Psyllid ID: psy2651


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340--
METHRRASRRYSGFRSETLGIRVTYVKVITTLEYSLVFQYSALTTNFHLFFYCHSATSYCLLDGDKVPKLIACCALGSVSFSSILDQRFNGKLHKKEDFKPFSIQLSTLVEWNLAANKKENAIISPFSLHVVLGLASFGAAGSTAEAMMKGLRIKHSETLLKDYKGIIDQLSKDYKGIIDQLSKSPELKIANKIYFAKDIELNPAYQTQAVDNFNSELGKVDFSQPPAAAKEMNDWVSNHTNDKIKDLIKADSLDASTKLVLINAIHFKGKWTVPFKPEATKDGPFYLDDTNSVQVPLMFVKDSFYMYEEAGEDGFKMLELPYGVSISFIIKSQVVPEMGRL
cHHHHHHHcccccccccccEEEEEEEEEEEEcccccEEEEEEEccccHHHHHHHHHHHHHHHccccccHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccEEEccHHHHHHHHHHHHcccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEHHccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccHHEEEHHHHccccccccccccccccccEEcccccEEEEcccccccccccEEEcccccEEEEEEccccccEEEEccccccccccc
ccccccHcccccccccccccEEEEEEEEEEEHHHHHHHHHHHHHHHHHHHHccccHcHEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEcHHHHHHHHHHHHHHccHHHHHHHHcHccccccccccHHHHHHHHHHHHHHHHHHccccccEccEEEEEEEEEccccEccHHHccccccccccEEEEccccHHHHHHHHHHHHHHHccccccccccHHHccccccEEEEEEEEEEEcEcccccHHHcEEEEEcccccccEEEEEEEEEEEEEEEEEHHHccEEEEEEEEccccEEEEEEEcccccccc
methrrasrrysgfrsetLGIRVTYVKVITTLEYSLVFQYSALTTNFHLFFYCHsatsyclldgdkvpkLIACCalgsvsfssildqrfngklhkkedfkpfsIQLSTLVEWNLAankkenaiisPFSLHVVLGLASFGAAGSTAEAMMKGLRIKHSETLLKDYKGIIDQLSKDYKGIIDQlskspelkiANKIYfakdielnpayqtqAVDNFnselgkvdfsqppaaakEMNDWVSNhtndkikdlikadsldaSTKLVLINAIhfkgkwtvpfkpeatkdgpfylddtnsvqvplmfvKDSFYMYEEAGEDGfkmlelpygvsiSFIIKSqvvpemgrl
methrrasrrysgfrsetlgiRVTYVKVITTLEYSLVFQYSALTTNFHLFFYCHSATSYCLLDGDKVPKLIACCALGSVSFSSILDQRFNGKLHKKEDFKPFSIQLSTLVEWNLAANKKENAIISPFSLHVVLGLASFGAAGSTAEAMMKGLRIKHSETLLKDYKGIIDQLSKDYKGIIDQLSKSPELKIANKIYFAKDIELNPAYQTQAVDNFNSELGKVDFSQPPAAAKEMNDWVSNHTNDKIKDLIKADSLDASTKLVLINAihfkgkwtvpfkpEATKDGPFYLDDTNSVQVPLMFVKDSFYMYEEAGEDGFKMLELPYGVSIsfiiksqvvpemgrl
METHRRASRRYSGFRSETLGIRVTYVKVITTLEYSLVFQYSALTTNFHLFFYCHSATSYCLLDGDKVPKLIACCALGSVSFSSILDQRFNGKLHKKEDFKPFSIQLSTLVEWNLAANKKENAIISPFSLHVVLGLASFGAAGSTAEAMMKGLRIKHSETLLKDYKGIIDQLSKDYKGIIDQLSKSPELKIANKIYFAKDIELNPAYQTQAVDNFNSELGKVDFSQPPAAAKEMNDWVSNHTNDKIKDLIKADSLDASTKLVLINAIHFKGKWTVPFKPEATKDGPFYLDDTNSVQVPLMFVKDSFYMYEEAGEDGFKMLELPYGVSISFIIKSQVVPEMGRL
*************FRSETLGIRVTYVKVITTLEYSLVFQYSALTTNFHLFFYCHSATSYCLLDGDKVPKLIACCALGSVSFSSILDQRFNGKLHKKEDFKPFSIQLSTLVEWNLAANKKENAIISPFSLHVVLGLASFGAAGSTAEAMMKGLRIKHSETLLKDYKGIIDQLSKDYKGIIDQLSKSPELKIANKIYFAKDIELNPAYQTQAVDNFNS*******************WVSNHTNDKIKDLIKADSLDASTKLVLINAIHFKGKWTVPFKPEATKDGPFYLDDTNSVQVPLMFVKDSFYMYEEAGEDGFKMLELPYGVSISFIIKSQV*******
*************FRSETLGIRVTYVKVITTLEYSLVFQYSALTTNFHLFFYCHSATSYCLLDGDKVPKLIACCALGSV*********************PFSIQLSTLVEWNLAANKKENAIISPFSLHVVLGLASFGAAGSTAEAMMKGLRIKHS***********DQLSKDYKG**DQLSKSPELKIANKIYFAKDIELNPAYQTQAVDNFNSELGKVDFSQPPAAAKEMNDWVSNHTNDKIKDLIKADSLDASTKLVLINAIHFKGKWTVPFKPEATKDGPFYLDDTNSVQVPLMFVKDSFYMYEEAGEDGFKMLELPYGVSISFIIKSQVVPEMG**
***********SGFRSETLGIRVTYVKVITTLEYSLVFQYSALTTNFHLFFYCHSATSYCLLDGDKVPKLIACCALGSVSFSSILDQRFNGKLHKKEDFKPFSIQLSTLVEWNLAANKKENAIISPFSLHVVLGLASFGAAGSTAEAMMKGLRIKHSETLLKDYKGIIDQLSKDYKGIIDQLSKSPELKIANKIYFAKDIELNPAYQTQAVDNFNSELGKVDFSQPPAAAKEMNDWVSNHTNDKIKDLIKADSLDASTKLVLINAIHFKGKWTVPFKPEATKDGPFYLDDTNSVQVPLMFVKDSFYMYEEAGEDGFKMLELPYGVSISFIIKSQVVPEMGRL
*************FRSETLGIRVTYVKVITTLEYSLVFQYSALTTNFHLFFYCHSATSYCLLDGDKVPKLIACCALGS***************HKKEDFKPFSIQLSTLVEWNLAANKKENAIISPFSLHVVLGLASFGAAGSTAEAMMKGLRIKHSETLLKDYKGIIDQLSKDYKGIIDQLSKSPELKIANKIYFAKDIELNPAYQTQAVDNFNSELGKVDFSQPPAAAKEMNDWVSNHTNDKIKDLIKADSLDASTKLVLINAIHFKGKWTVPFKPEATKDGPFYLDDTNSVQVPLMFVKDSFYMYEEAGEDGFKMLELPYGVSISFIIKSQVVPE****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METHRRASRRYSGFRSETLGIRVTYVKVITTLEYSLVFQYSALTTNFHLFFYCHSATSYCLLDGDKVPKLIACCALGSVSFSSILDQRFNGKLHKKEDFKPFSIQLSTLVEWNLAANKKENAIISPFSLHVVLGLASFGAAGSTAEAMMKGLRIKHSETLLKDYKGIIDQLSKDYKGIIDQLSKSPELKIANKIYFAKDIELNPAYQTQAVDNFNSELGKVDFSQPPAAAKEMNDWVSNHTNDKIKDLIKADSLDASTKLVLINAIHFKGKWTVPFKPEATKDGPFYLDDTNSVQVPLMFVKDSFYMYEEAGEDGFKMLELPYGVSISFIIKSQVVPEMGRL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query342 2.2.26 [Sep-21-2011]
Q5MGH0 383 Serine protease inhibitor N/A N/A 0.599 0.535 0.375 7e-34
Q9JLD2 410 Neuroserpin OS=Rattus nor yes N/A 0.652 0.543 0.325 3e-30
Q99574 410 Neuroserpin OS=Homo sapie yes N/A 0.631 0.526 0.331 9e-30
O35684 410 Neuroserpin OS=Mus muscul yes N/A 0.637 0.531 0.310 1e-29
Q90935 410 Neuroserpin OS=Gallus gal yes N/A 0.616 0.514 0.333 6e-29
Q80X76 445 Serine protease inhibitor no N/A 0.625 0.480 0.327 1e-28
P93692 398 Serpin-Z2B OS=Triticum ae N/A N/A 0.622 0.535 0.340 3e-28
Q9ST58 398 Serpin-Z1C OS=Triticum ae N/A N/A 0.622 0.535 0.336 4e-28
P22922 392 Antitrypsin OS=Bombyx mor N/A N/A 0.672 0.586 0.318 1e-27
Q03734 418 Serine protease inhibitor no N/A 0.631 0.516 0.334 2e-27
>sp|Q5MGH0|SPI3_LONON Serine protease inhibitor 3/4 (Fragment) OS=Lonomia obliqua PE=1 SV=1 Back     alignment and function desciption
 Score =  144 bits (364), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 81/216 (37%), Positives = 123/216 (56%), Gaps = 11/216 (5%)

Query: 117 NKKENAIISPFSLHVVLGLASFGAAGSTAEAMMKGLRIKHSETLLKDYKGIIDQLSKDYK 176
           N  +N + S FS+   L   +  +AG + + +   +   +        K +   L+++ K
Sbjct: 49  NPNKNIVFSAFSVMSPLAQLAIASAGESRDELFSAIGFPNENVT----KAVFTDLNRELK 104

Query: 177 GIIDQLSKSPELKIANKIYFAKDIELNPAYQTQAVDNFNSELGKVDFSQPPAAAKEMNDW 236
            +     K   LKIANKIY A   ELN  +   + D FNSE+ K+DF+Q   AAK +N W
Sbjct: 105 SV-----KGVTLKIANKIYIANGFELNDQFAVVSKDVFNSEVQKLDFAQNKVAAKTINTW 159

Query: 237 VSNHTNDKIKDLIKADSLDASTKLVLINAIHFKGKWTVPFKPEATKDGPFYLDDTNSVQV 296
           V +HTN++IKDL+  +SLD  T+ VL+NA++FKG W   F  E+T D PF++D+T ++QV
Sbjct: 160 VEDHTNNRIKDLVDPNSLDDYTRAVLVNALYFKGSWKNKFDKESTIDRPFHVDNTKTIQV 219

Query: 297 PLMFVKDSFYMYEEAGEDGFKMLELPY-GVSISFII 331
           P M  +   Y Y E+ E   K++E+PY G   S +I
Sbjct: 220 PTMH-RSGQYSYGESRELNAKIIEMPYEGDETSLVI 254





Lonomia obliqua (taxid: 304329)
>sp|Q9JLD2|NEUS_RAT Neuroserpin OS=Rattus norvegicus GN=Serpini1 PE=2 SV=1 Back     alignment and function description
>sp|Q99574|NEUS_HUMAN Neuroserpin OS=Homo sapiens GN=SERPINI1 PE=1 SV=1 Back     alignment and function description
>sp|O35684|NEUS_MOUSE Neuroserpin OS=Mus musculus GN=Serpini1 PE=1 SV=1 Back     alignment and function description
>sp|Q90935|NEUS_CHICK Neuroserpin OS=Gallus gallus GN=SERPINI1 PE=1 SV=1 Back     alignment and function description
>sp|Q80X76|SPA3F_MOUSE Serine protease inhibitor A3F OS=Mus musculus GN=Serpina3f PE=1 SV=3 Back     alignment and function description
>sp|P93692|SPZ2B_WHEAT Serpin-Z2B OS=Triticum aestivum PE=1 SV=1 Back     alignment and function description
>sp|Q9ST58|SPZ1C_WHEAT Serpin-Z1C OS=Triticum aestivum PE=1 SV=1 Back     alignment and function description
>sp|P22922|A1AT_BOMMO Antitrypsin OS=Bombyx mori PE=1 SV=2 Back     alignment and function description
>sp|Q03734|SPA3M_MOUSE Serine protease inhibitor A3M OS=Mus musculus GN=Serpina3m PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query342
118421175378 serpin [Anopheles sinensis] 0.666 0.603 0.4 1e-40
170058774377 serine protease inhibitor 4, serpin-4 [C 0.652 0.591 0.409 2e-37
157116803379 serine protease inhibitor 4, serpin-4 [A 0.608 0.548 0.415 1e-36
157116799376 serine protease inhibitor 4, serpin-4 [A 0.608 0.553 0.415 1e-36
157116805373 serine protease inhibitor 4, serpin-4 [A 0.608 0.557 0.415 2e-36
157116801386 serine protease inhibitor 4, serpin-4 [A 0.608 0.538 0.415 2e-36
187441032241 SRPN10 protein [Anopheles gambiae] 0.593 0.842 0.405 2e-35
187441010241 SRPN10 protein [Anopheles arabiensis] gi 0.593 0.842 0.405 2e-35
187441022241 SRPN10 protein [Anopheles gambiae] gi|18 0.593 0.842 0.405 2e-35
187441004241 SRPN10 protein [Anopheles arabiensis] gi 0.593 0.842 0.405 2e-35
>gi|118421175|gb|ABK88283.1| serpin [Anopheles sinensis] Back     alignment and taxonomy information
 Score =  173 bits (439), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 141/245 (57%), Gaps = 17/245 (6%)

Query: 82  SSILDQRFNGKLHKKEDFKPFSIQLSTLVEWNLAANKKENAIISPFSLHVVLGLASFGAA 141
           S  +D++F G+ ++      F+I+L  LV    A N  EN +ISPFS+   L LA+ GA 
Sbjct: 2   SEAVDRQFVGQSNE------FAIKLFQLVS---AQNAGENVVISPFSISACLSLAAMGAG 52

Query: 142 GSTAEAMMKGLRIKHSETLLKDYKGIIDQLSKDYKGIIDQLSKSPELKIANKIYFAKDIE 201
           G TAE M  GL    + +       +   ++ +Y+ ++ +L     + +ANKIY  K+  
Sbjct: 53  GLTAEQMFTGLNYGSAGS-------VKSTVADNYRRLLTRLDSDSTVNVANKIYVMKNYG 105

Query: 202 LNPAYQTQAVDNFNSELGKVDFSQPPAAAKEMNDWVSNHTNDKIKDLIKADSLDASTKLV 261
           +  A+   A D+F SE   VDF+Q  AAAK +N WV + TN+KIKDLI  DSLD  +++V
Sbjct: 106 IKSAFNAIATDSFRSEAESVDFAQSVAAAKTINGWVESKTNNKIKDLISPDSLDDLSRMV 165

Query: 262 LINAIHFKGKWTVPFKPEATKDGPFYLDDTNSVQVPLMFVKDSFYMYEEAGEDGFKMLEL 321
           L+NA+HFKG WT  F P+ T+  PF+  +T S  VP+M +K  F  Y    + GF  LEL
Sbjct: 166 LVNAVHFKGTWTYQFNPQLTRPFPFWTSETESRDVPMMNIKKEF-AYNNFEDQGFSALEL 224

Query: 322 PYGVS 326
            YG S
Sbjct: 225 TYGGS 229




Source: Anopheles sinensis

Species: Anopheles sinensis

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|170058774|ref|XP_001865070.1| serine protease inhibitor 4, serpin-4 [Culex quinquefasciatus] gi|167877746|gb|EDS41129.1| serine protease inhibitor 4, serpin-4 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157116803|ref|XP_001658643.1| serine protease inhibitor 4, serpin-4 [Aedes aegypti] gi|108876284|gb|EAT40509.1| AAEL007765-PD [Aedes aegypti] Back     alignment and taxonomy information
>gi|157116799|ref|XP_001658641.1| serine protease inhibitor 4, serpin-4 [Aedes aegypti] gi|108876282|gb|EAT40507.1| AAEL007765-PC [Aedes aegypti] Back     alignment and taxonomy information
>gi|157116805|ref|XP_001658644.1| serine protease inhibitor 4, serpin-4 [Aedes aegypti] gi|108876285|gb|EAT40510.1| AAEL007765-PB [Aedes aegypti] Back     alignment and taxonomy information
>gi|157116801|ref|XP_001658642.1| serine protease inhibitor 4, serpin-4 [Aedes aegypti] gi|108876283|gb|EAT40508.1| AAEL007765-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|187441032|emb|CAO83830.1| SRPN10 protein [Anopheles gambiae] Back     alignment and taxonomy information
>gi|187441010|emb|CAO83819.1| SRPN10 protein [Anopheles arabiensis] gi|187441016|emb|CAO83822.1| SRPN10 protein [Anopheles arabiensis] Back     alignment and taxonomy information
>gi|187441022|emb|CAO83825.1| SRPN10 protein [Anopheles gambiae] gi|187441026|emb|CAO83827.1| SRPN10 protein [Anopheles gambiae] gi|187441030|emb|CAO83829.1| SRPN10 protein [Anopheles gambiae] Back     alignment and taxonomy information
>gi|187441004|emb|CAO83816.1| SRPN10 protein [Anopheles arabiensis] gi|187441006|emb|CAO83817.1| SRPN10 protein [Anopheles arabiensis] gi|187441008|emb|CAO83818.1| SRPN10 protein [Anopheles arabiensis] gi|187441012|emb|CAO83820.1| SRPN10 protein [Anopheles arabiensis] gi|187441014|emb|CAO83821.1| SRPN10 protein [Anopheles arabiensis] gi|187441018|emb|CAO83823.1| SRPN10 protein [Anopheles arabiensis] gi|187441020|emb|CAO83824.1| SRPN10 protein [Anopheles gambiae] gi|187441024|emb|CAO83826.1| SRPN10 protein [Anopheles gambiae] gi|187441028|emb|CAO83828.1| SRPN10 protein [Anopheles gambiae] gi|187441034|emb|CAO83831.1| SRPN10 protein [Anopheles gambiae] gi|187441036|emb|CAO83832.1| SRPN10 protein [Anopheles gambiae] gi|187441038|emb|CAO83833.1| SRPN10 protein [Anopheles gambiae] gi|187441040|emb|CAO83834.1| SRPN10 protein [Anopheles gambiae] gi|187441044|emb|CAO83836.1| SRPN10 protein [Anopheles gambiae] gi|187441046|emb|CAO83837.1| SRPN10 protein [Anopheles gambiae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query342
UNIPROTKB|Q8WSX7 395 spi21F "AGAP005246-PA" [Anophe 0.593 0.513 0.405 4.4e-36
FB|FBgn0024294 393 Spn43Aa "Serpin 43Aa" [Drosoph 0.614 0.534 0.358 8.8e-31
RGD|619896 410 Serpini1 "serpin peptidase inh 0.654 0.546 0.326 3e-30
UNIPROTKB|E2RLA3 410 SERPINI1 "Uncharacterized prot 0.628 0.524 0.347 4.9e-30
UNIPROTKB|Q99574 410 SERPINI1 "Neuroserpin" [Homo s 0.716 0.597 0.309 4.9e-30
UNIPROTKB|F1SH33 410 SERPINI1 "Uncharacterized prot 0.695 0.580 0.325 6.2e-30
UNIPROTKB|E1BCA5 410 SERPINI1 "Uncharacterized prot 0.634 0.529 0.337 1.3e-29
MGI|MGI:1194506 410 Serpini1 "serine (or cysteine) 0.643 0.536 0.325 1.3e-29
MGI|MGI:2182838 445 Serpina3f "serine (or cysteine 0.634 0.487 0.331 5.6e-29
UNIPROTKB|Q90935 410 SERPINI1 "Neuroserpin" [Gallus 0.675 0.563 0.334 7.1e-29
UNIPROTKB|Q8WSX7 spi21F "AGAP005246-PA" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
 Score = 389 (142.0 bits), Expect = 4.4e-36, P = 4.4e-36
 Identities = 86/212 (40%), Positives = 124/212 (58%)

Query:   115 AANKKENAIISPFSLHVVLGLASFGAAGSTAEAMMKGLRIKHSETLLKDYKGIIDQLSKD 174
             A +  EN +ISPFS+   L LA+ GA G TAE M   L     E    D K  +   + +
Sbjct:    29 AKHAGENVVISPFSISACLSLAAMGAGGLTAEQMYSVL-----EFGAPDRKQTV---ADN 80

Query:   175 YKGIIDQLSKSPELKIANKIYFAKDIELNPAYQTQAVDNFNSELGKVDFSQPPAAAKEMN 234
             Y+ ++++L+    + +ANKIY  ++  +  A+   A  +F SE   V+F++  AAAK++N
Sbjct:    81 YRRLMERLATDSTVNVANKIYVMQNYAVKGAFNAIATGSFRSEAESVNFAESAAAAKKIN 140

Query:   235 DWVSNHTNDKIKDLIKADSLDASTKLVLINAIHFKGKWTVPFKPEATKDGPFYLDDTNSV 294
              WV   TN+KIKDLI  D+LD  +++VL+NA+HFKG WT  F P  T+  PF+L +T S 
Sbjct:   141 GWVEEKTNNKIKDLISPDALDELSRMVLVNAVHFKGTWTYQFDPSLTRPFPFWLSETESR 200

Query:   295 QVPLMFVKDSFYMYEEAGEDGFKMLELPYGVS 326
              VP+M +K  F  +    E GF  LEL YG S
Sbjct:   201 DVPMMNIKKHF-AFNNFEELGFSALELTYGGS 231




GO:0004867 "serine-type endopeptidase inhibitor activity" evidence=ISS
GO:0010951 "negative regulation of endopeptidase activity" evidence=ISS
GO:0030162 "regulation of proteolysis" evidence=ISS
FB|FBgn0024294 Spn43Aa "Serpin 43Aa" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|619896 Serpini1 "serpin peptidase inhibitor, clade I (neuroserpin), member 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RLA3 SERPINI1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q99574 SERPINI1 "Neuroserpin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SH33 SERPINI1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BCA5 SERPINI1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1194506 Serpini1 "serine (or cysteine) peptidase inhibitor, clade I, member 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
MGI|MGI:2182838 Serpina3f "serine (or cysteine) peptidase inhibitor, clade A, member 3F" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q90935 SERPINI1 "Neuroserpin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query342
pfam00079 369 pfam00079, Serpin, Serpin (serine protease inhibit 6e-72
cd00172 364 cd00172, SERPIN, SERine Proteinase INhibitors (ser 6e-69
smart00093 359 smart00093, SERPIN, SERine Proteinase INhibitors 6e-56
cd02049 364 cd02049, bacterial_SERPIN, SERine Proteinase INhib 5e-44
cd02043 381 cd02043, plant_SERPIN, SERine Proteinase INhibitor 8e-41
cd02048 388 cd02048, neuroserpin, Neuroserpin is a inhibitory 7e-39
cd02051 377 cd02051, PAI-1_nexin-1, Plasminogen activator inhi 9e-39
cd02058 380 cd02058, PAI-2, Plasminogen Activator Inhibitor-2 6e-38
cd02059 389 cd02059, ovalbumin_like, The ovalbumin_like group 4e-31
cd02056 361 cd02056, alpha-1-antitrypsin_like, alpha-1-antitry 4e-31
cd02044 370 cd02044, ov-serpin, ovalbumin family of serpins (o 3e-30
COG4826 410 COG4826, COG4826, Serine protease inhibitor [Postt 3e-30
cd02045 381 cd02045, antithrombin-III_like, Antithrombin is a 6e-29
cd02055 365 cd02055, PZI, Protein Z-dependent protease inhibit 3e-22
cd02050 352 cd02050, C1_inh, C1 inhibitor (C1-Inh) is a protea 5e-19
cd02053 351 cd02053, alpha2AP, Alpha2-antiplasmin (alpha2AP) i 7e-18
cd02052 374 cd02052, PEDF, Pigment epithelium-derived factor ( 6e-17
cd02057 372 cd02057, maspin_like, Maspin (mammary serine prote 1e-16
cd02047 436 cd02047, HCII, Heparin cofactor II (HCII) inhibits 7e-14
cd02046 366 cd02046, hsp47, Heat shock protein 47 (Hsp47), als 8e-13
cd02054 372 cd02054, angiotensinogen, Angiotensinogen is part 4e-12
PHA02948 373 PHA02948, PHA02948, serine protease inhibitor-like 5e-04
>gnl|CDD|215699 pfam00079, Serpin, Serpin (serine protease inhibitor) Back     alignment and domain information
 Score =  227 bits (581), Expect = 6e-72
 Identities = 83/219 (37%), Positives = 125/219 (57%), Gaps = 11/219 (5%)

Query: 115 AANKKENAIISPFSLHVVLGLASFGAAGSTAEAMMKGLRIKHS--ETLLKDYKGIIDQLS 172
             +  +N   SP S+   L +   GA G TAE ++  L       E + + ++ ++  L+
Sbjct: 16  KESPDKNIFFSPLSISTALAMLYLGARGETAEQLLSVLGFPELDDEEIHEGFQSLLSSLN 75

Query: 173 KDYKGIIDQLSKSPELKIANKIYFAKDIELNPAYQTQAVDNFNSELGKVDFSQPPAAAKE 232
           K  KG          LKIAN+++  K ++L P +       + +E+  VDFS P  A K+
Sbjct: 76  KPDKG--------YTLKIANRLFVDKGLKLKPDFLQLLKKYYGAEVESVDFSDPAEARKQ 127

Query: 233 MNDWVSNHTNDKIKDLIKADSLDASTKLVLINAIHFKGKWTVPFKPEATKDGPFYLDDTN 292
           +N WV   TN KIKDL+   SLD  T+LVL+NAI+FKGKW  PF PE TK+ PF++D+  
Sbjct: 128 INSWVEKKTNGKIKDLLPEGSLDPDTRLVLVNAIYFKGKWKTPFDPELTKEEPFHVDNGT 187

Query: 293 SVQVPLMFVKDSFYMYEEAGEDGFKMLELPYGVSISFII 331
           +V+VP+M  + +F   E+  E G K+LELPY  ++S +I
Sbjct: 188 TVKVPMMSQEGTFRYAEDE-ELGCKVLELPYKGNLSMLI 225


Structure is a multi-domain fold containing a bundle of helices and a beta sandwich. Length = 369

>gnl|CDD|238101 cd00172, SERPIN, SERine Proteinase INhibitors (serpins) exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms Back     alignment and domain information
>gnl|CDD|214513 smart00093, SERPIN, SERine Proteinase INhibitors Back     alignment and domain information
>gnl|CDD|239004 cd02049, bacterial_SERPIN, SERine Proteinase INhibitors (serpins), prokaryotic subgroup Back     alignment and domain information
>gnl|CDD|238998 cd02043, plant_SERPIN, SERine Proteinase INhibitors (serpins), plant specific subgroup Back     alignment and domain information
>gnl|CDD|239003 cd02048, neuroserpin, Neuroserpin is a inhibitory member of the SERine Proteinase INhibitor (serpin) family that reacts preferentially with tissue-type plasminogen activator (tPA) Back     alignment and domain information
>gnl|CDD|239006 cd02051, PAI-1_nexin-1, Plasminogen activator inhibitor-1_like Back     alignment and domain information
>gnl|CDD|239013 cd02058, PAI-2, Plasminogen Activator Inhibitor-2 (PAI-2) Back     alignment and domain information
>gnl|CDD|239014 cd02059, ovalbumin_like, The ovalbumin_like group of serpins contains ovalbumin, the squamous cell carcinoma antigen 1 (SCCA1) and other closely related serpins of clade B of the serpin superfamily Back     alignment and domain information
>gnl|CDD|239011 cd02056, alpha-1-antitrypsin_like, alpha-1-antitrypsin_like Back     alignment and domain information
>gnl|CDD|238999 cd02044, ov-serpin, ovalbumin family of serpins (ov-serpins) Back     alignment and domain information
>gnl|CDD|227163 COG4826, COG4826, Serine protease inhibitor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|239000 cd02045, antithrombin-III_like, Antithrombin is a serine proteinase inhibitor (serpin) which controls the process of coagulation Back     alignment and domain information
>gnl|CDD|239010 cd02055, PZI, Protein Z-dependent protease inhibitor (ZPI) is a member of the serpin superfamily of proteinase inhibitors (clade A10) Back     alignment and domain information
>gnl|CDD|239005 cd02050, C1_inh, C1 inhibitor (C1-Inh) is a protease inhibitor of the serpin family Back     alignment and domain information
>gnl|CDD|239008 cd02053, alpha2AP, Alpha2-antiplasmin (alpha2AP) is the primary inhibitor of plasmin, a proteinase that digests fibrin, the main component of blood clots Back     alignment and domain information
>gnl|CDD|239007 cd02052, PEDF, Pigment epithelium-derived factor (PEDF)_like Back     alignment and domain information
>gnl|CDD|239012 cd02057, maspin_like, Maspin (mammary serine proteinase inhibitor), a member of the serpin superfamily, with a multitude of effects on cells and tissues at an assortment of developmental stages Back     alignment and domain information
>gnl|CDD|239002 cd02047, HCII, Heparin cofactor II (HCII) inhibits thrombin, the final protease of the coagulation cascade Back     alignment and domain information
>gnl|CDD|239001 cd02046, hsp47, Heat shock protein 47 (Hsp47), also called colligin, because of its collagen binding ability, is a chaperone specific for procollagen Back     alignment and domain information
>gnl|CDD|239009 cd02054, angiotensinogen, Angiotensinogen is part of the renin-angiotensin system (RAS), which plays an important role in blood pressure regulation, renal haemodynamics, fluid and electrolyte homeostasis Back     alignment and domain information
>gnl|CDD|165258 PHA02948, PHA02948, serine protease inhibitor-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 342
cd02057 372 maspin_like Maspin (mammary serine proteinase inhi 100.0
cd02048 388 neuroserpin Neuroserpin is a inhibitory member of 100.0
cd00172 364 SERPIN SERine Proteinase INhibitors (serpins) exhi 100.0
COG4826 410 Serine protease inhibitor [Posttranslational modif 100.0
cd02044 370 ov-serpin ovalbumin family of serpins (ov-serpins) 100.0
cd02054 372 angiotensinogen Angiotensinogen is part of the ren 100.0
cd02046 366 hsp47 Heat shock protein 47 (Hsp47), also called c 100.0
cd02059 389 ovalbumin_like The ovalbumin_like group of serpins 100.0
cd02058 380 PAI-2 Plasminogen Activator Inhibitor-2 (PAI-2). P 100.0
cd02056 361 alpha-1-antitrypsin_like alpha-1-antitrypsin_like. 100.0
cd02045 381 antithrombin-III_like Antithrombin is a serine pro 100.0
cd02051 377 PAI-1_nexin-1 Plasminogen activator inhibitor-1_li 100.0
KOG2392|consensus 380 100.0
cd02052 374 PEDF Pigment epithelium-derived factor (PEDF)_like 100.0
cd02049 364 bacterial_SERPIN SERine Proteinase INhibitors (ser 100.0
cd02055 365 PZI Protein Z-dependent protease inhibitor (ZPI) i 100.0
smart00093 359 SERPIN SERine Proteinase INhibitors. 100.0
PF00079 371 Serpin: Serpin (serine protease inhibitor); InterP 100.0
cd02047 436 HCII Heparin cofactor II (HCII) inhibits thrombin, 100.0
cd02043 381 plant_SERPIN SERine Proteinase INhibitors (serpins 100.0
PHA02948 373 serine protease inhibitor-like protein; Provisiona 100.0
cd02053 351 alpha2AP Alpha2-antiplasmin (alpha2AP) is the prim 100.0
cd02050 352 C1_inh C1 inhibitor (C1-Inh) is a protease inhibit 100.0
PHA02660 364 serpin-like protein; Provisional 100.0
>cd02057 maspin_like Maspin (mammary serine proteinase inhibitor), a member of the serpin superfamily, with a multitude of effects on cells and tissues at an assortment of developmental stages Back     alignment and domain information
Probab=100.00  E-value=1.5e-48  Score=383.20  Aligned_cols=220  Identities=26%  Similarity=0.482  Sum_probs=204.1

Q ss_pred             cccccccccccCCcchhhhhhhhhhhhhcc-CCCCEEEChhhHHHHHHHHHccCChhHHHHHHHHcCCCCcccchhcccc
Q psy2651          88 RFNGKLHKKEDFKPFSIQLSTLVEWNLAAN-KKENAIISPFSLHVVLGLASFGAAGSTAEAMMKGLRIKHSETLLKDYKG  166 (342)
Q Consensus        88 ~Fa~~L~~~~~~~~~~~~~~~~~~~~l~~~-~~~Niv~SP~sI~~aLamL~~GA~G~T~~qL~~~Lgl~~~~~~~~~~~~  166 (342)
                      +||++||+                 ++... +++|+|+||+||+.+|+||+.||+|+|++||.++||++...  +     
T Consensus         7 ~F~~~l~~-----------------~~~~~~~~~Nvv~SP~si~~aL~ml~~Ga~g~T~~el~~~L~~~~~~--~-----   62 (372)
T cd02057           7 AFAVDLFK-----------------KLCEKEPTGNVVFSPICLSTSLALAQVGAKGDTANEIGKVLHFENVK--D-----   62 (372)
T ss_pred             HHHHHHHH-----------------HHhccCCCCcEEECHHHHHHHHHHHHhhcCCcHHHHHHHHhCCCChh--H-----
Confidence            89999999                 88765 78999999999999999999999999999999999997433  3     


Q ss_pred             hhHHHHHHHHHHHHHhCCCc---chhhhhhhhhccCcccchHHHHHhhhhcccccEEecCCCc-HHHHHhhchhhhcccC
Q psy2651         167 IIDQLSKDYKGIIDQLSKSP---ELKIANKIYFAKDIELNPAYQTQAVDNFNSELGKVDFSQP-PAAAKEMNDWVSNHTN  242 (342)
Q Consensus       167 ~~~~v~~~~~~l~~~l~~~~---~l~~an~lfv~~~~~l~~~F~~~~~~~y~a~v~~vdF~~~-~~a~~~IN~WV~~~T~  242 (342)
                          ++..++.+...+.+..   .++++|++|++++++++++|.+.++++|+++++.+||.+. ..+++.||+||+++|+
T Consensus        63 ----~~~~~~~~~~~~~~~~~~~~l~~an~l~v~~~~~~~~~f~~~~~~~y~~~~~~vdF~~~~~~a~~~IN~wv~~~T~  138 (372)
T cd02057          63 ----VPFGFQTVTSDVSKLSSFYSLKLIKRLYVDKSLNLSTDFINSTKRPYPKELETVDFKDKLEETRGQINNSIKELTD  138 (372)
T ss_pred             ----HHHHHHHHHHHHhcCCccchhHhhhhhhhhCCCCccHHHHHHHHHHhcCeeEEecCCCCHHHHHHHHHHHHHHhcc
Confidence                6777888877765432   7999999999999999999999999999999999999765 5688999999999999


Q ss_pred             CccccCCCCCCCCcccceeeeeeccccccccccCCCCCCcccCeeecCCCeEEEeeeeecceeeeEEEeCCCCeEEEEEe
Q psy2651         243 DKIKDLIKADSLDASTKLVLINAIHFKGKWTVPFKPEATKDGPFYLDDTNSVQVPLMFVKDSFYMYEEAGEDGFKMLELP  322 (342)
Q Consensus       243 g~I~~ll~~~~i~~~t~lvLvNaiyFkg~W~~~F~~~~T~~~~F~~~~g~~~~VpMM~~~~~~f~y~~~~~l~~~vLELP  322 (342)
                      |+|++++++++++++|+++|+||+||||.|+++|++..|++++||.++|+.++||||++.+. |+|+++++++++|||||
T Consensus       139 g~I~~l~~~~~i~~~t~l~lvNa~yFkg~W~~~F~~~~T~~~~F~~~~~~~~~V~mM~~~~~-~~~~~~~~~~~~vv~LP  217 (372)
T cd02057         139 GHFENILNENSVNDQTKILVVNAAYFVGNWMKKFPESETKECPFRVNKTETKPVQMMNLEAT-FSMGYIDELNTKILELP  217 (372)
T ss_pred             ChhhhcCCCCCCCCCCceeeeehheeccccCCCCCccccccCCCEECCCceEeeEhhheece-EEeEEeCCcCceEEEee
Confidence            99999999889999999999999999999999999999999999999999999999999998 99999999999999999


Q ss_pred             C-CCcEEEEEeecCCCCC
Q psy2651         323 Y-GVSISFIIKSQVVPEM  339 (342)
Q Consensus       323 Y-~~~~SMlI~~~ILP~~  339 (342)
                      | ++++||+|   |||++
T Consensus       218 y~~~~~sm~i---iLP~~  232 (372)
T cd02057         218 FQNKHLSMLI---LLPKD  232 (372)
T ss_pred             cCCCCEEEEE---EecCc
Confidence            9 99999999   89985



Maspin has tumor suppressing activity against breast and prostate cancer. In general, SERine Proteinase INhibitors (serpins) exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms. Many serpins, such as antitrypsin and antichymotrypsin, function as serine protease inhibitors which regulate blood coagulation cascades. Non-inhibitory serpins perform many diverse functions such as chaperoning proteins or transporting hormones.

>cd02048 neuroserpin Neuroserpin is a inhibitory member of the SERine Proteinase INhibitor (serpin) family that reacts preferentially with tissue-type plasminogen activator (tPA) Back     alignment and domain information
>cd00172 SERPIN SERine Proteinase INhibitors (serpins) exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms Back     alignment and domain information
>COG4826 Serine protease inhibitor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02044 ov-serpin ovalbumin family of serpins (ov-serpins) Back     alignment and domain information
>cd02054 angiotensinogen Angiotensinogen is part of the renin-angiotensin system (RAS), which plays an important role in blood pressure regulation, renal haemodynamics, fluid and electrolyte homeostasis Back     alignment and domain information
>cd02046 hsp47 Heat shock protein 47 (Hsp47), also called colligin, because of its collagen binding ability, is a chaperone specific for procollagen Back     alignment and domain information
>cd02059 ovalbumin_like The ovalbumin_like group of serpins contains ovalbumin, the squamous cell carcinoma antigen 1 (SCCA1) and other closely related serpins of clade B of the serpin superfamily Back     alignment and domain information
>cd02058 PAI-2 Plasminogen Activator Inhibitor-2 (PAI-2) Back     alignment and domain information
>cd02056 alpha-1-antitrypsin_like alpha-1-antitrypsin_like Back     alignment and domain information
>cd02045 antithrombin-III_like Antithrombin is a serine proteinase inhibitor (serpin) which controls the process of coagulation Back     alignment and domain information
>cd02051 PAI-1_nexin-1 Plasminogen activator inhibitor-1_like Back     alignment and domain information
>KOG2392|consensus Back     alignment and domain information
>cd02052 PEDF Pigment epithelium-derived factor (PEDF)_like Back     alignment and domain information
>cd02049 bacterial_SERPIN SERine Proteinase INhibitors (serpins), prokaryotic subgroup Back     alignment and domain information
>cd02055 PZI Protein Z-dependent protease inhibitor (ZPI) is a member of the serpin superfamily of proteinase inhibitors (clade A10) Back     alignment and domain information
>smart00093 SERPIN SERine Proteinase INhibitors Back     alignment and domain information
>PF00079 Serpin: Serpin (serine protease inhibitor); InterPro: IPR023796 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively Back     alignment and domain information
>cd02047 HCII Heparin cofactor II (HCII) inhibits thrombin, the final protease of the coagulation cascade Back     alignment and domain information
>cd02043 plant_SERPIN SERine Proteinase INhibitors (serpins), plant specific subgroup Back     alignment and domain information
>PHA02948 serine protease inhibitor-like protein; Provisional Back     alignment and domain information
>cd02053 alpha2AP Alpha2-antiplasmin (alpha2AP) is the primary inhibitor of plasmin, a proteinase that digests fibrin, the main component of blood clots Back     alignment and domain information
>cd02050 C1_inh C1 inhibitor (C1-Inh) is a protease inhibitor of the serpin family Back     alignment and domain information
>PHA02660 serpin-like protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query342
3f5n_A 407 Structure Of Native Human Neuroserpin Length = 407 9e-31
3fgq_A 397 Crystal Structure Of Native Human Neuroserpin Lengt 1e-30
3f02_A359 Cleaved Human Neuroserpin Length = 359 1e-30
2dut_A 423 Crystal Structure Of A M-Loop Deletion Variant Of M 9e-29
2h4q_A 382 Crystal Structure Of A M-Loop Deletion Variant Of M 1e-28
1sek_A 378 The Structure Of Active Serpin K From Manduca Sexta 3e-28
1k9o_I 378 Crystal Structure Of Michaelis Serpin-Trypsin Compl 8e-28
3ozq_A 376 Crystal Structure Of Serpin48, Which Is A Highly Sp 1e-27
2h4r_A 415 Crystal Structure Of Wildtype Ment In The Native Co 1e-25
2h4p_A 394 Crystal Structure Of Wildtype Ment In The Cleaved C 2e-25
1hle_A 345 Crystal Structure Of Cleaved Equine Leucocyte Elast 8e-25
3lw2_A 379 Mouse Plasminogen Activator Inhibitor-1 (Pai-1) Len 8e-25
1jjo_C261 Crystal Structure Of Mouse Neuroserpin (Cleaved For 1e-24
3le2_A 393 Structure Of Arabidopsis Atserpin1. Native Stressed 2e-24
1c5g_A 402 Plasminogen Activator Inhibitor-1 Length = 402 6e-24
1dvn_A 379 Latent Form Of Plasminogen Activator Inhibitor-1 (P 7e-24
9pai_A346 Cleaved Substrate Variant Of Plasminogen Activator 7e-24
1a7c_A 379 Human Plasminogen Activator Inhibitor Type-1 In Com 7e-24
4aqh_A 383 Plasminogen Activator Inhibitor Type-1 In Complex W 8e-24
1b3k_A 379 Plasminogen Activator Inhibitor-1 Length = 379 8e-24
3eox_A 379 High Quality Structure Of Cleaved Pai-1-Stab Length 8e-24
3ut3_A 375 A Novel Pai-i Inhibitor And Its Structural Mechanis 9e-24
1db2_A 377 Crystal Structure Of Native Plasminogen Activator I 9e-24
3cvm_A 392 High Resolution Structure Of A Stable Plasminogen A 9e-24
3r4l_A 379 Human Very Long Half Life Plasminogen Activator Inh 2e-23
4dy0_A 379 Crystal Structure Of Native Protease Nexin-1 With H 2e-23
1yxa_A 398 Serpina3n, A Murine Orthologue Of Human Antichymotr 4e-23
1dvm_A 379 Active Form Of Human Pai-1 Length = 379 4e-23
4ga7_A 389 Crystal Structure Of Human Serpinb1 Mutant Length = 7e-23
3caa_A341 Cleaved Antichymotrypsin A347r Length = 341 7e-23
1as4_A341 Cleaved Antichymotrypsin A349r Length = 341 7e-23
4caa_A341 Cleaved Antichymotrypsin T345r Length = 341 8e-23
2ach_A360 Crystal Structure Of Cleaved Human Alpha1-antichymo 1e-22
3dlw_A 411 Antichymotrypsin Length = 411 1e-22
3q02_A 379 Crystal Structure Of Plasminogen Activator Inhibito 1e-22
3pzf_A 397 1.75a Resolution Structure Of Serpin-2 From Anophel 4e-22
1qmn_A 401 Alpha1-Antichymotrypsin Serpin In The Delta Conform 5e-22
4bb2_A340 Crystal Structure Of Cleaved Corticosteroid-binding 5e-21
2vdx_A 373 Crystal Structure Of The Reactive Loop Cleaved Cort 1e-20
3nda_A 377 Crystal Structure Of Serpin From Tick Ixodes Ricinu 2e-20
2zv6_A 401 Crystal Structure Of Human Squamous Cell Carcinoma 3e-20
3vvj_A 392 Structure Of Ovalbumin From Emu (Dromaius Novaeholl 4e-20
1att_A 429 Crystal Structure Of Cleaved Bovine Antithrombin Ii 3e-19
2b4x_L 427 Crystal Structure Of Antithrombin-Iii Length = 427 4e-19
2hij_I 432 Crystal Structure Of P14 Alanine Variant Of Antithr 5e-19
1ath_A 432 The Intact And Cleaved Human Antithrombin Iii Compl 5e-19
1dzg_I 432 N135q-S380c-Antithrombin-Iii Length = 432 6e-19
1dzh_I 432 P14-Fluorescein-N135q-S380c-Antithrombin-Iii Length 7e-19
2gd4_I 443 Crystal Structure Of The Antithrombin-S195a Factor 8e-19
1by7_A 382 Human Plasminogen Activator Inhibitor-2. Loop (66-9 8e-19
1tb6_I 432 2.5a Crystal Structure Of The Antithrombin-Thrombin 9e-19
1oyh_I 432 Crystal Structure Of P13 Alanine Variant Of Antithr 1e-18
3kcg_I 432 Crystal Structure Of The Antithrombin-Factor Ixa- P 1e-18
2b4x_I 427 Crystal Structure Of Antithrombin-Iii Length = 427 2e-18
4if8_A 414 Structure Of Vaspin Length = 414 2e-18
3f1s_A 385 Crystal Structure Of Protein Z Complexed With Prote 2e-18
3h5c_A 423 X-Ray Structure Of Protein Z-Protein Z Inhibitor Co 2e-18
4afx_A387 Crystal Structure Of The Reactive Loop Cleaved Zpi 3e-18
2xn6_A350 Crystal Structure Of Thyroxine-Binding Globulin Com 3e-18
2arq_A 382 Human Plasminogen Activator Inhibitor-2.[loop (66-9 3e-18
2riw_A338 The Reactive Loop Cleaved Human Thyroxine Binding G 7e-18
2ceo_A 379 Thyroxine-Binding Globulin Complex With Thyroxine L 8e-18
2riv_A343 Crystal Structure Of The Reactive Loop Cleaved Huma 9e-18
2xn5_A350 Crystal Structure Of Thyroxine-Binding Globulin Com 9e-18
1atu_A 374 Uncleaved Alpha-1-Antitrypsin Length = 374 2e-17
4eb1_I 440 Hyperstable In-Frame Insertion Variant Of Antithrom 2e-17
2d26_A358 Active Site Distortion Is Sufficient For Proteinase 3e-17
1iz2_A 394 Interactions Causing The Kinetic Trap In Serpin Pro 3e-17
1oo8_A 394 Crystal Structure Of A1pi-Pittsburgh In The Native 4e-17
1kct_A 394 Alpha1-Antitrypsin Length = 394 6e-17
1qmb_A326 Cleaved Alpha-1-Antitrypsin Polymer Length = 326 8e-17
1hp7_A 394 A 2.1 Angstrom Structure Of An Uncleaved Alpha-1-An 2e-16
1ova_B 386 Crystal Structure Of Uncleaved Ovalbumin At 1.95 An 2e-16
1ova_C 386 Crystal Structure Of Uncleaved Ovalbumin At 1.95 An 2e-16
1ova_A 386 Crystal Structure Of Uncleaved Ovalbumin At 1.95 An 2e-16
2v95_A 371 Struture Of Corticosteroid-Binding Globulin In Comp 2e-16
1jti_A 385 Loop-Inserted Structure Of P1-P1' Cleaved Ovalbumin 2e-16
1uhg_A 385 Crystal Structure Of S-ovalbumin At 1.9 Angstrom Re 2e-16
1d5s_A334 Crystal Structure Of Cleaved Antitrypsin Polymer Le 4e-16
1ezx_A335 Crystal Structure Of A Serpin:protease Complex Leng 4e-16
7api_A347 The S Variant Of Human Alpha1-Antitrypsin, Structur 5e-16
2hi9_A 363 Crystal Structure Of Human Native Protein C Inhibit 5e-16
3dy0_A336 Crystal Structure Of Cleaved Pci Bound To Heparin L 5e-16
1lq8_A346 Crystal Structure Of Cleaved Protein C Inhibitor Le 5e-16
3ndf_A343 Cleaved Antitrypsin With P8-P6 Asp Length = 343 5e-16
2ol2_A 395 High Resolution Structure Of Native Pci In Space Gr 6e-16
3t1p_A 371 Crystal Structure Of An Alpha-1-Antitrypsin Trimer 6e-16
3ndd_A343 Cleaved Antitrypsin With P10 Pro, And P9-P6 Asp Len 6e-16
1psi_A 394 Intact Recombined Alpha1-Antitrypsin Mutant Phe 51 6e-16
3drm_A 404 2.2 Angstrom Crystal Structure Of Thr114phe Alpha1- 8e-16
3ne4_A 424 1.8 Angstrom Structure Of Intact Native Wild-Type A 8e-16
1qlp_A 394 2.0 Angstrom Structure Of Intact Alpha-1-Antitrypsi 9e-16
2qug_A 394 Crystal Structure Of Alpha-1-Antitrypsin, Crystal F 1e-15
3dru_A 404 Crystal Structure Of Gly117phe Alpha1-Antitrypsin L 2e-15
1xu8_A 380 The 2.8 A Structure Of A Tumour Suppressing Serpin 7e-15
1wz9_A 375 The 2.1 A Structure Of A Tumour Suppressing Serpin 1e-14
1xqg_A 389 3.10 A Crystal Structure Of Maspin, Space Group P 4 2e-14
1f0c_A305 Structure Of The Viral Serpin Crma Length = 305 6e-14
4ajt_A 427 The Cystal Structure Of Mouse Protein-Z Dependent P 8e-14
1c8o_A300 2.9 A Structure Of Cleaved Viral Serpin Crma Length 1e-13
1jmo_A 480 Crystal Structure Of The Heparin Cofactor Ii-S195a 7e-13
1jmj_A 480 Crystal Structure Of Native Heparin Cofactor Ii Len 1e-12
3sto_A 406 Serpin From The Trematode Schistosoma Haematobium L 5e-12
1imv_A 398 2.85 A Crystal Structure Of Pedf Length = 398 6e-11
2r9y_A 430 Structure Of Antiplasmin Length = 430 8e-11
4au2_A 392 Crystal Structure Of A Hsp47-Collagen Complex Lengt 8e-11
2oay_A 390 Crystal Structure Of Latent Human C1-Inhibitor Leng 2e-10
4au3_A 392 Crystal Structure Of A Hsp47-Collagen Complex Lengt 5e-09
4au3_B 392 Crystal Structure Of A Hsp47-Collagen Complex Lengt 5e-09
1m93_B245 1.65 A Structure Of Cleaved Viral Serpin Crma Lengt 9e-09
2pef_A 373 Crystal Structure Of A Thermophilic Serpin, Tengpin 2e-07
2pee_A 387 Crystal Structure Of A Thermophilic Serpin, Tengpin 2e-07
2vh4_A 381 Structure Of A Loop C-sheet Serpin Polymer Length = 2e-07
1mtp_A323 The X-Ray Crystal Structure Of A Serpin From A Ther 4e-07
1sng_A 370 Structure Of A Thermophilic Serpin In The Native St 1e-06
>pdb|3F5N|A Chain A, Structure Of Native Human Neuroserpin Length = 407 Back     alignment and structure

Iteration: 1

Score = 130 bits (328), Expect = 9e-31, Method: Compositional matrix adjust. Identities = 77/232 (33%), Positives = 119/232 (51%), Gaps = 16/232 (6%) Query: 115 AANKKENAIISPFSLHVVLGLASFGAAGSTAEAMMKGLRIKHSETLLKDYKGIIDQLSKD 174 A + EN + SP S+ + +G+ GA GST + I+HS G K+ Sbjct: 36 ATGEDENILFSPLSIALAMGMMELGAQGSTQK------EIRHSMGYDSLKNGEEFSFLKE 89 Query: 175 YKGIIDQLSKSPELKIANKIYFAKDIELNPAYQTQAVDNFNSELGKVDFSQPPAAAKEMN 234 + ++ +KIAN ++ +N + FN+ + VDFSQ A A +N Sbjct: 90 FSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYIN 149 Query: 235 DWVSNHTNDKIKDLIKADSLDASTKLVLINAIHFKGKWTVPFKPEATKDGPFYLDDTNSV 294 WV N+TN+ +KDL+ DA+T L LINA++FKG W F+PE T+ F DD + V Sbjct: 150 KWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEV 209 Query: 295 QVPLMFVKDSFYMYE------EAGEDGFKMLELPY---GVSISFIIKSQVVP 337 Q+P+M+ + FY E EAG +++LE+PY +S+ ++ Q VP Sbjct: 210 QIPMMYQQGEFYYGEFSDGSNEAG-GIYQVLEIPYEGDEISMMLVLSRQEVP 260
>pdb|3FGQ|A Chain A, Crystal Structure Of Native Human Neuroserpin Length = 397 Back     alignment and structure
>pdb|3F02|A Chain A, Cleaved Human Neuroserpin Length = 359 Back     alignment and structure
>pdb|2DUT|A Chain A, Crystal Structure Of A M-Loop Deletion Variant Of Ment In The Native Conformation Length = 423 Back     alignment and structure
>pdb|2H4Q|A Chain A, Crystal Structure Of A M-Loop Deletion Variant Of Ment In The Cleaved Conformation Length = 382 Back     alignment and structure
>pdb|1SEK|A Chain A, The Structure Of Active Serpin K From Manduca Sexta And A Model For Serpin-Protease Complex Formation Length = 378 Back     alignment and structure
>pdb|1K9O|I Chain I, Crystal Structure Of Michaelis Serpin-Trypsin Complex Length = 378 Back     alignment and structure
>pdb|3OZQ|A Chain A, Crystal Structure Of Serpin48, Which Is A Highly Specific Serpin In The Insect Tenebrio Molitor Length = 376 Back     alignment and structure
>pdb|2H4R|A Chain A, Crystal Structure Of Wildtype Ment In The Native Conformation Length = 415 Back     alignment and structure
>pdb|2H4P|A Chain A, Crystal Structure Of Wildtype Ment In The Cleaved Conformation Length = 394 Back     alignment and structure
>pdb|1HLE|A Chain A, Crystal Structure Of Cleaved Equine Leucocyte Elastase Inhibitor Determined At 1.95 Angstroms Resolution Length = 345 Back     alignment and structure
>pdb|3LW2|A Chain A, Mouse Plasminogen Activator Inhibitor-1 (Pai-1) Length = 379 Back     alignment and structure
>pdb|1JJO|C Chain C, Crystal Structure Of Mouse Neuroserpin (Cleaved Form) Length = 261 Back     alignment and structure
>pdb|3LE2|A Chain A, Structure Of Arabidopsis Atserpin1. Native Stressed Conforma Length = 393 Back     alignment and structure
>pdb|1C5G|A Chain A, Plasminogen Activator Inhibitor-1 Length = 402 Back     alignment and structure
>pdb|1DVN|A Chain A, Latent Form Of Plasminogen Activator Inhibitor-1 (Pai-1) Length = 379 Back     alignment and structure
>pdb|9PAI|A Chain A, Cleaved Substrate Variant Of Plasminogen Activator Inhibitor-1 Length = 346 Back     alignment and structure
>pdb|1A7C|A Chain A, Human Plasminogen Activator Inhibitor Type-1 In Complex With A Pentapeptide Length = 379 Back     alignment and structure
>pdb|4AQH|A Chain A, Plasminogen Activator Inhibitor Type-1 In Complex With The Inhibitor Az3976 Length = 383 Back     alignment and structure
>pdb|1B3K|A Chain A, Plasminogen Activator Inhibitor-1 Length = 379 Back     alignment and structure
>pdb|3EOX|A Chain A, High Quality Structure Of Cleaved Pai-1-Stab Length = 379 Back     alignment and structure
>pdb|3UT3|A Chain A, A Novel Pai-i Inhibitor And Its Structural Mechanism Length = 375 Back     alignment and structure
>pdb|1DB2|A Chain A, Crystal Structure Of Native Plasminogen Activator Inhibitor- 1 Length = 377 Back     alignment and structure
>pdb|3CVM|A Chain A, High Resolution Structure Of A Stable Plasminogen Activator Inhibitor Type-1 In Its Protease Cleaved Form Length = 392 Back     alignment and structure
>pdb|3R4L|A Chain A, Human Very Long Half Life Plasminogen Activator Inhibitor Type-1 Length = 379 Back     alignment and structure
>pdb|4DY0|A Chain A, Crystal Structure Of Native Protease Nexin-1 With Heparin Length = 379 Back     alignment and structure
>pdb|1YXA|A Chain A, Serpina3n, A Murine Orthologue Of Human Antichymotrypsin Length = 398 Back     alignment and structure
>pdb|1DVM|A Chain A, Active Form Of Human Pai-1 Length = 379 Back     alignment and structure
>pdb|4GA7|A Chain A, Crystal Structure Of Human Serpinb1 Mutant Length = 389 Back     alignment and structure
>pdb|3CAA|A Chain A, Cleaved Antichymotrypsin A347r Length = 341 Back     alignment and structure
>pdb|1AS4|A Chain A, Cleaved Antichymotrypsin A349r Length = 341 Back     alignment and structure
>pdb|4CAA|A Chain A, Cleaved Antichymotrypsin T345r Length = 341 Back     alignment and structure
>pdb|2ACH|A Chain A, Crystal Structure Of Cleaved Human Alpha1-antichymotrypsin At 2.7 Angstroms Resolution And Its Comparison With Other Serpins Length = 360 Back     alignment and structure
>pdb|3DLW|A Chain A, Antichymotrypsin Length = 411 Back     alignment and structure
>pdb|3Q02|A Chain A, Crystal Structure Of Plasminogen Activator Inhibitor-1 In A Metastable Active Conformation. Length = 379 Back     alignment and structure
>pdb|3PZF|A Chain A, 1.75a Resolution Structure Of Serpin-2 From Anopheles Gambiae Length = 397 Back     alignment and structure
>pdb|1QMN|A Chain A, Alpha1-Antichymotrypsin Serpin In The Delta Conformation (Partial Loop Insertion) Length = 401 Back     alignment and structure
>pdb|4BB2|A Chain A, Crystal Structure Of Cleaved Corticosteroid-binding Globulin In Complex With Progesterone Length = 340 Back     alignment and structure
>pdb|2VDX|A Chain A, Crystal Structure Of The Reactive Loop Cleaved Corticosteroid Binding Globulin Length = 373 Back     alignment and structure
>pdb|3NDA|A Chain A, Crystal Structure Of Serpin From Tick Ixodes Ricinus Length = 377 Back     alignment and structure
>pdb|2ZV6|A Chain A, Crystal Structure Of Human Squamous Cell Carcinoma Antigen 1 Length = 401 Back     alignment and structure
>pdb|3VVJ|A Chain A, Structure Of Ovalbumin From Emu (Dromaius Novaehollandiae) Length = 392 Back     alignment and structure
>pdb|1ATT|A Chain A, Crystal Structure Of Cleaved Bovine Antithrombin Iii At 3.2 Angstroms Resolution Length = 429 Back     alignment and structure
>pdb|2B4X|L Chain L, Crystal Structure Of Antithrombin-Iii Length = 427 Back     alignment and structure
>pdb|2HIJ|I Chain I, Crystal Structure Of P14 Alanine Variant Of Antithrombin Length = 432 Back     alignment and structure
>pdb|1ATH|A Chain A, The Intact And Cleaved Human Antithrombin Iii Complex As A Model For Serpin-Proteinase Interactions Length = 432 Back     alignment and structure
>pdb|1DZG|I Chain I, N135q-S380c-Antithrombin-Iii Length = 432 Back     alignment and structure
>pdb|1DZH|I Chain I, P14-Fluorescein-N135q-S380c-Antithrombin-Iii Length = 432 Back     alignment and structure
>pdb|2GD4|I Chain I, Crystal Structure Of The Antithrombin-S195a Factor Xa-Pentasaccharide Complex Length = 443 Back     alignment and structure
>pdb|1BY7|A Chain A, Human Plasminogen Activator Inhibitor-2. Loop (66-98) Deletion Mutant Length = 382 Back     alignment and structure
>pdb|1TB6|I Chain I, 2.5a Crystal Structure Of The Antithrombin-Thrombin-Heparin Ternary Complex Length = 432 Back     alignment and structure
>pdb|1OYH|I Chain I, Crystal Structure Of P13 Alanine Variant Of Antithrombin Length = 432 Back     alignment and structure
>pdb|3KCG|I Chain I, Crystal Structure Of The Antithrombin-Factor Ixa- Pentasaccharide Complex Length = 432 Back     alignment and structure
>pdb|2B4X|I Chain I, Crystal Structure Of Antithrombin-Iii Length = 427 Back     alignment and structure
>pdb|4IF8|A Chain A, Structure Of Vaspin Length = 414 Back     alignment and structure
>pdb|3F1S|A Chain A, Crystal Structure Of Protein Z Complexed With Protein Z-Dependent Inhibitor Length = 385 Back     alignment and structure
>pdb|3H5C|A Chain A, X-Ray Structure Of Protein Z-Protein Z Inhibitor Complex Length = 423 Back     alignment and structure
>pdb|4AFX|A Chain A, Crystal Structure Of The Reactive Loop Cleaved Zpi In I2 Space Group Length = 387 Back     alignment and structure
>pdb|2XN6|A Chain A, Crystal Structure Of Thyroxine-Binding Globulin Complexed With Thyroxine-Fluoresein Length = 350 Back     alignment and structure
>pdb|2ARQ|A Chain A, Human Plasminogen Activator Inhibitor-2.[loop (66-98) Deletion Mutant] Complexed With Peptide N-Acetyl-Teaaagdggvmtgr-Oh Length = 382 Back     alignment and structure
>pdb|2RIW|A Chain A, The Reactive Loop Cleaved Human Thyroxine Binding Globulin Complexed With Thyroxine Length = 338 Back     alignment and structure
>pdb|2CEO|A Chain A, Thyroxine-Binding Globulin Complex With Thyroxine Length = 379 Back     alignment and structure
>pdb|2RIV|A Chain A, Crystal Structure Of The Reactive Loop Cleaved Human Thyroxine Binding Globulin Length = 343 Back     alignment and structure
>pdb|2XN5|A Chain A, Crystal Structure Of Thyroxine-Binding Globulin Complexed With Furosemide Length = 350 Back     alignment and structure
>pdb|1ATU|A Chain A, Uncleaved Alpha-1-Antitrypsin Length = 374 Back     alignment and structure
>pdb|4EB1|I Chain I, Hyperstable In-Frame Insertion Variant Of Antithrombin Length = 440 Back     alignment and structure
>pdb|2D26|A Chain A, Active Site Distortion Is Sufficient For Proteinase Inhibit Second Crystal Structure Of Covalent Serpin-Proteinase Complex Length = 358 Back     alignment and structure
>pdb|1IZ2|A Chain A, Interactions Causing The Kinetic Trap In Serpin Protein Folding Length = 394 Back     alignment and structure
>pdb|1OO8|A Chain A, Crystal Structure Of A1pi-Pittsburgh In The Native Conformation Length = 394 Back     alignment and structure
>pdb|1KCT|A Chain A, Alpha1-Antitrypsin Length = 394 Back     alignment and structure
>pdb|1QMB|A Chain A, Cleaved Alpha-1-Antitrypsin Polymer Length = 326 Back     alignment and structure
>pdb|1HP7|A Chain A, A 2.1 Angstrom Structure Of An Uncleaved Alpha-1-Antitrypsin Shows Variability Of The Reactive Center And Other Loops Length = 394 Back     alignment and structure
>pdb|1OVA|B Chain B, Crystal Structure Of Uncleaved Ovalbumin At 1.95 Angstroms Resolution Length = 386 Back     alignment and structure
>pdb|1OVA|C Chain C, Crystal Structure Of Uncleaved Ovalbumin At 1.95 Angstroms Resolution Length = 386 Back     alignment and structure
>pdb|1OVA|A Chain A, Crystal Structure Of Uncleaved Ovalbumin At 1.95 Angstroms Resolution Length = 386 Back     alignment and structure
>pdb|2V95|A Chain A, Struture Of Corticosteroid-Binding Globulin In Complex With Cortisol Length = 371 Back     alignment and structure
>pdb|1JTI|A Chain A, Loop-Inserted Structure Of P1-P1' Cleaved Ovalbumin Mutant R339t Length = 385 Back     alignment and structure
>pdb|1UHG|A Chain A, Crystal Structure Of S-ovalbumin At 1.9 Angstrom Resolution Length = 385 Back     alignment and structure
>pdb|1D5S|A Chain A, Crystal Structure Of Cleaved Antitrypsin Polymer Length = 334 Back     alignment and structure
>pdb|1EZX|A Chain A, Crystal Structure Of A Serpin:protease Complex Length = 335 Back     alignment and structure
>pdb|7API|A Chain A, The S Variant Of Human Alpha1-Antitrypsin, Structure And Implications For Function And Metabolism Length = 347 Back     alignment and structure
>pdb|2HI9|A Chain A, Crystal Structure Of Human Native Protein C Inhibitor Length = 363 Back     alignment and structure
>pdb|3DY0|A Chain A, Crystal Structure Of Cleaved Pci Bound To Heparin Length = 336 Back     alignment and structure
>pdb|1LQ8|A Chain A, Crystal Structure Of Cleaved Protein C Inhibitor Length = 346 Back     alignment and structure
>pdb|3NDF|A Chain A, Cleaved Antitrypsin With P8-P6 Asp Length = 343 Back     alignment and structure
>pdb|2OL2|A Chain A, High Resolution Structure Of Native Pci In Space Group P21 Length = 395 Back     alignment and structure
>pdb|3T1P|A Chain A, Crystal Structure Of An Alpha-1-Antitrypsin Trimer Length = 371 Back     alignment and structure
>pdb|3NDD|A Chain A, Cleaved Antitrypsin With P10 Pro, And P9-P6 Asp Length = 343 Back     alignment and structure
>pdb|1PSI|A Chain A, Intact Recombined Alpha1-Antitrypsin Mutant Phe 51 To Leu Length = 394 Back     alignment and structure
>pdb|3DRM|A Chain A, 2.2 Angstrom Crystal Structure Of Thr114phe Alpha1- Antitrypsin Length = 404 Back     alignment and structure
>pdb|3NE4|A Chain A, 1.8 Angstrom Structure Of Intact Native Wild-Type Alpha-1-Antitrypsin Length = 424 Back     alignment and structure
>pdb|1QLP|A Chain A, 2.0 Angstrom Structure Of Intact Alpha-1-Antitrypsin: A Canonical Template For Active Serpins Length = 394 Back     alignment and structure
>pdb|2QUG|A Chain A, Crystal Structure Of Alpha-1-Antitrypsin, Crystal Form A Length = 394 Back     alignment and structure
>pdb|3DRU|A Chain A, Crystal Structure Of Gly117phe Alpha1-Antitrypsin Length = 404 Back     alignment and structure
>pdb|1XU8|A Chain A, The 2.8 A Structure Of A Tumour Suppressing Serpin Length = 380 Back     alignment and structure
>pdb|1WZ9|A Chain A, The 2.1 A Structure Of A Tumour Suppressing Serpin Length = 375 Back     alignment and structure
>pdb|1XQG|A Chain A, 3.10 A Crystal Structure Of Maspin, Space Group P 4 21 2 Length = 389 Back     alignment and structure
>pdb|1F0C|A Chain A, Structure Of The Viral Serpin Crma Length = 305 Back     alignment and structure
>pdb|4AJT|A Chain A, The Cystal Structure Of Mouse Protein-Z Dependent Protease Inhibitor(Mzpi) Length = 427 Back     alignment and structure
>pdb|1C8O|A Chain A, 2.9 A Structure Of Cleaved Viral Serpin Crma Length = 300 Back     alignment and structure
>pdb|1JMO|A Chain A, Crystal Structure Of The Heparin Cofactor Ii-S195a Thrombin Complex Length = 480 Back     alignment and structure
>pdb|1JMJ|A Chain A, Crystal Structure Of Native Heparin Cofactor Ii Length = 480 Back     alignment and structure
>pdb|3STO|A Chain A, Serpin From The Trematode Schistosoma Haematobium Length = 406 Back     alignment and structure
>pdb|1IMV|A Chain A, 2.85 A Crystal Structure Of Pedf Length = 398 Back     alignment and structure
>pdb|2R9Y|A Chain A, Structure Of Antiplasmin Length = 430 Back     alignment and structure
>pdb|4AU2|A Chain A, Crystal Structure Of A Hsp47-Collagen Complex Length = 392 Back     alignment and structure
>pdb|2OAY|A Chain A, Crystal Structure Of Latent Human C1-Inhibitor Length = 390 Back     alignment and structure
>pdb|4AU3|A Chain A, Crystal Structure Of A Hsp47-Collagen Complex Length = 392 Back     alignment and structure
>pdb|4AU3|B Chain B, Crystal Structure Of A Hsp47-Collagen Complex Length = 392 Back     alignment and structure
>pdb|1M93|B Chain B, 1.65 A Structure Of Cleaved Viral Serpin Crma Length = 245 Back     alignment and structure
>pdb|2PEF|A Chain A, Crystal Structure Of A Thermophilic Serpin, Tengpin, In The Latent State Length = 373 Back     alignment and structure
>pdb|2PEE|A Chain A, Crystal Structure Of A Thermophilic Serpin, Tengpin, In The Native State Length = 387 Back     alignment and structure
>pdb|2VH4|A Chain A, Structure Of A Loop C-sheet Serpin Polymer Length = 381 Back     alignment and structure
>pdb|1MTP|A Chain A, The X-Ray Crystal Structure Of A Serpin From A Thermophilic Prokaryote Length = 323 Back     alignment and structure
>pdb|1SNG|A Chain A, Structure Of A Thermophilic Serpin In The Native State Length = 370 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query342
3ozq_A 376 Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molito 2e-76
1sek_A 378 Serpin K; serine protease inhibitor, protease; 2.1 1e-75
1wz9_A 375 Maspin precursor; serpin, tumor suppressor, serpin 2e-74
1lj5_A 379 Plasminogen activator inhibitor-1; beta-barrell, b 2e-74
3f5n_A 407 Neuroserpin; cleaved form, fenib, human, tissue PL 7e-73
3le2_A 393 Serpin-ZX; apoplast, glycoprotein, protease inhibi 9e-73
1hle_A 345 Horse leukocyte elastase inhibitor; hydrolase inhi 1e-72
3kcg_I 432 Antithrombin-III, ATIII; michaelis complex, blood 2e-72
3f02_A359 Neuroserpin; cleaved form, fenib, human, disease M 7e-72
3pzf_A 397 Serpin 2; protease inhibitor, melanization, hydrol 2e-71
3nda_A 377 Serpin-2; vaccination target, TICK, hydrolase inhi 2e-71
3f1s_A 385 Protein Z-dependent protease inhibitor; PZ, ZPI, c 5e-71
1mtp_A323 Serine proteinase inhibitor (serpin), chain A; str 7e-71
2arr_A 382 Plasminogen activator inhibitor-2; serpin, peptide 2e-70
1sng_A 370 COG4826: serine protease inhibitor; serine proteas 2e-70
2pef_A 373 Serine protease inhibitor; serpin; 1.60A {Thermoan 4e-70
4dy0_A 379 GLIA-derived nexin; serpin, protease inhibitor, th 5e-70
2h4r_A 415 MENT, heterochromatin-associated protein MENT; ser 1e-69
1yxa_A 398 Serine (OR cysteine) proteinase inhibitor, clade 3 2e-69
2h4p_A394 MENT, heterochromatin-associated protein MENT; ser 3e-69
1uhg_A 385 Ovalbumin, S-ovalbumin; allergen, egg white protei 3e-69
3sto_A 406 Serine protease inhibitor; serpin fold, hydrolase 3e-69
4au2_A 392 HSP47, serpin peptidase inhibitor, clade H (heat s 3e-69
2zv6_A 401 Serpin B3; serine proteinase inhibitor, reactive s 3e-69
3b9f_I 395 Protein C inhibitor; michaelis complex, acute phas 1e-68
1as4_A341 Antichymotrypsin, ACT; serpin, serine protease inh 1e-68
2vdx_A 373 Corticosteroid-binding globulin; transport protein 2e-68
3dy0_A336 N-terminus plasma serine protease inhibitor; serpi 6e-68
1qmn_A 401 AACT, alpha-1-antichymotrypsin; serpin, serine pro 1e-67
3ndd_A343 Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 4e-67
1jmo_A 480 HC-II, heparin cofactor II, HLS2, serin; serpin, t 4e-67
3ne4_A 424 Alpha-1-antitrypsin; serpin, LUNG disease, liver d 5e-67
2ceo_A 379 Thyroxine-binding globulin; transport, serpin, hor 7e-67
1imv_A 398 PEDF, pigment epithelium-derived factor; serpin, a 9e-67
2r9y_A 430 Alpha-2-antiplasmin; inhibitory serpin, plasmin in 3e-66
2xn6_A350 Thyroxine-binding globulin; transport, cleaved pro 5e-66
2oay_A 390 C1-inhibitor, plasma protease C1 inhibitor, C1 INH 2e-65
2v95_A 371 Corticosteroid-binding globulin; transport protein 2e-64
1f0c_A305 ICE inhibitor; apoptosis, caspase inhibitor, prote 2e-61
2wxw_A 453 Angiotensinogen, serpin A8; glycoprotein, hyperten 6e-61
2wxy_C 453 Angiotensinogen, serpin A8; glycoprotein, hyperten 3e-60
1m93_B245 Serine proteinase inhibitor 2; serpin, CRMA, apopt 7e-52
1m93_A55 Serine proteinase inhibitor 2; serpin, CRMA, apopt 8e-08
>3ozq_A Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molitor} Length = 376 Back     alignment and structure
 Score =  238 bits (610), Expect = 2e-76
 Identities = 71/219 (32%), Positives = 111/219 (50%), Gaps = 11/219 (5%)

Query: 114 LAANKKENAIISPFSLHVVLGLASFGAAGSTAEAMMKGLRIKHSETLLKDYKGIIDQLSK 173
           +   +K N ++SPFS   +L LA  G  G TAE + + L           + G  ++   
Sbjct: 26  VLKTEKANFLVSPFSAATLLALAQSGCRGDTAEEIRQVLH----------FVGDREKAEG 75

Query: 174 DYKGIIDQLSKS-PELKIANKIYFAKDIELNPAYQTQAVDNFNSELGKVDFSQPPAAAKE 232
             K ++ +L+     L  ANKIY   +  +   +Q  AV+ + ++   VDFS+   AAK 
Sbjct: 76  AVKEVLSKLTNEEYTLHTANKIYVKTNFSVREEFQKIAVEVYGAQSENVDFSEKNDAAKL 135

Query: 233 MNDWVSNHTNDKIKDLIKADSLDASTKLVLINAIHFKGKWTVPFKPEATKDGPFYLDDTN 292
           MN WV   T  KI++L+  + L+  T++VLINA++F  KW VPF P  T+   F+     
Sbjct: 136 MNAWVEEQTQHKIQNLVDPEILNNLTRVVLINALYFNAKWLVPFPPFHTRKSDFHKSAKE 195

Query: 293 SVQVPLMFVKDSFYMYEEAGEDGFKMLELPYGVSISFII 331
            VQV  M++ + ++ Y E      K+LELP+    S  I
Sbjct: 196 VVQVDTMYLDEQYFNYYECHHLDAKLLELPFKGGASLTI 234


>1sek_A Serpin K; serine protease inhibitor, protease; 2.10A {Manduca sexta} SCOP: e.1.1.1 PDB: 1k9o_I Length = 378 Back     alignment and structure
>1wz9_A Maspin precursor; serpin, tumor suppressor, serpinb5, signaling protein; HET: CME; 2.10A {Homo sapiens} PDB: 1xu8_A 1xqg_A 1xqj_A Length = 375 Back     alignment and structure
>1lj5_A Plasminogen activator inhibitor-1; beta-barrell, blood clotting; 1.80A {Homo sapiens} SCOP: e.1.1.1 PDB: 1dvn_A 1c5g_A 1a7c_A* 3q02_A 3q03_A 3r4l_A* 1oc0_A 1b3k_A 3pb1_I 1dvm_A 3eox_A 3cvm_A 1db2_A 9pai_A 3lw2_A 9pai_B Length = 379 Back     alignment and structure
>3f5n_A Neuroserpin; cleaved form, fenib, human, tissue PLAS activator, hydrolase inhibitor; 3.15A {Homo sapiens} Length = 407 Back     alignment and structure
>3le2_A Serpin-ZX; apoplast, glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase; 2.20A {Arabidopsis thaliana} Length = 393 Back     alignment and structure
>1hle_A Horse leukocyte elastase inhibitor; hydrolase inhibitor(serine proteinase); 1.95A {Equus caballus} SCOP: e.1.1.1 Length = 345 Back     alignment and structure
>3kcg_I Antithrombin-III, ATIII; michaelis complex, blood coagulation, calcium, disulfide bond, EGF-like domain, glycoprotein, hemophilia, hydrolase; HET: NAG FUC MAN NTP; 1.70A {Homo sapiens} PDB: 1e04_I* 1ath_A 1ant_L* 1br8_L 1azx_I* 1dzh_L* 1e03_L* 1dzg_L* 1e05_L* 1jvq_L* 1lk6_L* 1nq9_I* 1oyh_L* 1r1l_L* 1sr5_A* 2ant_L* 2beh_L* 2hij_L* 2znh_A* 3evj_I* ... Length = 432 Back     alignment and structure
>3f02_A Neuroserpin; cleaved form, fenib, human, disease MUT glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase inhibitor; 1.80A {Homo sapiens} PDB: 3fgq_A 1jjo_C 1jjo_A Length = 359 Back     alignment and structure
>3pzf_A Serpin 2; protease inhibitor, melanization, hydrolase inhibito; 1.75A {Anopheles gambiae} Length = 397 Back     alignment and structure
>3nda_A Serpin-2; vaccination target, TICK, hydrolase inhibitor; HET: 1PE; 1.80A {Ixodes ricinus} Length = 377 Back     alignment and structure
>3f1s_A Protein Z-dependent protease inhibitor; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} PDB: 3h5c_A* Length = 385 Back     alignment and structure
>1mtp_A Serine proteinase inhibitor (serpin), chain A; structural genomics, protease inhibitor; 1.50A {Thermobifida fusca} SCOP: e.1.1.1 Length = 323 Back     alignment and structure
>2arr_A Plasminogen activator inhibitor-2; serpin, peptide binding, hydrolase inhibitor-PEPT complex; 1.55A {Homo sapiens} PDB: 2arq_A 1jrr_A 1by7_A Length = 382 Back     alignment and structure
>1sng_A COG4826: serine protease inhibitor; serine protease inhibitor (serpin), native state., hydrolase inhibitor; 1.76A {Thermobifida fusca} SCOP: e.1.1.1 Length = 370 Back     alignment and structure
>2pef_A Serine protease inhibitor; serpin; 1.60A {Thermoanaerobacter tengcongensis} PDB: 2vh4_A 2pee_A Length = 373 Back     alignment and structure
>4dy0_A GLIA-derived nexin; serpin, protease inhibitor, thrombin, cell surface, hydrolas inhibitor; HET: IDS SGN; 2.35A {Homo sapiens} PDB: 4dy7_C Length = 379 Back     alignment and structure
>2h4r_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 2.70A {Gallus gallus} PDB: 2dut_A Length = 415 Back     alignment and structure
>1yxa_A Serine (OR cysteine) proteinase inhibitor, clade 3N; serpin, antichymotrypsin, protease inhibitor, reactive centr plasma, hydrolase inhibitor; 2.10A {Mus musculus} Length = 398 Back     alignment and structure
>2h4p_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 1.70A {Gallus gallus} PDB: 2h4q_A Length = 394 Back     alignment and structure
>1uhg_A Ovalbumin, S-ovalbumin; allergen, egg white protein, serpin; HET: SEP NAG; 1.90A {Gallus gallus} SCOP: e.1.1.1 PDB: 1ova_A* 1jti_A Length = 385 Back     alignment and structure
>3sto_A Serine protease inhibitor; serpin fold, hydrolase inhibitor; 2.41A {Schistosoma haematobium} Length = 406 Back     alignment and structure
>4au2_A HSP47, serpin peptidase inhibitor, clade H (heat shock P 47), member 1, (collagen binding...; chaperone-peptide complex; 2.30A {Canis lupus familiaris} PDB: 4au3_A 4au4_A 4awr_A 4au3_B Length = 392 Back     alignment and structure
>2zv6_A Serpin B3; serine proteinase inhibitor, reactive site loop, acetylation, alternative splicing, cytoplasm, polymorphism, protease inhibitor; 2.70A {Homo sapiens} Length = 401 Back     alignment and structure
>3b9f_I Protein C inhibitor; michaelis complex, acute phase, blood coagulation, cleavage of basic residues, disease mutation; HET: NAG FUC SGN IDS; 1.60A {Homo sapiens} PDB: 2ol2_A* Length = 395 Back     alignment and structure
>1as4_A Antichymotrypsin, ACT; serpin, serine protease inhibitor; 2.10A {Homo sapiens} SCOP: e.1.1.1 PDB: 2ach_A* 4caa_A 3caa_A Length = 341 Back     alignment and structure
>2vdx_A Corticosteroid-binding globulin; transport protein, cortisol binding globulin, glycoprotein, lipid-binding, disease mutation, CBG, SERP cleaved; 1.84A {Homo sapiens} PDB: 2vdy_A* Length = 373 Back     alignment and structure
>3dy0_A N-terminus plasma serine protease inhibitor; serpin, blood clotting, hydrolase inhibitor; HET: IDS SGN; 1.55A {Homo sapiens} PDB: 1lq8_A* 2hi9_A* Length = 336 Back     alignment and structure
>1qmn_A AACT, alpha-1-antichymotrypsin; serpin, serine proteinase inhibitor, partial loop insertion, loop-sheet polymerization, emphysema, disease mutation; 2.27A {Homo sapiens} SCOP: e.1.1.1 PDB: 3dlw_A Length = 401 Back     alignment and structure
>3ndd_A Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 1.50A {Homo sapiens} PDB: 3ndf_A 7api_A* 8api_A* 9api_A* 1d5s_A 1ezx_A 3t1p_A 2d26_A 1qmb_A Length = 343 Back     alignment and structure
>1jmo_A HC-II, heparin cofactor II, HLS2, serin; serpin, thrombin, protease, inhibition, inhibitor, blood CLO; HET: TYS NDG NAG; 2.20A {Homo sapiens} SCOP: e.1.1.1 PDB: 1jmj_A* Length = 480 Back     alignment and structure
>3ne4_A Alpha-1-antitrypsin; serpin, LUNG disease, liver disease, polymerisation, hydrolase inhibitor; 1.81A {Homo sapiens} PDB: 1qlp_A 2qug_A 3cwl_A 3cwm_A* 1psi_A 3drm_A 1kct_A 3dru_A 1hp7_A 1iz2_A* 1oph_A 1oo8_A 1atu_A 1d5s_B 1qmb_B Length = 424 Back     alignment and structure
>2ceo_A Thyroxine-binding globulin; transport, serpin, hormone trans thyroxine, disease mutation, glycoprotein; HET: T44; 2.80A {Homo sapiens} Length = 379 Back     alignment and structure
>1imv_A PEDF, pigment epithelium-derived factor; serpin, angiogenesis, signaling protein; HET: NAG; 2.85A {Homo sapiens} SCOP: e.1.1.1 Length = 398 Back     alignment and structure
>2r9y_A Alpha-2-antiplasmin; inhibitory serpin, plasmin inhibitor, AC phase, glycoprotein, protease inhibitor, secreted, serine P inhibitor, sulfation; 2.65A {Mus musculus} Length = 430 Back     alignment and structure
>2xn6_A Thyroxine-binding globulin; transport, cleaved protein; HET: F6Y T44; 1.29A {Homo sapiens} PDB: 2xn7_A* 2xn5_A* 2riv_A 2xn3_A* 2riw_A* Length = 350 Back     alignment and structure
>2oay_A C1-inhibitor, plasma protease C1 inhibitor, C1 INH, C1INH; latent serpin, RCL insertion, immune system,hydrolase inhibi; HET: NAG; 2.35A {Homo sapiens} Length = 390 Back     alignment and structure
>2v95_A Corticosteroid-binding globulin; transport protein, CBG, RCL, serpin, secreted, transport, glycoprotein, lipid-binding, glucocorticoids; HET: HCY; 1.93A {Rattus norvegicus} Length = 371 Back     alignment and structure
>1f0c_A ICE inhibitor; apoptosis, caspase inhibitor, protease inhibitor, serpin, viral protein; 2.26A {Cowpox virus} SCOP: e.1.1.1 PDB: 1c8o_A Length = 305 Back     alignment and structure
>2wxw_A Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 3.30A {Homo sapiens} PDB: 2x0b_B Length = 453 Back     alignment and structure
>2wxy_C Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 2.10A {Mus musculus} PDB: 2wxx_A 2wy0_C 2wxz_A 2wxz_C 2wy1_A Length = 453 Back     alignment and structure
>1m93_B Serine proteinase inhibitor 2; serpin, CRMA, apoptosis, ICE inhibitor, viral protein; 1.65A {Cowpox virus} SCOP: e.1.1.1 Length = 245 Back     alignment and structure
>1m93_A Serine proteinase inhibitor 2; serpin, CRMA, apoptosis, ICE inhibitor, viral protein; 1.65A {Cowpox virus} SCOP: e.1.1.1 Length = 55 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query342
3f02_A359 Neuroserpin; cleaved form, fenib, human, disease M 100.0
1hle_A 345 Horse leukocyte elastase inhibitor; hydrolase inhi 100.0
3ndd_A343 Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 100.0
3dy0_A336 N-terminus plasma serine protease inhibitor; serpi 100.0
3f5n_A 407 Neuroserpin; cleaved form, fenib, human, tissue PL 100.0
3ne4_A 424 Alpha-1-antitrypsin; serpin, LUNG disease, liver d 100.0
2h4p_A 394 MENT, heterochromatin-associated protein MENT; ser 100.0
3nda_A 377 Serpin-2; vaccination target, TICK, hydrolase inhi 100.0
4ga7_A 389 Leukocyte elastase inhibitor; serpin, conformation 100.0
1uhg_A 385 Ovalbumin, S-ovalbumin; allergen, egg white protei 100.0
2xn6_A 350 Thyroxine-binding globulin; transport, cleaved pro 100.0
3ozq_A 376 Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molito 100.0
4au2_A 392 HSP47, serpin peptidase inhibitor, clade H (heat s 100.0
2zv6_A 401 Serpin B3; serine proteinase inhibitor, reactive s 100.0
1as4_A341 Antichymotrypsin, ACT; serpin, serine protease inh 100.0
3sto_A 406 Serine protease inhibitor; serpin fold, hydrolase 100.0
2h4r_A 415 MENT, heterochromatin-associated protein MENT; ser 100.0
1lj5_A 379 Plasminogen activator inhibitor-1; beta-barrell, b 100.0
2ceo_A 379 Thyroxine-binding globulin; transport, serpin, hor 100.0
2arr_A 382 Plasminogen activator inhibitor-2; serpin, peptide 100.0
3b9f_I 395 Protein C inhibitor; michaelis complex, acute phas 100.0
4afx_A387 Protein Z dependent protease inhibitor; hydrolase 100.0
2vdx_A 373 Corticosteroid-binding globulin; transport protein 100.0
1sek_A 378 Serpin K; serine protease inhibitor, protease; 2.1 100.0
4dy0_A 379 GLIA-derived nexin; serpin, protease inhibitor, th 100.0
1wz9_A 375 Maspin precursor; serpin, tumor suppressor, serpin 100.0
1yxa_A 398 Serine (OR cysteine) proteinase inhibitor, clade 3 100.0
3f1s_A 385 Protein Z-dependent protease inhibitor; PZ, ZPI, c 100.0
4ajt_A 427 Protein Z-dependent protease inhibitor; blood clot 100.0
3pzf_A 397 Serpin 2; protease inhibitor, melanization, hydrol 100.0
1qmn_A 401 AACT, alpha-1-antichymotrypsin; serpin, serine pro 100.0
3kcg_I 432 Antithrombin-III, ATIII; michaelis complex, blood 100.0
1imv_A 398 PEDF, pigment epithelium-derived factor; serpin, a 100.0
2v95_A 371 Corticosteroid-binding globulin; transport protein 100.0
3le2_A 393 Serpin-ZX; apoplast, glycoprotein, protease inhibi 100.0
1mtp_A323 Serine proteinase inhibitor (serpin), chain A; str 100.0
1jmo_A 480 HC-II, heparin cofactor II, HLS2, serin; serpin, t 100.0
1sng_A 370 COG4826: serine protease inhibitor; serine proteas 100.0
2wxy_C 453 Angiotensinogen, serpin A8; glycoprotein, hyperten 100.0
2pef_A 373 Serine protease inhibitor; serpin; 1.60A {Thermoan 100.0
2wxw_A 453 Angiotensinogen, serpin A8; glycoprotein, hyperten 100.0
2r9y_A 430 Alpha-2-antiplasmin; inhibitory serpin, plasmin in 100.0
1f0c_A305 ICE inhibitor; apoptosis, caspase inhibitor, prote 100.0
2oay_A 390 C1-inhibitor, plasma protease C1 inhibitor, C1 INH 100.0
1m93_B245 Serine proteinase inhibitor 2; serpin, CRMA, apopt 100.0
1m93_A55 Serine proteinase inhibitor 2; serpin, CRMA, apopt 99.38
>3f02_A Neuroserpin; cleaved form, fenib, human, disease MUT glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase inhibitor; 1.80A {Homo sapiens} PDB: 3fgq_A 1jjo_C 1jjo_A Back     alignment and structure
Probab=100.00  E-value=2.2e-54  Score=421.35  Aligned_cols=230  Identities=30%  Similarity=0.531  Sum_probs=205.3

Q ss_pred             cccccccccccccccccccCCcchhhhhhhhhhhhhcc-CCCCEEEChhhHHHHHHHHHccCChhHHHHHHHHcCCCCcc
Q psy2651          80 SFSSILDQRFNGKLHKKEDFKPFSIQLSTLVEWNLAAN-KKENAIISPFSLHVVLGLASFGAAGSTAEAMMKGLRIKHSE  158 (342)
Q Consensus        80 ~~~~~~~~~Fa~~L~~~~~~~~~~~~~~~~~~~~l~~~-~~~Niv~SP~sI~~aLamL~~GA~G~T~~qL~~~Lgl~~~~  158 (342)
                      .++++.+ +||++||+                 ++.+. +++|+||||+||+.+|+|+++||+|+|++||.++||++...
T Consensus        18 ~l~~~~~-~Fa~~L~~-----------------~l~~~~~~~Niv~SP~Si~~aLaml~~GA~G~T~~ql~~~L~~~~~~   79 (359)
T 3f02_A           18 FPEEAIA-DLSVNMYN-----------------RLRATGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLK   79 (359)
T ss_dssp             ---CHHH-HHHHHHHH-----------------HHHHHSTTCCEEECHHHHHHHHHHHHHHCCHHHHHHHHHHHTCCC--
T ss_pred             HHHHHHH-HHHHHHHH-----------------HHhhcCCCCCEEEcHHHHHHHHHHHHhhcCChHHHHHHHHhCCCCCC
Confidence            4556667 99999999                 88776 78999999999999999999999999999999999998654


Q ss_pred             cchhcccchhHHHHHHHHHHHHHhCCCc---chhhhhhhhhccCcccchHHHHHhhhhcccccEEecCCCcHHHHHhhch
Q psy2651         159 TLLKDYKGIIDQLSKDYKGIIDQLSKSP---ELKIANKIYFAKDIELNPAYQTQAVDNFNSELGKVDFSQPPAAAKEMND  235 (342)
Q Consensus       159 ~~~~~~~~~~~~v~~~~~~l~~~l~~~~---~l~~an~lfv~~~~~l~~~F~~~~~~~y~a~v~~vdF~~~~~a~~~IN~  235 (342)
                      ..+         ++..|+.++..+.+.+   .+.+||+||+++++++.++|++.++++|+++++.+||.+++.+++.||+
T Consensus        80 ~~~---------~~~~~~~l~~~l~~~~~~~~l~~an~l~~~~~~~l~~~f~~~~~~~y~a~~~~vdF~~~~~a~~~IN~  150 (359)
T 3f02_A           80 NGE---------EFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINK  150 (359)
T ss_dssp             --C---------HHHHHHCC----------CEEEEEEEEEEETTCCCCHHHHHHHHHHHCCEEEEECTTSHHHHHHHHHH
T ss_pred             HHH---------HHHHHHHHHHHHhcCCCCcEEEEEEEEEEeCCCccchHHHHHHHHHhcCceEEcCCCCHHHHHHHHHH
Confidence            334         8888998888776433   8999999999999999999999999999999999999988889999999


Q ss_pred             hhhcccCCccccCCCCCCCCcccceeeeeeccccccccccCCCCCCcccCeeecCCCeEEEeeeeecceeeeEEEeCCCC
Q psy2651         236 WVSNHTNDKIKDLIKADSLDASTKLVLINAIHFKGKWTVPFKPEATKDGPFYLDDTNSVQVPLMFVKDSFYMYEEAGEDG  315 (342)
Q Consensus       236 WV~~~T~g~I~~ll~~~~i~~~t~lvLvNaiyFkg~W~~~F~~~~T~~~~F~~~~g~~~~VpMM~~~~~~f~y~~~~~l~  315 (342)
                      ||+++|+|+|++++++++++++|+++|+||+||||.|+++|++.+|++++|+..+|++++||||++.+. |+|+++++++
T Consensus       151 WV~~~T~gkI~~ll~~~~l~~~t~lvLvNaiyFkg~W~~~F~~~~T~~~~F~~~~g~~v~V~mM~~~~~-~~y~~~~~l~  229 (359)
T 3f02_A          151 WVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGE-FYYGEFSDGS  229 (359)
T ss_dssp             HHHHTTTTCSCCSSCGGGCSTTEEEEEEEEEEEEEEBSSCCCGGGCEEEEEECTTSCEEEEEEEEEEEE-EEEEEEECCC
T ss_pred             HHHhhhCCcccccCCcccCCCCceEEEEeHHHHhHHhhccCCcccceeeeeEecCCcEEEccceEeece-EeEEEccCcC
Confidence            999999999999999999999999999999999999999999999999999999999999999999998 9999999998


Q ss_pred             e------EEEEEeC-CCcEEEEEeecCCCCCC
Q psy2651         316 F------KMLELPY-GVSISFIIKSQVVPEMG  340 (342)
Q Consensus       316 ~------~vLELPY-~~~~SMlI~~~ILP~~g  340 (342)
                      +      +|||||| ++++||+|   |||+++
T Consensus       230 a~~~~~~~vleLPY~~~~~sm~i---iLP~~~  258 (359)
T 3f02_A          230 NEAGGIYQVLEIPYEGDEISMML---VLSRQE  258 (359)
T ss_dssp             ---CCEEEEEEEEBTTSSEEEEE---EECCTT
T ss_pred             cccccccEEEEeEcCCCcEEEEE---EEcCCC
Confidence            8      9999999 99999999   899986



>1hle_A Horse leukocyte elastase inhibitor; hydrolase inhibitor(serine proteinase); 1.95A {Equus caballus} SCOP: e.1.1.1 Back     alignment and structure
>3ndd_A Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 1.50A {Homo sapiens} PDB: 3ndf_A 7api_A* 8api_A* 9api_A* 1d5s_A 1ezx_A 3t1p_A 2d26_A 1qmb_A Back     alignment and structure
>3dy0_A N-terminus plasma serine protease inhibitor; serpin, blood clotting, hydrolase inhibitor; HET: IDS SGN; 1.55A {Homo sapiens} PDB: 1lq8_A* 2hi9_A* Back     alignment and structure
>3f5n_A Neuroserpin; cleaved form, fenib, human, tissue PLAS activator, hydrolase inhibitor; 3.15A {Homo sapiens} Back     alignment and structure
>3ne4_A Alpha-1-antitrypsin; serpin, LUNG disease, liver disease, polymerisation, hydrolase inhibitor; 1.81A {Homo sapiens} PDB: 1qlp_A 2qug_A 3cwl_A 3cwm_A* 1psi_A 3drm_A 1kct_A 3dru_A 1hp7_A 1iz2_A* 1oph_A 1oo8_A 1atu_A 1d5s_B 1qmb_B Back     alignment and structure
>2h4p_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 1.70A {Gallus gallus} PDB: 2h4q_A Back     alignment and structure
>3nda_A Serpin-2; vaccination target, TICK, hydrolase inhibitor; HET: 1PE; 1.80A {Ixodes ricinus} Back     alignment and structure
>4ga7_A Leukocyte elastase inhibitor; serpin, conformational change, serine protease inhibitor, Ca inhibitor, chymase inhibitor, chymotrypsin inhibitor; 2.90A {Homo sapiens} Back     alignment and structure
>1uhg_A Ovalbumin, S-ovalbