of Gdp-Bound Human Rab4a 3e-25
1yzk_A184 Gppnhp Bound Rab11 Gtpase Length = 184 4e-25
1oiv_A191 X-Ray Structure Of The Small G Protein Rab11a In Co 4e-25
2f9l_A199 3d Structure Of Inactive Human Rab11b Gtpase Length 4e-25
1z0d_A167 Gdp-bound Rab5c Gtpase Length = 167 7e-25
4drz_A196 Crystal Structure Of Human Rab14 Length = 196 8e-25
3bfk_A181 Crystal Structure Of Plasmodium Falciparum Rab11a I 9e-25
3cpj_B223 Crystal Structure Of Ypt31 In Complex With Yeast Ra 1e-24
1oiw_A191 X-ray Structure Of The Small G Protein Rab11a In Co 3e-24
2hv8_A172 Crystal Structure Of Gtp-Bound Rab11 In Complex Wit 3e-24
3dz8_A191 Crystal Structure Of Human Rab3b Gtpase Bound With 3e-24
2f7s_A217 The Crystal Structure Of Human Rab27b Bound To Gdp 4e-24
1yu9_A175 Gppnhp-Bound Rab4a Length = 175 4e-24
2d7c_A167 Crystal Structure Of Human Rab11 In Complex With Fi 1e-23
2gzd_A173 Crystal Structure Of Rab11 In Complex With Rab11-Fi 1e-23
2gf9_A189 Crystal Structure Of Human Rab3d In Complex With Gd 2e-23
1yvd_A169 Gppnhp-Bound Rab22 Gtpase Length = 169 2e-23
2oil_A193 Crystal Structure Of Human Rab25 In Complex With Gd 2e-23
2p5s_A199 Rab Domain Of Human Rasef In Complex With Gdp Lengt 3e-23
1z0k_A172 Structure Of Gtp-Bound Rab4q67l Gtpase In Complex W 3e-23
3tso_A178 Structure Of The Cancer Associated Rab25 Protein In 3e-23
2iez_A220 Crystal Structure Of Mouse Rab27b Bound To Gdp In M 5e-23
2if0_A200 Crystal Structure Of Mouse Rab27b Bound To Gdp In M 1e-22
1z0j_A170 Structure Of Gtp-Bound Rab22q64l Gtpase In Complex 1e-22
2fg5_A192 Crystal Structure Of Human Rab31 In Complex With A 2e-22
3rwm_B185 Crystal Structure Of Ypt32 In Complex With Gppnhp L 3e-22
3bc1_A195 Crystal Structure Of The Complex Rab27a-slp2a Lengt 9e-22
2zet_A203 Crystal Structure Of The Small Gtpase Rab27b Comple 1e-21
2iey_A195 Crystal Structure Of Mouse Rab27b Bound To Gdp In H 2e-21
1z06_A189 Gppnhp-Bound Rab33 Gtpase Length = 189 4e-21
1x3s_A195 Crystal Structure Of Human Rab18 In Complex With Gp 3e-20
2g77_B198 Crystal Structure Of Gyp1 Tbc Domain In Complex Wit 3e-20
4dkx_A216 Crystal Structure Of The Rab 6a'(Q72l) Length = 216 8e-20
2efc_B181 Ara7-GdpATVPS9A Length = 181 2e-19
3bbp_A211 Rab6-Gtp:gcc185 Rab Binding Domain Complex Length = 2e-19
2y8e_A179 Crystal Structure Of D. Melanogaster Rab6 Gtpase Bo 6e-19
2fe4_A171 The Crystal Structure Of Human Neuronal Rab6b In It 6e-19
1yzq_A170 Gppnhp-Bound Rab6 Gtpase Length = 170 6e-19
1yzt_A184 Gppnhp-Bound Rab21 Gtpase At 2.05 A Resolution Leng 8e-19
1yzu_A170 Gppnhp-Bound Rab21 Gtpase At 2.50 A Resolution Leng 1e-18
1z08_A170 Gppnhp-Bound Rab21 Q53g Mutant Gtpase Length = 170 1e-18
2gil_A162 Structure Of The Extremely Slow Gtpase Rab6a In The 2e-18
1ky2_A182 Gppnhp-Bound Ypt7p At 1.6 A Resolution Length = 182 6e-18
3cwz_A188 Strucure Of Rab6(Gtp)-R6ip1 Complex Length = 188 8e-18
1ek0_A170 Gppnhp-Bound Ypt51 At 1.48 A Resolution Length = 17 1e-17
1d5c_A162 Crystal Structure Of Plasmodium Falciparum Rab6 Com 6e-17
1u8y_A168 Crystal Structures Of Ral-Gppnhp And Ral-Gdp Reveal 7e-17
2bov_A206 Molecular Recognition Of An Adp-Ribosylating Clostr 8e-17
2a78_A187 Crystal Structure Of The C3bot-Rala Complex Reveals 1e-16
1uad_A175 Crystal Structure Of The Rala-gppnhp-sec5 Ral-bindi 1e-16
3clv_A208 Crystal Structure Of Rab5a From Plasmodium Falcipar 2e-16
1vg0_B207 The Crystal Structures Of The Rep-1 Protein In Comp 3e-16
3law_A207 Structure Of Gtp-Bound L129f Mutant Rab7 Length = 2 3e-16
1vg1_A185 Gdp-bound Rab7 Length = 185 5e-16
4q21_A189 Molecular Switch For Signal Transduction: Structura 8e-16
1zc3_A175 Crystal Structure Of The Ral-Binding Domain Of Exo8 8e-16
1t91_A207 Crystal Structure Of Human Small Gtpase Rab7(Gtp) L 2e-15
4epx_A170 Discovery Of Small Molecules That Bind To K-Ras And 4e-15
4ept_A170 Discovery Of Small Molecules That Bind To K-Ras And 4e-15
4epr_A170 Discovery Of Small Molecules That Bind To K-Ras And 4e-15
2cl0_X166 Crystal Structure Analysis Of A Fluorescent Form Of 5e-15
2cld_X166 Crystal Structure Analysis Of A Fluorescent Form Of 5e-15
3con_A190 Crystal Structure Of The Human Nras Gtpase Bound Wi 9e-15
1z22_A168 Gdp-Bound Rab23 Gtpase Crystallized In C222(1) Spac 9e-15
3kkm_A172 Crystal Structure Of H-Ras T35s In Complex With Gpp 1e-14
4efm_A171 Crystal Structure Of H-Ras G12v In Complex With Gpp 1e-14
4efl_A171 Crystal Structure Of H-Ras Wt In Complex With Gppnh 1e-14
6q21_A171 Molecular Switch For Signal Transduction: Structura 1e-14
2q21_A171 Crystal Structures At 2.2 Angstroms Resolution Of T 1e-14
3ddc_A166 Crystal Structure Of Nore1a In Complex With Ras Len 1e-14
221p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 1e-14
2c5l_A173 Structure Of Plc Epsilon Ras Association Domain Wit 1e-14
3v4f_A166 H-Ras Peg 400CACL2, ORDERED OFF Length = 166 1e-14
1wq1_R166 Ras-Rasgap Complex Length = 166 1e-14
1rvd_A166 H-Ras Complexed With Diaminobenzophenone-Beta,Gamma 1e-14
3k9n_A166 Allosteric Modulation Of H-Ras Gtpase Length = 166 1e-14
421p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 1e-14
1iaq_A166 C-H-Ras P21 Protein Mutant With Thr 35 Replaced By 1e-14
1lfd_B167 Crystal Structure Of The Active Ras Protein Complex 1e-14
4dso_A189 Small-Molecule Ligands Bind To A Distinct Pocket In 1e-14
1clu_A166 H-Ras Complexed With Diaminobenzophenone-Beta,Gamma 1e-14
1agp_A166 Three-Dimensional Structures And Properties Of A Tr 1e-14
3i3s_R166 Crystal Structure Of H-Ras With Thr50 Replaced By I 2e-14
1jah_A166 H-Ras P21 Protein Mutant G12p, Complexed With Guano 2e-14
3lo5_A166 Crystal Structure Of The Dominant Negative S17n Mut 2e-14
2ke5_A174 Solution Structure And Dynamics Of The Small Gtpase 2e-14
2kwi_A178 Ralb-Rlip76 (Ralbp1) Complex Length = 178 2e-14
2quz_A166 Crystal Structure Of The Activating H-Rask117r Muta 2e-14
1lf0_A166 Crystal Structure Of Rasa59g In The Gtp-Bound Form 4e-14
1yzl_A179 Gppnhp-Bound Rab9 Gtpase Length = 179 4e-14
1xcm_A167 Crystal Structure Of The Gppnhp-Bound H-Ras G60a Mu 4e-14
3gft_A187 Human K-Ras In Complex With A Gtp Analogue Length = 4e-14
1xj0_A166 Crystal Structure Of The Gdp-Bound Form Of The Rasg 4e-14
1s8f_A177 Crystal Structure Of Rab9 Complexed To Gdp Reveals 4e-14
1wms_A177 High Resolution Crystal Structure Of Human Rab9 Gtp 4e-14
2x1v_A166 Crystal Structure Of The Activating H-Ras I163f Mut 4e-14
2rgb_A166 Crystal Structure Of H-Rasq61k-Gppnhp Length = 166 4e-14
521p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 5e-14
621p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 5e-14
1nvv_Q166 Structural Evidence For Feedback Activation By Rasg 6e-14
4efn_A171 Crystal Structure Of H-Ras Q61l In Complex With Gpp 8e-14
2ocb_A180 Crystal Structure Of Human Rab9b In Complex With A 9e-14
1zw6_A166 Crystal Structure Of The Gtp-Bound Form Of Rasq61g 1e-13
1zvq_A166 Structure Of The Q61g Mutant Of Ras In The Gdp-Boun 1e-13
721p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 1e-13
2rgc_A166 Crystal Structure Of H-Rasq61v-Gppnhp Length = 166 1e-13
2rga_A166 Crystal Structure Of H-Rasq61i-Gppnhp Length = 166 1e-13
2fn4_A181 The Crystal Structure Of Human Ras-Related Protein, 2e-13
2ery_A172 The Crystal Structure Of The Ras Related Protein Rr 5e-13
2bku_A177 Kap95p:rangtp Complex Length = 177 4e-12
3ea5_A216 Kap95p Binding Induces The Switch Loops Of Rangdp T 4e-12
1rrp_A204 Structure Of The Ran-Gppnhp-Ranbd1 Complex Length = 4e-12
1byu_A216 Canine Gdp-Ran Length = 216 4e-12
1a2k_C216 Gdpran-Ntf2 Complex Length = 216 4e-12
3gj4_A221 Crystal Structure Of Human Rangdp-Nup153znf3 Comple 4e-12
1qg2_A216 Canine Gdp-Ran R76e Mutant Length = 216 5e-12
3gj0_A221 Crystal Structure Of Human Rangdp Length = 221 5e-12
1wa5_A176 Crystal Structure Of The Exportin Cse1p Complexed W 5e-12
1qbk_C216 Structure Of The Karyopherin Beta2-ran Gppnhp Nucle 9e-12
1qg4_A216 Canine Gdp-Ran F72y Mutant Length = 216 1e-11
4dxa_A169 Co-Crystal Structure Of Rap1 In Complex With Krit1 2e-11
3brw_D167 Structure Of The Rap-Rapgap Complex Length = 167 2e-11
3nby_C176 Crystal Structure Of The Pki Nes-Crm1-Rangtp Nuclea 3e-11
3ran_A216 Canine Gdp-Ran Q69l Mutant Length = 216 3e-11
3nc1_C182 Crystal Structure Of The Crm1-Rangtp Complex Length 3e-11
3m1i_A219 Crystal Structure Of Yeast Crm1 (Xpo1p) In Complex 4e-11
3icq_B171 Karyopherin Nuclear State Length = 171 4e-11
2x19_A172 Crystal Structure Of Importin13 - Rangtp Complex Le 4e-11
1c1y_A167 Crystal Structure Of Rap.Gmppnp In Complex With The 6e-11
1gua_A167 Human Rap1a, Residues 1-167, Double Mutant (E30d,K3 7e-11
3pir_A183 Crystal Structure Of M-Rasd41e In Complex With Gppn 8e-11
3kko_A183 Crystal Structure Of M-Ras P40dD41EL51R IN COMPLEX 9e-11
3kkp_A183 Crystal Structure Of M-Ras P40d In Complex With Gpp 9e-11
1x1r_A178 Crystal Structure Of M-Ras In Complex With Gdp Leng 9e-11
3rap_R167 The Small G Protein Rap2 In A Non Catalytic Complex 1e-10
4djt_A218 Crystal Structure Of A Nuclear Gtp-Binding Protein 3e-10
2atv_A196 The Crystal Structure Of Human Rerg In The Gdp Boun 5e-09
2j0v_A212 The Crystal Structure Of Arabidopsis Thaliana Rac7- 1e-08
2erx_A172 Crystal Structure Of Diras2 In Complex With Gdp And 2e-08
3oes_A201 Crystal Structure Of The Small Gtpase Rhebl1 Length 8e-08
2yc2_C208 Intraflagellar Transport Complex 25-27 From Chlamyd 8e-08
2gf0_A199 The Crystal Structure Of The Human Diras1 Gtpase In 2e-07
2j1l_A214 Crystal Structure Of Human Rho-Related Gtp-Binding 3e-07
2hxs_A178 Crystal Structure Of Rab28a Gtpase In The Inactive 4e-07
3t5g_A181 Structure Of Fully Modified Farnesylated Rheb In Co 8e-07
1xtq_A177 Structure Of Small Gtpase Human Rheb In Complex Wit 8e-07
1zd9_A188 Structure Of Human Adp-Ribosylation Factor-Like 10b 8e-07
3sea_A167 Structure Of Rheb-Y35a Mutant In Gdp- And Gmppnp-Bo 9e-07
2l0x_A169 Solution Structure Of The 21 Kda Gtpase Rheb Bound 1e-06
2h18_A193 Structure Of Human Adp-Ribosylation Factor-Like 10b 1e-06
1z2c_A193 Crystal Structure Of Mdia1 Gbd-Fh3 In Complex With 1e-06
3lvr_E497 The Crystal Structure Of Asap3 In Complex With Arf6 2e-06
2al7_A186 Structure Of Human Adp-Ribosylation Factor-Like 10c 2e-06
3bwd_D182 Crystal Structure Of The Plant Rho Protein Rop5 Len 3e-06
2a5d_A175 Structural Basis For The Activation Of Cholera Toxi 4e-06
1e0s_A174 Small G Protein Arf6-Gdp Length = 174 4e-06
2wbl_C180 Three-Dimensional Structure Of A Binary Rop-Prone C 4e-06
1ow3_B193 Crystal Structure Of Rhoa.Gdp.Mgf3-In Complex With 4e-06
3n5c_A162 Crystal Structure Of Arf6delta13 Complexed With Gdp 4e-06
2nty_C180 Rop4-Gdp-Prone8 Length = 180 4e-06
1lb1_B192 Crystal Structure Of The Dbl And Pleckstrin Homolog 4e-06
1cc0_A190 Crystal Structure Of The Rhoa.Gdp-Rhogdi Complex Le 4e-06
3tvd_A193 Crystal Structure Of Mouse Rhoa-Gtp Complex Length 4e-06
4f38_A195 Crystal Structure Of Geranylgeranylated Rhoa In Com 5e-06
4fme_C160 Espg-Rab1-Arf6 Complex Length = 160 5e-06
1x86_B196 Crystal Structure Of The DhPH DOMAINS OF LEUKEMIA-A 5e-06
2v55_B200 Mechanism Of Multi-site Phosphorylation From A Rock 5e-06
3pcr_B162 Structure Of Espg-Arf6 Complex Length = 162 5e-06
2gcn_A201 Crystal Structure Of The Human Rhoc-Gdp Complex Len 5e-06
3lw8_A185 Shigella Ipgb2 In Complex With Human Rhoa, Gdp And 5e-06
2fv8_A207 The Crystal Structure Of Rhob In The Gdp-Bound Stat 5e-06
1tx4_B177 RhoRHOGAPGDP(DOT)ALF4 COMPLEX Length = 177 5e-06
1xcg_B178 Crystal Structure Of Human Rhoa In Complex With DhP 5e-06
1dpf_A180 Crystal Structure Of A Mg-Free Form Of Rhoa Complex 5e-06
3msx_A180 Crystal Structure Of Rhoa.Gdp.Mgf3 In Complex With 6e-06
1cxz_A182 Crystal Structure Of Human Rhoa Complexed With The 6e-06
1s1c_A183 Crystal Structure Of The Complex Between The Human 6e-06
1gwn_A205 The Crystal Structure Of The Core Domain Of RhoeRND 6e-06
3kz1_E182 Crystal Structure Of The Complex Of Pdz-Rhogef DhPH 6e-06
1m7b_A184 Crystal Structure Of Rnd3RHOE: FUNCTIONAL IMPLICATI 8e-06
3a58_B188 Crystal Structure Of Sec3p - Rho1p Complex From Sac 9e-06
2a5g_A175 Cholera Toxin A1 Subunit Bound To Arf6(Q67l) Length 3e-05
3vhx_A172 The Crystal Structure Of Arf6-Mklp1 (Mitotic Kinesi 3e-05
2w83_A165 Crystal Structure Of The Arf6 Gtpase In Complex Wit 3e-05
1kmq_A184 Crystal Structure Of A Constitutively Activated Rho 3e-05
2cls_A198 The Crystal Structure Of The Human Rnd1 Gtpase In T 7e-05
2rex_B197 Crystal Structure Of The Effector Domain Of Plxnb1 8e-05
2gco_A201 Crystal Structure Of The Human Rhoc-gppnhp Complex 8e-05
3q3j_B214 Crystal Structure Of Plexin A2 Rbd In Complex With 8e-05
1i4d_D192 Crystal Structure Analysis Of Rac1-Gdp Complexed Wi 2e-04
2vrw_A184 Critical Structural Role For The Ph And C1 Domains 2e-04
2cjw_B192 Crystal Structure Of The Small Gtpase Gem (Gemdndca 2e-04
2dpx_A174 Crystal Structure Of Human Rad Gtpase Length = 174 2e-04
3q72_A166 Crystal Structure Of Rad G-Domain-Gtp Analog Comple 2e-04
2gjs_A176 The Crystal Structure Of Human Rrad In Complex With 2e-04
2cjw_A192 Crystal Structure Of The Small Gtpase Gem (Gemdndca 3e-04
1he1_C176 Crystal Structure Of The Complex Between The Gap Do 3e-04
3sua_A184 Crystal Structure Of The Intracellular Domain Of Pl 3e-04
2fju_A178 Activated Rac1 Bound To Its Effector Phospholipase 3e-04
1foe_B177 Crystal Structure Of Rac1 In Complex With The Guani 3e-04
3tjz_A164 Crystal Structure Of Arf1 Bound To The GammaZETA-Co 3e-04
2k5u_A181 Solution Structure Of Myirstoylated Yeast Arf1 Prot 3e-04
1z6x_A180 Structure Of Human Adp-Ribosylation Factor 4 Length 3e-04
2yin_C196 Structure Of The Complex Between Dock2 And Rac1. Le 4e-04
4gzm_A204 Crystal Structure Of Rac1 F28l Mutant Length = 204 4e-04
3th5_A204 Crystal Structure Of Wild-Type Rac1 Length = 204 4e-04
3b13_B184 Crystal Structure Of The Dhr-2 Domain Of Dock2 In C 4e-04
1hh4_A192 Rac1-Rhogdi Complex Involved In Nadph Oxidase Activ 4e-04
2atx_A194 Crystal Structure Of The Tc10 Gppnhp Complex Length 4e-04
1mh1_A186 Small G-Protein Length = 186 5e-04
1g4u_R184 Crystal Structure Of The Salmonella Tyrosine Phosph 5e-04
2h7v_A188 Co-crystal Structure Of Ypka-rac1 Length = 188 5e-04
3sbd_A187 Crystal Structure Of Rac1 P29s Mutant Length = 187 5e-04
1mr3_F181 Saccharomyces Cerevisiae Adp-Ribosylation Factor 2 5e-04
2g3y_A211 Crystal Structure Of The Human Small Gtpase Gem Len 5e-04
2g0n_A179 The Crystal Structure Of The Human Rac3 In Complex 6e-04
2ic5_A180 Crystal Structure Of Human Rac3 Grown In The Presen 7e-04
2c2h_A192 Crystal Structure Of The Human Rac3 In Complex With 7e-04
2ht6_A174 Crystal Structure Of Human Gem G-Domain Bound To Gd 7e-04
2nzj_A175 The Crystal Structure Of Rem1 In Complex With Gdp L 8e-04
2q3h_A201 The Crystal Structure Of Rhoua In The Gdp-bound Sta 9e-04
>pdb|3TKL|A Chain A, Crystal Structure Of The Gtp-Bound Rab1a In Complex With The Coiled- Coil Domain Of Lida From Legionella Pneumophila Length = 196 Back     alignment and structure

Iteration: 1

Score = 199 bits (505), Expect = 9e-52, Method: Compositional matrix adjust. Identities = 92/113 (81%), Positives = 101/113 (89%) Query: 24 IWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQETFNNLKQWLEEIDRYACDNVNKLLVG 83 IWDTAGQERFRTITSSYYRGAHGIIVVYD TDQE+FNN+KQWL+EIDRYA +NVNKLLVG Sbjct: 69 IWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVG 128 Query: 84 NKNDQTSKKAVDYQVAKEYADHLKIPFLETSAKNGANVEQAFLTMATEIKKRV 136 NK D T+KK VDY AKE+AD L IPFLETSAKN NVEQ+F+TMA EIKKR+ Sbjct: 129 NKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM 181
>pdb|4FMD|F Chain F, Espg-Rab1 Complex Structure At 3.05 A Length = 164 Back     alignment and structure
>pdb|3SFV|A Chain A, Crystal Structure Of The Gdp-Bound Rab1a S25n Mutant In Complex With The Coiled-Coil Domain Of Lida From Legionella Pneumophila Length = 181 Back     alignment and structure
>pdb|4FMB|B Chain B, Vira-Rab1 Complex Structure Length = 171 Back     alignment and structure
>pdb|2FOL|A Chain A, Crystal Structure Of Human Rab1a In Complex With Gdp Length = 191 Back     alignment and structure
>pdb|4FMC|B Chain B, Espg-Rab1 Complex Length = 171 Back     alignment and structure
>pdb|2WWX|A Chain A, Crystal Structure Of The SidmDRRA(GEFGDF DOMAIN)-Rab1 (Gtpase Domain) Complex Length = 175 Back     alignment and structure
>pdb|4I1O|A Chain A, Crystal Structure Of The Legionella Pneumophila Gap Domain Of Lepb In Complex With Rab1b Bound To Gdp And Bef3 Length = 181 Back     alignment and structure
>pdb|3JZA|A Chain A, Crystal Structure Of Human Rab1b In Complex With The Gef Domain Of DrraSIDM FROM LEGIONELLA PNEUMOPHILA Length = 175 Back     alignment and structure
>pdb|3L0I|B Chain B, Complex Structure Of Sidm/drra With The Wild Type Rab1 Length = 199 Back     alignment and structure
>pdb|2BCG|Y Chain Y, Structure Of Doubly Prenylated Ypt1:gdi Complex Length = 206 Back     alignment and structure
>pdb|1UKV|Y Chain Y, Structure Of Rabgdp-Dissociation Inhibitor In Complex With Prenylated Ypt1 Gtpase Length = 206 Back     alignment and structure
>pdb|2RHD|A Chain A, Crystal Structure Of Cryptosporidium Parvum Small Gtpase Rab1a Length = 175 Back     alignment and structure
>pdb|1YZN|A Chain A, Gppnhp-Bound Ypt1p Gtpase Length = 185 Back     alignment and structure
>pdb|3TW8|B Chain B, Gef Domain Of Dennd 1b In Complex With Rab Gtpase Rab35 Length = 181 Back     alignment and structure
>pdb|4FMC|F Chain F, Espg-Rab1 Complex Length = 117 Back     alignment and structure
>pdb|1G17|A Chain A, Crystal Structure Of Sec4-Guanosine-5'-(Beta,Gamma)- Imidotriphosphate Length = 170 Back     alignment and structure
>pdb|3CPH|A Chain A, Crystal Structure Of Sec4 In Complex With Rab-Gdi Length = 213 Back     alignment and structure
>pdb|2EQB|A Chain A, Crystal Structure Of The Rab Gtpase Sec4p, The Sec2p Gef Domain, And Phosphate Complex Length = 174 Back     alignment and structure
>pdb|1G16|A Chain A, Crystal Structure Of Sec4-Gdp Length = 170 Back     alignment and structure
>pdb|2FU5|C Chain C, Structure Of Rab8 In Complex With Mss4 Length = 183 Back     alignment and structure
>pdb|2OCY|C Chain C, Complex Of The Guanine Exchange Factor Sec2p And The Rab Gtpase Sec4p Length = 170 Back     alignment and structure
>pdb|3QBT|A Chain A, Crystal Structure Of Ocrl1 540-678 In Complex With Rab8a:gppnhp Length = 174 Back     alignment and structure
>pdb|2G6B|A Chain A, Crystal Structure Of Human Rab26 In Complex With A Gtp Analogue Length = 180 Back     alignment and structure
>pdb|2HUP|A Chain A, Crystal Structure Of Human Rab43 In Complex With Gdp Length = 201 Back     alignment and structure
>pdb|2A5J|A Chain A, Crystal Structure Of Human Rab2b Length = 191 Back     alignment and structure
>pdb|3RAB|A Chain A, Gppnhp-bound Rab3a At 2.0 A Resolution Length = 169 Back     alignment and structure
>pdb|1N6N|A Chain A, Crystal Structure Of Human Rab5a A30r Mutant Complex With Gppnhp Length = 170 Back     alignment and structure
>pdb|1N6O|A Chain A, Crystal Structure Of Human Rab5a A30k Mutant Complex With Gppnhp Length = 170 Back     alignment and structure
>pdb|1TU3|A Chain A, Crystal Structure Of Rab5 Complex With Rabaptin5 C-Terminal Domain Length = 171 Back     alignment and structure
>pdb|1N6I|A Chain A, Crystal Structure Of Human Rab5a A30p Mutant Complex With Gdp Length = 170 Back     alignment and structure
>pdb|1N6H|A Chain A, Crystal Structure Of Human Rab5a Length = 170 Back     alignment and structure
>pdb|1N6P|A Chain A, Crystal Structure Of Human Rab5a A30e Mutant Complex With Gppnhp Length = 170 Back     alignment and structure
>pdb|1N6R|A Chain A, Crystal Structure Of Human Rab5a A30l Mutant Complex With Gppnhp Length = 170 Back     alignment and structure
>pdb|1Z0A|A Chain A, Gdp-Bound Rab2a Gtpase Length = 174 Back     alignment and structure
>pdb|2EW1|A Chain A, Crystal Structure Of Rab30 In Complex With A Gtp Analogue Length = 201 Back     alignment and structure
>pdb|1Z07|A Chain A, Gppnhp-Bound Rab5c G55q Mutant Gtpase Length = 166 Back     alignment and structure
>pdb|1ZBD|A Chain A, Structural Basis Of Rab Effector Specificity: Crystal Structure Of The Small G Protein Rab3a Complexed With The Effector Domain Of Rabphilin-3a Length = 203 Back     alignment and structure
>pdb|2O52|A Chain A, Crystal Structure Of Human Rab4b In Complex With Gdp Length = 200 Back     alignment and structure
>pdb|1HUQ|A Chain A, 1.8a Crystal Structure Of The Monomeric Gtpase Rab5c (Mouse) Length = 164 Back     alignment and structure
>pdb|2HEI|A Chain A, Crystal Structure Of Human Rab5b In Complex With Gdp Length = 179 Back     alignment and structure
>pdb|2IL1|A Chain A, Crystal Structure Of A Predicted Human Gtpase In Complex With Gdp Length = 192 Back     alignment and structure
>pdb|1TU4|A Chain A, Crystal Structure Of Rab5-Gdp Complex Length = 171 Back     alignment and structure
>pdb|3MJH|A Chain A, Crystal Structure Of Human Rab5a In Complex With The C2h2 Zinc Finger Of Eea1 Length = 168 Back     alignment and structure
>pdb|1Z0F|A Chain A, Gdp-Bound Rab14 Gtpase Length = 179 Back     alignment and structure
>pdb|2BMD|A Chain A, High Resolution Structure Of Gdp-Bound Human Rab4a Length = 186 Back     alignment and structure
>pdb|1YZK|A Chain A, Gppnhp Bound Rab11 Gtpase Length = 184 Back     alignment and structure
>pdb|1OIV|A Chain A, X-Ray Structure Of The Small G Protein Rab11a In Complex With Gdp Length = 191 Back     alignment and structure
>pdb|2F9L|A Chain A, 3d Structure Of Inactive Human Rab11b Gtpase Length = 199 Back     alignment and structure
>pdb|1Z0D|A Chain A, Gdp-bound Rab5c Gtpase Length = 167 Back     alignment and structure
>pdb|4DRZ|A Chain A, Crystal Structure Of Human Rab14 Length = 196 Back     alignment and structure
>pdb|3BFK|A Chain A, Crystal Structure Of Plasmodium Falciparum Rab11a In Complex With Gdp Length = 181 Back     alignment and structure
>pdb|3CPJ|B Chain B, Crystal Structure Of Ypt31 In Complex With Yeast Rab-Gdi Length = 223 Back     alignment and structure
>pdb|1OIW|A Chain A, X-ray Structure Of The Small G Protein Rab11a In Complex With Gtpgammas Length = 191 Back     alignment and structure
>pdb|2HV8|A Chain A, Crystal Structure Of Gtp-Bound Rab11 In Complex With Fip3 Length = 172 Back     alignment and structure
>pdb|3DZ8|A Chain A, Crystal Structure Of Human Rab3b Gtpase Bound With Gdp Length = 191 Back     alignment and structure
>pdb|2F7S|A Chain A, The Crystal Structure Of Human Rab27b Bound To Gdp Length = 217 Back     alignment and structure
>pdb|1YU9|A Chain A, Gppnhp-Bound Rab4a Length = 175 Back     alignment and structure
>pdb|2D7C|A Chain A, Crystal Structure Of Human Rab11 In Complex With Fip3 Rab- Binding Domain Length = 167 Back     alignment and structure
>pdb|2GZD|A Chain A, Crystal Structure Of Rab11 In Complex With Rab11-Fip2 Length = 173 Back     alignment and structure
>pdb|2GF9|A Chain A, Crystal Structure Of Human Rab3d In Complex With Gdp Length = 189 Back     alignment and structure
>pdb|1YVD|A Chain A, Gppnhp-Bound Rab22 Gtpase Length = 169 Back     alignment and structure
>pdb|2OIL|A Chain A, Crystal Structure Of Human Rab25 In Complex With Gdp Length = 193 Back     alignment and structure
>pdb|2P5S|A Chain A, Rab Domain Of Human Rasef In Complex With Gdp Length = 199 Back     alignment and structure
>pdb|1Z0K|A Chain A, Structure Of Gtp-Bound Rab4q67l Gtpase In Complex With The Central Rab Binding Domain Of Rabenosyn-5 Length = 172 Back     alignment and structure
>pdb|3TSO|A Chain A, Structure Of The Cancer Associated Rab25 Protein In Complex With Fip2 Length = 178 Back     alignment and structure
>pdb|2IEZ|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Monoclinic Space Group Length = 220 Back     alignment and structure
>pdb|2IF0|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Monoclinic Space Group Length = 200 Back     alignment and structure
>pdb|1Z0J|A Chain A, Structure Of Gtp-Bound Rab22q64l Gtpase In Complex With The Minimal Rab Binding Domain Of Rabenosyn-5 Length = 170 Back     alignment and structure
>pdb|2FG5|A Chain A, Crystal Structure Of Human Rab31 In Complex With A Gtp Analogue Length = 192 Back     alignment and structure
>pdb|3RWM|B Chain B, Crystal Structure Of Ypt32 In Complex With Gppnhp Length = 185 Back     alignment and structure
>pdb|3BC1|A Chain A, Crystal Structure Of The Complex Rab27a-slp2a Length = 195 Back     alignment and structure
>pdb|2ZET|A Chain A, Crystal Structure Of The Small Gtpase Rab27b Complexed With The Slp Homology Domain Of Slac2-AMELANOPHILIN Length = 203 Back     alignment and structure
>pdb|2IEY|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Hexagonal Space Group Length = 195 Back     alignment and structure
>pdb|1Z06|A Chain A, Gppnhp-Bound Rab33 Gtpase Length = 189 Back     alignment and structure
>pdb|1X3S|A Chain A, Crystal Structure Of Human Rab18 In Complex With Gppnhp Length = 195 Back     alignment and structure
>pdb|2G77|B Chain B, Crystal Structure Of Gyp1 Tbc Domain In Complex With Rab33 Gtpase Bound To Gdp And Alf3 Length = 198 Back     alignment and structure
>pdb|4DKX|A Chain A, Crystal Structure Of The Rab 6a'(Q72l) Length = 216 Back     alignment and structure
>pdb|2EFC|B Chain B, Ara7-GdpATVPS9A Length = 181 Back     alignment and structure
>pdb|3BBP|A Chain A, Rab6-Gtp:gcc185 Rab Binding Domain Complex Length = 211 Back     alignment and structure
>pdb|2Y8E|A Chain A, Crystal Structure Of D. Melanogaster Rab6 Gtpase Bound To Gmppnp Length = 179 Back     alignment and structure
>pdb|2FE4|A Chain A, The Crystal Structure Of Human Neuronal Rab6b In Its Inactive Gdp-Bound Form Length = 171 Back     alignment and structure
>pdb|1YZQ|A Chain A, Gppnhp-Bound Rab6 Gtpase Length = 170 Back     alignment and structure
>pdb|1YZT|A Chain A, Gppnhp-Bound Rab21 Gtpase At 2.05 A Resolution Length = 184 Back     alignment and structure
>pdb|1YZU|A Chain A, Gppnhp-Bound Rab21 Gtpase At 2.50 A Resolution Length = 170 Back     alignment and structure
>pdb|1Z08|A Chain A, Gppnhp-Bound Rab21 Q53g Mutant Gtpase Length = 170 Back     alignment and structure
>pdb|2GIL|A Chain A, Structure Of The Extremely Slow Gtpase Rab6a In The Gtp Bound Form At 1.8 Resolution Length = 162 Back     alignment and structure
>pdb|1KY2|A Chain A, Gppnhp-Bound Ypt7p At 1.6 A Resolution Length = 182 Back     alignment and structure
>pdb|3CWZ|A Chain A, Strucure Of Rab6(Gtp)-R6ip1 Complex Length = 188 Back     alignment and structure
>pdb|1EK0|A Chain A, Gppnhp-Bound Ypt51 At 1.48 A Resolution Length = 170 Back     alignment and structure
>pdb|1D5C|A Chain A, Crystal Structure Of Plasmodium Falciparum Rab6 Complexed With Gdp Length = 162 Back     alignment and structure
>pdb|1U8Y|A Chain A, Crystal Structures Of Ral-Gppnhp And Ral-Gdp Reveal Two Novel Binding Sites That Are Also Present In Ras And Rap Length = 168 Back     alignment and structure
>pdb|2BOV|A Chain A, Molecular Recognition Of An Adp-Ribosylating Clostridium Botulinum C3 Exoenzyme By Rala Gtpase Length = 206 Back     alignment and structure
>pdb|2A78|A Chain A, Crystal Structure Of The C3bot-Rala Complex Reveals A Novel Type Of Action Of A Bacterial Exoenzyme Length = 187 Back     alignment and structure
>pdb|1UAD|A Chain A, Crystal Structure Of The Rala-gppnhp-sec5 Ral-binding Domain Complex Length = 175 Back     alignment and structure
>pdb|3CLV|A Chain A, Crystal Structure Of Rab5a From Plasmodium Falciparum, Pfb0500c Length = 208 Back     alignment and structure
>pdb|1VG0|B Chain B, The Crystal Structures Of The Rep-1 Protein In Complex With Monoprenylated Rab7 Protein Length = 207 Back     alignment and structure
>pdb|3LAW|A Chain A, Structure Of Gtp-Bound L129f Mutant Rab7 Length = 207 Back     alignment and structure
>pdb|1VG1|A Chain A, Gdp-bound Rab7 Length = 185 Back     alignment and structure
>pdb|4Q21|A Chain A, Molecular Switch For Signal Transduction: Structural Differences Between Active And Inactive Forms Of Protooncogenic Ras Proteins Length = 189 Back     alignment and structure
>pdb|1ZC3|A Chain A, Crystal Structure Of The Ral-Binding Domain Of Exo84 In Complex With The Active Rala Length = 175 Back     alignment and structure
>pdb|1T91|A Chain A, Crystal Structure Of Human Small Gtpase Rab7(Gtp) Length = 207 Back     alignment and structure
>pdb|4EPX|A Chain A, Discovery Of Small Molecules That Bind To K-Ras And Inhibit Sos- Mediated Activation Length = 170 Back     alignment and structure
>pdb|4EPT|A Chain A, Discovery Of Small Molecules That Bind To K-Ras And Inhibit Sos- Mediated Activation Length = 170 Back     alignment and structure
>pdb|4EPR|A Chain A, Discovery Of Small Molecules That Bind To K-Ras And Inhibit Sos- Mediated Activation Length = 170 Back     alignment and structure
>pdb|2CL0|X Chain X, Crystal Structure Analysis Of A Fluorescent Form Of H-Ras P21 In Complex With Gppnhp Length = 166 Back     alignment and structure
>pdb|3CON|A Chain A, Crystal Structure Of The Human Nras Gtpase Bound With Gdp Length = 190 Back     alignment and structure
>pdb|1Z22|A Chain A, Gdp-Bound Rab23 Gtpase Crystallized In C222(1) Space Group Length = 168 Back     alignment and structure
>pdb|3KKM|A Chain A, Crystal Structure Of H-Ras T35s In Complex With Gppnhp Length = 172 Back     alignment and structure
>pdb|4EFM|A Chain A, Crystal Structure Of H-Ras G12v In Complex With Gppnhp (State 1) Length = 171 Back     alignment and structure
>pdb|4EFL|A Chain A, Crystal Structure Of H-Ras Wt In Complex With Gppnhp (State 1) Length = 171 Back     alignment and structure
>pdb|6Q21|A Chain A, Molecular Switch For Signal Transduction: Structural Differences Between Active And Inactive Forms Of Protooncogenic Ras Proteins Length = 171 Back     alignment and structure
>pdb|2Q21|A Chain A, Crystal Structures At 2.2 Angstroms Resolution Of The Catalytic Domains Of Normal Ras Protein And An Oncogenic Mutant Complexed With Gsp Length = 171 Back     alignment and structure
>pdb|3DDC|A Chain A, Crystal Structure Of Nore1a In Complex With Ras Length = 166 Back     alignment and structure
>pdb|221P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|2C5L|A Chain A, Structure Of Plc Epsilon Ras Association Domain With Hras Length = 173 Back     alignment and structure
>pdb|3V4F|A Chain A, H-Ras Peg 400CACL2, ORDERED OFF Length = 166 Back     alignment and structure
>pdb|1WQ1|R Chain R, Ras-Rasgap Complex Length = 166 Back     alignment and structure
>pdb|1RVD|A Chain A, H-Ras Complexed With Diaminobenzophenone-Beta,Gamma-Imido- Gtp Length = 166 Back     alignment and structure
>pdb|3K9N|A Chain A, Allosteric Modulation Of H-Ras Gtpase Length = 166 Back     alignment and structure
>pdb|421P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|1IAQ|A Chain A, C-H-Ras P21 Protein Mutant With Thr 35 Replaced By Ser (T35s) Complexed With Guanosine-5'-[b,G-Imido] Triphosphate Length = 166 Back     alignment and structure
>pdb|1LFD|B Chain B, Crystal Structure Of The Active Ras Protein Complexed With The Ras-interacting Domain Of Ralgds Length = 167 Back     alignment and structure
>pdb|4DSO|A Chain A, Small-Molecule Ligands Bind To A Distinct Pocket In Ras And Inhibit Sos-Mediated Nucleotide Exchange Activity Length = 189 Back     alignment and structure
>pdb|1CLU|A Chain A, H-Ras Complexed With Diaminobenzophenone-Beta,Gamma-Imido- Gtp Length = 166 Back     alignment and structure
>pdb|1AGP|A Chain A, Three-Dimensional Structures And Properties Of A Transforming And A Nontransforming Gly-12 Mutant Of P21-H-Ras Length = 166 Back     alignment and structure
>pdb|3I3S|R Chain R, Crystal Structure Of H-Ras With Thr50 Replaced By Isoleucine Length = 166 Back     alignment and structure
>pdb|1JAH|A Chain A, H-Ras P21 Protein Mutant G12p, Complexed With Guanosine-5'- [beta,Gamma-Methylene] Triphosphate And Magnesium Length = 166 Back     alignment and structure
>pdb|3LO5|A Chain A, Crystal Structure Of The Dominant Negative S17n Mutant Of Ras Length = 166 Back     alignment and structure
>pdb|2KE5|A Chain A, Solution Structure And Dynamics Of The Small Gtpase Ralb In Its Active Conformation: Significance For Effector Protein Binding Length = 174 Back     alignment and structure
>pdb|2KWI|A Chain A, Ralb-Rlip76 (Ralbp1) Complex Length = 178 Back     alignment and structure
>pdb|2QUZ|A Chain A, Crystal Structure Of The Activating H-Rask117r Mutant In Costello Syndrome, Bound To Mg-Gdp Length = 166 Back     alignment and structure
>pdb|1LF0|A Chain A, Crystal Structure Of Rasa59g In The Gtp-Bound Form Length = 166 Back     alignment and structure
>pdb|1YZL|A Chain A, Gppnhp-Bound Rab9 Gtpase Length = 179 Back     alignment and structure
>pdb|1XCM|A Chain A, Crystal Structure Of The Gppnhp-Bound H-Ras G60a Mutant Length = 167 Back     alignment and structure
>pdb|3GFT|A Chain A, Human K-Ras In Complex With A Gtp Analogue Length = 187 Back     alignment and structure
>pdb|1XJ0|A Chain A, Crystal Structure Of The Gdp-Bound Form Of The Rasg60a Mutant Length = 166 Back     alignment and structure
>pdb|1S8F|A Chain A, Crystal Structure Of Rab9 Complexed To Gdp Reveals A Dimer With An Active Conformation Of Switch Ii Length = 177 Back     alignment and structure
>pdb|1WMS|A Chain A, High Resolution Crystal Structure Of Human Rab9 Gtpase: A Novel Antiviral Drug Target Length = 177 Back     alignment and structure
>pdb|2X1V|A Chain A, Crystal Structure Of The Activating H-Ras I163f Mutant In Costello Syndrome, Bound To Mg-Gdp Length = 166 Back     alignment and structure
>pdb|2RGB|A Chain A, Crystal Structure Of H-Rasq61k-Gppnhp Length = 166 Back     alignment and structure
>pdb|521P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|621P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|1NVV|Q Chain Q, Structural Evidence For Feedback Activation By Rasgtp Of The Ras-specific Nucleotide Exchange Factor Sos Length = 166 Back     alignment and structure
>pdb|4EFN|A Chain A, Crystal Structure Of H-Ras Q61l In Complex With Gppnhp (State 1) Length = 171 Back     alignment and structure
>pdb|2OCB|A Chain A, Crystal Structure Of Human Rab9b In Complex With A Gtp Analogue Length = 180 Back     alignment and structure
>pdb|1ZW6|A Chain A, Crystal Structure Of The Gtp-Bound Form Of Rasq61g Length = 166 Back     alignment and structure
>pdb|1ZVQ|A Chain A, Structure Of The Q61g Mutant Of Ras In The Gdp-Bound Form Length = 166 Back     alignment and structure
>pdb|721P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|2RGC|A Chain A, Crystal Structure Of H-Rasq61v-Gppnhp Length = 166 Back     alignment and structure
>pdb|2RGA|A Chain A, Crystal Structure Of H-Rasq61i-Gppnhp Length = 166 Back     alignment and structure
>pdb|2FN4|A Chain A, The Crystal Structure Of Human Ras-Related Protein, Rras, In The Gdp- Bound State Length = 181 Back     alignment and structure
>pdb|2ERY|A Chain A, The Crystal Structure Of The Ras Related Protein Rras2 (Rras2) In The Gdp Bound State Length = 172 Back     alignment and structure
>pdb|2BKU|A Chain A, Kap95p:rangtp Complex Length = 177 Back     alignment and structure
>pdb|3EA5|A Chain A, Kap95p Binding Induces The Switch Loops Of Rangdp To Adopt The Gtp- Bound Conformation: Implications For Nuclear Import Complex Assembly Dynamics Length = 216 Back     alignment and structure
>pdb|1RRP|A Chain A, Structure Of The Ran-Gppnhp-Ranbd1 Complex Length = 204 Back     alignment and structure
>pdb|1BYU|A Chain A, Canine Gdp-Ran Length = 216 Back     alignment and structure
>pdb|1A2K|C Chain C, Gdpran-Ntf2 Complex Length = 216 Back     alignment and structure
>pdb|3GJ4|A Chain A, Crystal Structure Of Human Rangdp-Nup153znf3 Complex Length = 221 Back     alignment and structure
>pdb|1QG2|A Chain A, Canine Gdp-Ran R76e Mutant Length = 216 Back     alignment and structure
>pdb|3GJ0|A Chain A, Crystal Structure Of Human Rangdp Length = 221 Back     alignment and structure
>pdb|1WA5|A Chain A, Crystal Structure Of The Exportin Cse1p Complexed With Its Cargo (Kap60p) And Rangtp Length = 176 Back     alignment and structure
>pdb|1QBK|C Chain C, Structure Of The Karyopherin Beta2-ran Gppnhp Nuclear Transport Complex Length = 216 Back     alignment and structure
>pdb|1QG4|A Chain A, Canine Gdp-Ran F72y Mutant Length = 216 Back     alignment and structure
>pdb|4DXA|A Chain A, Co-Crystal Structure Of Rap1 In Complex With Krit1 Length = 169 Back     alignment and structure
>pdb|3BRW|D Chain D, Structure Of The Rap-Rapgap Complex Length = 167 Back     alignment and structure
>pdb|3NBY|C Chain C, Crystal Structure Of The Pki Nes-Crm1-Rangtp Nuclear Export Complex Length = 176 Back     alignment and structure
>pdb|3RAN|A Chain A, Canine Gdp-Ran Q69l Mutant Length = 216 Back     alignment and structure
>pdb|3NC1|C Chain C, Crystal Structure Of The Crm1-Rangtp Complex Length = 182 Back     alignment and structure
>pdb|3M1I|A Chain A, Crystal Structure Of Yeast Crm1 (Xpo1p) In Complex With Yeas (Yrb1p) And Yeast Rangtp (Gsp1pgtp) Length = 219 Back     alignment and structure
>pdb|3ICQ|B Chain B, Karyopherin Nuclear State Length = 171 Back     alignment and structure
>pdb|2X19|A Chain A, Crystal Structure Of Importin13 - Rangtp Complex Length = 172 Back     alignment and structure
>pdb|1C1Y|A Chain A, Crystal Structure Of Rap.Gmppnp In Complex With The Ras- Binding-Domain Of C-Raf1 Kinase (Rafrbd) Length = 167 Back     alignment and structure
>pdb|1GUA|A Chain A, Human Rap1a, Residues 1-167, Double Mutant (E30d,K31e) Complexed With Gppnhp And The Ras-Binding-Domain Of Human C-Raf1, Residues 51-131 Length = 167 Back     alignment and structure
>pdb|3PIR|A Chain A, Crystal Structure Of M-Rasd41e In Complex With Gppnhp (Type 1) Length = 183 Back     alignment and structure
>pdb|3KKO|A Chain A, Crystal Structure Of M-Ras P40dD41EL51R IN COMPLEX WITH GP Length = 183 Back     alignment and structure
>pdb|3KKP|A Chain A, Crystal Structure Of M-Ras P40d In Complex With Gppnhp Length = 183 Back     alignment and structure
>pdb|1X1R|A Chain A, Crystal Structure Of M-Ras In Complex With Gdp Length = 178 Back     alignment and structure
>pdb|3RAP|R Chain R, The Small G Protein Rap2 In A Non Catalytic Complex With Gtp Length = 167 Back     alignment and structure
>pdb|4DJT|A Chain A, Crystal Structure Of A Nuclear Gtp-Binding Protein From Encephalitozoon Cuniculi Bound To Gdp-Mg2+ Length = 218 Back     alignment and structure
>pdb|2ATV|A Chain A, The Crystal Structure Of Human Rerg In The Gdp Bound State Length = 196 Back     alignment and structure
>pdb|2J0V|A Chain A, The Crystal Structure Of Arabidopsis Thaliana Rac7-Rop9: The First Ras Superfamily Gtpase From The Plant Kingdom Length = 212 Back     alignment and structure
>pdb|2ERX|A Chain A, Crystal Structure Of Diras2 In Complex With Gdp And Inorganic Phosphate Length = 172 Back     alignment and structure
>pdb|3OES|A Chain A, Crystal Structure Of The Small Gtpase Rhebl1 Length = 201 Back     alignment and structure
>pdb|2YC2|C Chain C, Intraflagellar Transport Complex 25-27 From Chlamydomonas Length = 208 Back     alignment and structure
>pdb|2GF0|A Chain A, The Crystal Structure Of The Human Diras1 Gtpase In The Inactive Gdp Bound State Length = 199 Back     alignment and structure
>pdb|2J1L|A Chain A, Crystal Structure Of Human Rho-Related Gtp-Binding Protein Rhod Length = 214 Back     alignment and structure
>pdb|2HXS|A Chain A, Crystal Structure Of Rab28a Gtpase In The Inactive (Gdp-3'p- Bound) Form Length = 178 Back     alignment and structure
>pdb|3T5G|A Chain A, Structure Of Fully Modified Farnesylated Rheb In Complex With Pde6d Length = 181 Back     alignment and structure
>pdb|1XTQ|A Chain A, Structure Of Small Gtpase Human Rheb In Complex With Gdp Length = 177 Back     alignment and structure
>pdb|1ZD9|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10b Length = 188 Back     alignment and structure
>pdb|3SEA|A Chain A, Structure Of Rheb-Y35a Mutant In Gdp- And Gmppnp-Bound Forms Length = 167 Back     alignment and structure
>pdb|2L0X|A Chain A, Solution Structure Of The 21 Kda Gtpase Rheb Bound To Gdp Length = 169 Back     alignment and structure
>pdb|2H18|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10b (Arl10b) Length = 193 Back     alignment and structure
>pdb|1Z2C|A Chain A, Crystal Structure Of Mdia1 Gbd-Fh3 In Complex With Rhoc- Gmppnp Length = 193 Back     alignment and structure
>pdb|3LVR|E Chain E, The Crystal Structure Of Asap3 In Complex With Arf6 In Trans State Soaked With Calcium Length = 497 Back     alignment and structure
>pdb|2AL7|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10c Length = 186 Back     alignment and structure
>pdb|3BWD|D Chain D, Crystal Structure Of The Plant Rho Protein Rop5 Length = 182 Back     alignment and structure
>pdb|2A5D|A Chain A, Structural Basis For The Activation Of Cholera Toxin By Human Arf6-Gtp Length = 175 Back     alignment and structure
>pdb|1E0S|A Chain A, Small G Protein Arf6-Gdp Length = 174 Back     alignment and structure
>pdb|2WBL|C Chain C, Three-Dimensional Structure Of A Binary Rop-Prone Complex Length = 180 Back     alignment and structure
>pdb|1OW3|B Chain B, Crystal Structure Of Rhoa.Gdp.Mgf3-In Complex With Rhogap Length = 193 Back     alignment and structure
>pdb|3N5C|A Chain A, Crystal Structure Of Arf6delta13 Complexed With Gdp Length = 162 Back     alignment and structure
>pdb|2NTY|C Chain C, Rop4-Gdp-Prone8 Length = 180 Back     alignment and structure
>pdb|1LB1|B Chain B, Crystal Structure Of The Dbl And Pleckstrin Homology Domains Of Dbs In Complex With Rhoa Length = 192 Back     alignment and structure
>pdb|1CC0|A Chain A, Crystal Structure Of The Rhoa.Gdp-Rhogdi Complex Length = 190 Back     alignment and structure
>pdb|3TVD|A Chain A, Crystal Structure Of Mouse Rhoa-Gtp Complex Length = 193 Back     alignment and structure
>pdb|4F38|A Chain A, Crystal Structure Of Geranylgeranylated Rhoa In Complex With Rhogdi In Its Active Gppnhp-Bound Form Length = 195 Back     alignment and structure
>pdb|4FME|C Chain C, Espg-Rab1-Arf6 Complex Length = 160 Back     alignment and structure
>pdb|1X86|B Chain B, Crystal Structure Of The DhPH DOMAINS OF LEUKEMIA-Associated Rhogef In Complex With Rhoa Length = 196 Back     alignment and structure
>pdb|2V55|B Chain B, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 200 Back     alignment and structure
>pdb|3PCR|B Chain B, Structure Of Espg-Arf6 Complex Length = 162 Back     alignment and structure
>pdb|2GCN|A Chain A, Crystal Structure Of The Human Rhoc-Gdp Complex Length = 201 Back     alignment and structure
>pdb|3LW8|A Chain A, Shigella Ipgb2 In Complex With Human Rhoa, Gdp And Mg2+ (Complex A) Length = 185 Back     alignment and structure
>pdb|2FV8|A Chain A, The Crystal Structure Of Rhob In The Gdp-Bound State Length = 207 Back     alignment and structure
>pdb|1TX4|B Chain B, RhoRHOGAPGDP(DOT)ALF4 COMPLEX Length = 177 Back     alignment and structure
>pdb|1XCG|B Chain B, Crystal Structure Of Human Rhoa In Complex With DhPH Fragment Of Pdzrhogef Length = 178 Back     alignment and structure
>pdb|1DPF|A Chain A, Crystal Structure Of A Mg-Free Form Of Rhoa Complexed With Gdp Length = 180 Back     alignment and structure
>pdb|3MSX|A Chain A, Crystal Structure Of Rhoa.Gdp.Mgf3 In Complex With Gap Domain Of Arhgap20 Length = 180 Back     alignment and structure
>pdb|1CXZ|A Chain A, Crystal Structure Of Human Rhoa Complexed With The Effector Domain Of The Protein Kinase PknPRK1 Length = 182 Back     alignment and structure
>pdb|1S1C|A Chain A, Crystal Structure Of The Complex Between The Human Rhoa And Rho-Binding Domain Of Human Rocki Length = 183 Back     alignment and structure
>pdb|1GWN|A Chain A, The Crystal Structure Of The Core Domain Of RhoeRND3 - A Constitutively Activated Small G Protein Length = 205 Back     alignment and structure
>pdb|3KZ1|E Chain E, Crystal Structure Of The Complex Of Pdz-Rhogef DhPH DOMAINS WITH GTP- Gamma-S Activated Rhoa Length = 182 Back     alignment and structure
>pdb|1M7B|A Chain A, Crystal Structure Of Rnd3RHOE: FUNCTIONAL IMPLICATIONS Length = 184 Back     alignment and structure
>pdb|3A58|B Chain B, Crystal Structure Of Sec3p - Rho1p Complex From Saccharomyces Cerevisiae Length = 188 Back     alignment and structure
>pdb|2A5G|A Chain A, Cholera Toxin A1 Subunit Bound To Arf6(Q67l) Length = 175 Back     alignment and structure
>pdb|3VHX|A Chain A, The Crystal Structure Of Arf6-Mklp1 (Mitotic Kinesin-Like Protein 1) Complex Length = 172 Back     alignment and structure
>pdb|2W83|A Chain A, Crystal Structure Of The Arf6 Gtpase In Complex With A Specific Effector, Jip4 Length = 165 Back     alignment and structure
>pdb|1KMQ|A Chain A, Crystal Structure Of A Constitutively Activated Rhoa Mutant (Q63l) Length = 184 Back     alignment and structure
>pdb|2CLS|A Chain A, The Crystal Structure Of The Human Rnd1 Gtpase In The Active Gtp Bound State Length = 198 Back     alignment and structure
>pdb|2REX|B Chain B, Crystal Structure Of The Effector Domain Of Plxnb1 Bound With Rnd1 Gtpase Length = 197 Back     alignment and structure
>pdb|2GCO|A Chain A, Crystal Structure Of The Human Rhoc-gppnhp Complex Length = 201 Back     alignment and structure
>pdb|3Q3J|B Chain B, Crystal Structure Of Plexin A2 Rbd In Complex With Rnd1 Length = 214 Back     alignment and structure
>pdb|1I4D|D Chain D, Crystal Structure Analysis Of Rac1-Gdp Complexed With Arfaptin (P21) Length = 192 Back     alignment and structure
>pdb|2VRW|A Chain A, Critical Structural Role For The Ph And C1 Domains Of The Vav1 Exchange Factor Length = 184 Back     alignment and structure
>pdb|2CJW|B Chain B, Crystal Structure Of The Small Gtpase Gem (Gemdndcam) In Complex To Mg.Gdp Length = 192 Back     alignment and structure
>pdb|2DPX|A Chain A, Crystal Structure Of Human Rad Gtpase Length = 174 Back     alignment and structure
>pdb|3Q72|A Chain A, Crystal Structure Of Rad G-Domain-Gtp Analog Complex Length = 166 Back     alignment and structure
>pdb|2GJS|A Chain A, The Crystal Structure Of Human Rrad In Complex With Gdp Length = 176 Back     alignment and structure
>pdb|2CJW|A Chain A, Crystal Structure Of The Small Gtpase Gem (Gemdndcam) In Complex To Mg.Gdp Length = 192 Back     alignment and structure
>pdb|1HE1|C Chain C, Crystal Structure Of The Complex Between The Gap Domain Of The Pseudomonas Aeruginosa Exos Toxin And Human Rac Length = 176 Back     alignment and structure
>pdb|3SUA|A Chain A, Crystal Structure Of The Intracellular Domain Of Plexin-B1 In Complex With Rac1 Length = 184 Back     alignment and structure
>pdb|2FJU|A Chain A, Activated Rac1 Bound To Its Effector Phospholipase C Beta 2 Length = 178 Back     alignment and structure
>pdb|1FOE|B Chain B, Crystal Structure Of Rac1 In Complex With The Guanine Nucleotide Exchange Region Of Tiam1 Length = 177 Back     alignment and structure
>pdb|3TJZ|A Chain A, Crystal Structure Of Arf1 Bound To The GammaZETA-Cop Core Complex Length = 164 Back     alignment and structure
>pdb|2K5U|A Chain A, Solution Structure Of Myirstoylated Yeast Arf1 Protein, Gdp- Bound Length = 181 Back     alignment and structure
>pdb|1Z6X|A Chain A, Structure Of Human Adp-Ribosylation Factor 4 Length = 180 Back     alignment and structure
>pdb|2YIN|C Chain C, Structure Of The Complex Between Dock2 And Rac1. Length = 196 Back     alignment and structure
>pdb|4GZM|A Chain A, Crystal Structure Of Rac1 F28l Mutant Length = 204 Back     alignment and structure
>pdb|3TH5|A Chain A, Crystal Structure Of Wild-Type Rac1 Length = 204 Back     alignment and structure
>pdb|3B13|B Chain B, Crystal Structure Of The Dhr-2 Domain Of Dock2 In Complex With Rac1 (T17n Mutant) Length = 184 Back     alignment and structure
>pdb|1HH4|A Chain A, Rac1-Rhogdi Complex Involved In Nadph Oxidase Activation Length = 192 Back     alignment and structure
>pdb|2ATX|A Chain A, Crystal Structure Of The Tc10 Gppnhp Complex Length = 194 Back     alignment and structure
>pdb|1MH1|A Chain A, Small G-Protein Length = 186 Back     alignment and structure
>pdb|1G4U|R Chain R, Crystal Structure Of The Salmonella Tyrosine Phosphatase And Gtpase Activating Protein Sptp Bound To Rac1 Length = 184 Back     alignment and structure
>pdb|2H7V|A Chain A, Co-crystal Structure Of Ypka-rac1 Length = 188 Back     alignment and structure
>pdb|3SBD|A Chain A, Crystal Structure Of Rac1 P29s Mutant Length = 187 Back     alignment and structure
>pdb|1MR3|F Chain F, Saccharomyces Cerevisiae Adp-Ribosylation Factor 2 (Scarf2) Complexed With Gdp-3'p At 1.6a Resolution Length = 181 Back     alignment and structure
>pdb|2G3Y|A Chain A, Crystal Structure Of The Human Small Gtpase Gem Length = 211 Back     alignment and structure
>pdb|2G0N|A Chain A, The Crystal Structure Of The Human Rac3 In Complex With Gdp And Chloride Length = 179 Back     alignment and structure
>pdb|2IC5|A Chain A, Crystal Structure Of Human Rac3 Grown In The Presence Of Gpp(Nh)p. Length = 180 Back     alignment and structure
>pdb|2C2H|A Chain A, Crystal Structure Of The Human Rac3 In Complex With Gdp Length = 192 Back     alignment and structure
>pdb|2HT6|A Chain A, Crystal Structure Of Human Gem G-Domain Bound To Gdp Length = 174 Back     alignment and structure
>pdb|2NZJ|A Chain A, The Crystal Structure Of Rem1 In Complex With Gdp Length = 175 Back     alignment and structure
>pdb|2Q3H|A Chain A, The Crystal Structure Of Rhoua In The Gdp-bound State Length = 201 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query168
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 7e-77
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 2e-74
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 5e-74
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 6e-74
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 2e-73
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 5e-73
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 6e-73
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 7e-73
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 8e-73
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 1e-72
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 2e-72
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 3e-72
3bbp_A211 RAB-6, RAS-related protein RAB-6A; golgi complex, 3e-72
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 1e-71
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 1e-71
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 2e-71
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 4e-71
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 6e-71
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 6e-71
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 7e-71
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 8e-71
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 1e-70
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 3e-70
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 7e-70
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 9e-70
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 4e-69
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 6e-69
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 6e-69
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 8e-69
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 1e-68
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 2e-68
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 3e-68
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 1e-67
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 1e-67
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 2e-66
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 4e-66
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 4e-66
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 1e-63
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 4e-63
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 9e-63
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 2e-61
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 1e-60
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 2e-60
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 2e-60
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 4e-59
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 4e-59
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 6e-59
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 4e-58
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 7e-58
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 1e-57
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 2e-57
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 3e-57
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 4e-57
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 6e-57
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 1e-56
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 2e-56
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 1e-55
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 4e-55
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 7e-55
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 4e-54
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 5e-54
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 7e-54
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 2e-52
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 1e-50
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 2e-48
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 3e-48
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 2e-47
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 6e-47
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 2e-42
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 3e-42
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 6e-30
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 2e-29
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 2e-28
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 8e-28
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 1e-27
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 3e-27
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 4e-26
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 2e-25
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 5e-25
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 1e-24
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 5e-24
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 5e-23
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 6e-22
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 1e-21
3t1o_A198 Gliding protein MGLA; G domain containing protein, 6e-20
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 2e-17
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 2e-13
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 1e-12
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 2e-12
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 4e-12
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 4e-12
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 6e-12
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 7e-12
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 8e-12
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 9e-12
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 2e-11
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 7e-10
3o47_A329 ADP-ribosylation factor GTPase-activating protein 1e-09
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 7e-09
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 2e-08
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 2e-08
3llu_A196 RAS-related GTP-binding protein C; structural geno 7e-08
2ged_A193 SR-beta, signal recognition particle receptor beta 1e-06
1nrj_B218 SR-beta, signal recognition particle receptor beta 1e-06
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 2e-06
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 1e-05
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 1e-05
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 2e-05
2fh5_B214 SR-beta, signal recognition particle receptor beta 2e-05
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 7e-05
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 6e-04
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Length = 206 Back     alignment and structure
 Score =  227 bits (580), Expect = 7e-77
 Identities = 86/161 (53%), Positives = 109/161 (67%), Gaps = 9/161 (5%)

Query: 17  RTRTLIV--------IWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQETFNNLKQWLEE 68
           + +T+ +        IWDTAGQERFRTITSSYYRG+HGII+VYD TDQE+FN +K WL+E
Sbjct: 46  KIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQE 105

Query: 69  IDRYACDNVNKLLVGNKNDQTSKKAVDYQVAKEYADHLKIPFLETSAKNGANVEQAFLTM 128
           IDRYA   V KLLVGNK D   K+ V+Y VAKE+AD  K+PFLETSA +  NVE AFLTM
Sbjct: 106 IDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTM 165

Query: 129 ATEIKKRV-TKDEKPSSESDAKKLNLNSGKPVDAPRSGGCC 168
           A +IK+ +  ++   +++    K N+N          G CC
Sbjct: 166 ARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLTNTGGCCC 206


>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Length = 196 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Length = 183 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Length = 203 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 201 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} Length = 191 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Length = 199 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Length = 189 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 180 Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Length = 199 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Length = 193 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 213 Back     alignment and structure
>3bbp_A RAB-6, RAS-related protein RAB-6A; golgi complex, GRIP domain, RAB GTPase, ARL GTPase, golgin, RAB effector, clAsp protein; HET: GTP; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Length = 191 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Length = 223 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Length = 181 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Length = 191 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Length = 201 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Length = 200 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Length = 186 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Length = 192 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Length = 217 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Length = 195 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Length = 179 Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Length = 170 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Length = 199 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Length = 207 Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Length = 181 Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Length = 170 Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Length = 170 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Length = 168 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Length = 170 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Length = 192 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Length = 195 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Length = 218 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Length = 179 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Length = 189 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Length = 178 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Length = 177 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Length = 182 Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Length = 208 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Length = 181 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Length = 206 Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Length = 208 Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 1qg4_A* 3ea5_A* 1qg2_A* 1byu_A* 3ran_A* 3gjx_C* ... Length = 221 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Length = 168 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Length = 187 Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* Length = 181 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} Length = 169 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Length = 166 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Length = 195 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Length = 167 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Length = 172 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 199 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Length = 183 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Length = 189 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Length = 175 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Length = 166 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Length = 167 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Length = 190 Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Length = 211 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Length = 192 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 196 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 170 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} Length = 184 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Length = 187 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Length = 184 Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Length = 535 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Length = 178 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Length = 182 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* Length = 194 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Length = 214 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Length = 201 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Length = 212 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 207 Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Length = 255 Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Length = 205 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Length = 204 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Length = 184 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Length = 186 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Length = 201 Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Length = 214 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Length = 194 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Length = 198 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Length = 332 Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Length = 190 Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Length = 192 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Length = 188 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 187 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Length = 164 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Length = 189 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Length = 171 Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Length = 181 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 183 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Length = 186 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Length = 181 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Length = 329 Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Length = 190 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Length = 198 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Length = 196 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Length = 193 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 218 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Length = 476 Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Length = 227 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} Length = 307 Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} Length = 331 Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Length = 214 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Length = 172 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Length = 423 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query168
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 100.0
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.96
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.95
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.95
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.94
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.94
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.94
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.94
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.94
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.94
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.94
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.94
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.93
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.93
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.93
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.93
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.93
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.93
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.93
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.93
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.93
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.93
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.93
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.93
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.93
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.93
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.93
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.93
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.93
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.93
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.93
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.93
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.93
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.93
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.93
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.93
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.93
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.92
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.92
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.92
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.92
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.92
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.92
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.92
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.92
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.92
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.92
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.92
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.92
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.92
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.92
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.92
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.92
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.92
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.92
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.92
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.91
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.91
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.91
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.91
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.91
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.91
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.91
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.91
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.91
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.91
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.91
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.91
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.91
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.91
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.91
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.91
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.91
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.91
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.91
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.9
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.9
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.9
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.9
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.9
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 99.9
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.9
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.9
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.89
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.89
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.89
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.89
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.89
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.89
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.89
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.89
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 99.89
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.89
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.89
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.88
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.88
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 99.88
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.88
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 99.87
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 99.87
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.87
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.87
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.86
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.86
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 99.86
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.86
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 99.85
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.75
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.83
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.83
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 99.83
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.8
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 99.79
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.79
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.79
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.78
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.76
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.75
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.75
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.74
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.74
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.73
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.73
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 99.72
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.72
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.71
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.69
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.69
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.68
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.67
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.67
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.66
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 99.66
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.66
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.66
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.66
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.65
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 99.63
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 99.63
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 99.63
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 99.61
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.61
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 99.6
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 99.6
1wb1_A 482 Translation elongation factor SELB; selenocysteine 99.59
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.59
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 99.59
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 99.59
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 99.58
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 99.58
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.57
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 99.57
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 99.56
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.56
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.56
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 99.55
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 99.54
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 99.52
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.52
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 99.51
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.5
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.5
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 99.5
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 99.49
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.49
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 99.49
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.47
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 99.47
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.46
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 99.45
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.43
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 99.39
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.39
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.38
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 99.38
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.37
2ged_A193 SR-beta, signal recognition particle receptor beta 99.37
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 99.34
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.33
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.33
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 99.33
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 99.31
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 99.27
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 99.26
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.25
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 99.24
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.15
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.14
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 99.11
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.11
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 99.1
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 99.09
3h2y_A 368 GTPase family protein; GTP-binding protein YQEH, p 99.08
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.07
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 99.05
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 99.0
1wxq_A397 GTP-binding protein; structural genomics, riken st 98.99
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 98.99
3ec1_A 369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 98.94
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 98.9
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 98.89
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 98.86
1puj_A 282 YLQF, conserved hypothetical protein YLQF; structu 98.84
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 98.81
1jal_A363 YCHF protein; nucleotide-binding fold, structural 98.68
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 98.68
2www_A349 Methylmalonic aciduria type A protein, mitochondri 98.67
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 98.63
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 98.56
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 98.44
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 98.42
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.41
3cnl_A 262 YLQF, putative uncharacterized protein; circular p 98.37
2hf9_A226 Probable hydrogenase nickel incorporation protein 98.32
2rcn_A 358 Probable GTPase ENGC; YJEQ, circularly permuted, G 98.18
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 97.91
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 97.34
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 96.67
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 96.63
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 96.09
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 95.72
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 95.7
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 95.3
3end_A307 Light-independent protochlorophyllide reductase ir 95.24
3cwq_A209 Para family chromosome partitioning protein; alpha 95.0
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 94.67
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 94.46
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 94.26
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 94.01
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 93.29
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 93.01
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 92.61
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 92.52
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 92.33
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 92.08
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 90.83
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 90.02
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 89.12
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 88.74
3pg5_A361 Uncharacterized protein; structural genomics, PSI- 88.45
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 86.61
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 86.57
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 85.75
1vma_A306 Cell division protein FTSY; TM0570, structural gen 84.71
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 84.41
2xxa_A 433 Signal recognition particle protein; protein trans 84.27
2xj4_A286 MIPZ; replication, cell division, ATPase, WACA; 1. 83.85
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 81.6
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 81.53
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
Probab=100.00  E-value=2.5e-33  Score=202.48  Aligned_cols=135  Identities=32%  Similarity=0.509  Sum_probs=116.1

Q ss_pred             ccccccc----eeeeeeCCeEEEEEEEeCCCchhhcccchhhhcCCcEEEEEEeCCChhhHHHHHHHHHHHHHhcCCCCc
Q psy2646           3 LLLPYQT----LQNKKEERTRTLIVIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQETFNNLKQWLEEIDRYACDNVN   78 (168)
Q Consensus         3 ~~~~t~~----~~~~~~~~~~~~l~l~Dt~G~~~~~~~~~~~~~~~d~~i~v~d~~~~~s~~~~~~~~~~i~~~~~~~~p   78 (168)
                      .+.||++    .+.+.+++..+.++||||+|+++|..+++.|+++++++++|||++++++|+.+..|+..+.....++.|
T Consensus        41 ~~~~Tig~d~~~k~~~~~~~~v~l~iwDtaGqe~~~~l~~~~~~~a~~~ilv~di~~~~Sf~~i~~~~~~i~~~~~~~~p  120 (216)
T 4dkx_A           41 TYQATIGIDFLSKTMYLEDRTIRLQLWDTAGLERFRSLIPSYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVI  120 (216)
T ss_dssp             ---------CEEEEEECSSCEEEEEEECCSCTTTCGGGHHHHHTTCSEEEEEEETTCHHHHHTHHHHHHHHHHHHTTSSE
T ss_pred             CcCCccceEEEEEEEEecceEEEEEEEECCCchhhhhHHHHHhccccEEEEEeecchhHHHHHHHHHHHHHHHhcCCCCe
Confidence            3567776    456677899999999999999999999999999999999999999999999999999999776667899


Q ss_pred             EEEEEecCCCCCCcccCHHHHHHHHHhcCCCEEEEeccCCCCHHHHHHHHHHHHHHHhc
Q psy2646          79 KLLVGNKNDQTSKKAVDYQVAKEYADHLKIPFLETSAKNGANVEQAFLTMATEIKKRVT  137 (168)
Q Consensus        79 iivv~nK~Dl~~~~~v~~~~~~~~~~~~~~~~~~vSa~~~~~i~~i~~~l~~~~~~~~~  137 (168)
                      ++|||||+|+...+.++.+++.++++.++++|+++||++|.||+++|+.|++.+.....
T Consensus       121 iilVgNK~Dl~~~r~V~~~e~~~~a~~~~~~~~e~SAktg~nV~e~F~~i~~~i~~~~~  179 (216)
T 4dkx_A          121 IMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMES  179 (216)
T ss_dssp             EEEEEECTTCGGGCCSCHHHHHHHHHHHTCEEEEEBTTTTBSHHHHHHHHHHHC-----
T ss_pred             EEEEeeccchHhcCcccHHHHhhHHHHhCCeeEEEeCCCCcCHHHHHHHHHHHHHhhhc
Confidence            99999999999888999999999999999999999999999999999999988875543



>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 168
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 9e-34
d2g6ba1170 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T 1e-32
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 2e-31
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 3e-30
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 2e-29
d2bcgy1194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 2e-29
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 4e-29
d1z0fa1166 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [Ta 5e-29
d2a5ja1173 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [Ta 2e-28
d2ew1a1171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 2e-28
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 2e-27
d2f7sa1186 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [T 3e-27
d1yzqa1164 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [Ta 4e-27
d1u8za_168 c.37.1.8 (A:) Ras-related protein RalA {Cotton-top 1e-24
d1z08a1167 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [T 2e-24
d1r2qa_170 c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 2e-24
d1kaoa_167 c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9e-23
d1ek0a_170 c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces 4e-21
d1z0ja1167 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [ 1e-20
d1ctqa_166 c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapi 2e-20
d1wmsa_174 c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 1e-19
d1c1ya_167 c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 3e-19
d1e0sa_173 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 5e-18
d2erya1171 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [ 7e-18
d1mh1a_183 c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 96 9e-18
d1z06a1165 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) 2e-17
d2fn4a1173 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [T 4e-17
d1moza_182 c.37.1.8 (A:) ADP-ribosylation factor {Baker's yea 4e-17
d1z2aa1164 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [Ta 7e-17
d1x1ra1169 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRa 7e-17
d2atxa1185 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [Tax 2e-16
d2erxa1171 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [ 4e-16
d1r8sa_160 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 6e-16
d1ky3a_175 c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y 1e-15
d2ngra_191 c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 1e-15
d1vg8a_184 c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId 2e-15
d2atva1168 c.37.1.8 (A:5-172) Ras-like estrogen-regulated gro 2e-14
d1ksha_165 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 5e-14
d1fzqa_176 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 6e-14
d1zj6a1177 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human 6e-14
d1kmqa_177 c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9 9e-14
d2gjsa1168 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [Tax 9e-13
d2g3ya1172 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human 9e-13
d1m7ba_179 c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [T 2e-12
d1xtqa1167 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human 3e-12
d1i2ma_170 c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 96 9e-11
d1upta_169 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 6e-10
d2bmja1175 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {H 1e-09
d1zd9a1164 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human 4e-09
d2qtvb1166 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom 8e-09
d2bcjq2200 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha sub 2e-08
d1f6ba_186 c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus gr 1e-07
d1zcba2200 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha sub 1e-06
d1svsa1195 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha sub 3e-06
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab8a
species: Mouse (Mus musculus) [TaxId: 10090]
 Score =  115 bits (288), Expect = 9e-34
 Identities = 56/117 (47%), Positives = 84/117 (71%)

Query: 22  IVIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQETFNNLKQWLEEIDRYACDNVNKLL 81
           + IWDTAGQERFRTIT++YYRGA GI++VYD T++++F+N++ W+  I+ +A  +V K++
Sbjct: 57  LQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMI 116

Query: 82  VGNKNDQTSKKAVDYQVAKEYADHLKIPFLETSAKNGANVEQAFLTMATEIKKRVTK 138
           +GNK D   K+ V  +  ++ A    I F+ETSAK   NVE AF T+A +IK ++ K
Sbjct: 117 LGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDK 173


>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Length = 168 Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Length = 167 Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Length = 182 Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Length = 169 Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Length = 185 Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184 Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Length = 179 Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 186 Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 195 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query168
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.95
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.95
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.95
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.95
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.95
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.95
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.94
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.94
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.94
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.94
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.93
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.93
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.92
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.92
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.92
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.92
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.92
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.91
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.91
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.91
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.9
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.9
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.9
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.88
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.88
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.8
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.76
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.76
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.73
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.71
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.7
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.69
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.64
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 99.63
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.59
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.56
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.55
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.52
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.51
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.48
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.45
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.44
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.41
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.39
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.36
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.36
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.35
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.21
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.21
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.19
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 99.11
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.1
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 99.0
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 98.98
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 98.93
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 98.88
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 98.87
d1nrjb_209 Signal recognition particle receptor beta-subunit 98.8
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 98.63
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 98.62
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 98.36
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 98.33
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 98.28
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 98.01
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 97.96
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 97.89
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 97.8
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 97.53
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 96.45
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 96.16
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 95.83
d2qy9a2211 GTPase domain of the signal recognition particle r 94.14
d1okkd2207 GTPase domain of the signal recognition particle r 94.08
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 93.81
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 93.61
d1vmaa2213 GTPase domain of the signal recognition particle r 93.23
d1j8yf2211 GTPase domain of the signal sequence recognition p 90.48
d1ls1a2207 GTPase domain of the signal sequence recognition p 90.06
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 89.22
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 87.42
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 84.36
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 84.03
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rad
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96  E-value=2.9e-29  Score=172.89  Aligned_cols=129  Identities=22%  Similarity=0.301  Sum_probs=110.3

Q ss_pred             ceeeeeeCCeEEEEEEEeCCCchhhcccchhhhcCCcEEEEEEeCCChhhHHHHHHHHHHHHHhc-CCCCcEEEEEecCC
Q psy2646           9 TLQNKKEERTRTLIVIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQETFNNLKQWLEEIDRYA-CDNVNKLLVGNKND   87 (168)
Q Consensus         9 ~~~~~~~~~~~~~l~l~Dt~G~~~~~~~~~~~~~~~d~~i~v~d~~~~~s~~~~~~~~~~i~~~~-~~~~piivv~nK~D   87 (168)
                      ..+.+.+++..+.+.+||++|++++..++..+++++|++|+|||++++.+|+.+..|+..+.... ...+|+++||||+|
T Consensus        37 ~~~~i~~~~~~~~l~i~D~~g~e~~~~~~~~~~~~~d~~ilv~d~t~~~s~~~~~~~~~~i~~~~~~~~~piilvgnK~D  116 (168)
T d2gjsa1          37 YDRSIVVDGEEASLMVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSD  116 (168)
T ss_dssp             EEEEEEETTEEEEEEEEECC-------CHHHHHTSCSEEEEEEETTCHHHHHHHHHHHHHHHHHCC--CCCEEEEEECTT
T ss_pred             ecceeeccccccceeeeecccccccceecccchhhhhhhceeccccccccccccccccchhhcccccccceEEEeecccc
Confidence            34567789999999999999999999999999999999999999999999999999999986654 45689999999999


Q ss_pred             CCCCcccCHHHHHHHHHhcCCCEEEEeccCCCCHHHHHHHHHHHHHHHhc
Q psy2646          88 QTSKKAVDYQVAKEYADHLKIPFLETSAKNGANVEQAFLTMATEIKKRVT  137 (168)
Q Consensus        88 l~~~~~v~~~~~~~~~~~~~~~~~~vSa~~~~~i~~i~~~l~~~~~~~~~  137 (168)
                      +...++++..++..+++.++++++++||++|.|++++|+++++.+..++.
T Consensus       117 l~~~~~v~~~~~~~~~~~~~~~~~e~Sak~~~~v~~~f~~l~~~i~~~~~  166 (168)
T d2gjsa1         117 LVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRRD  166 (168)
T ss_dssp             CGGGCCSCHHHHHHHHHHHTSEEEECBTTTTBSHHHHHHHHHHHHHHHHH
T ss_pred             hhhhcchhHHHHHHHHHhcCCEEEEEeCCCCcCHHHHHHHHHHHHHHHhh
Confidence            98888889999999999999999999999999999999999998877654



>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure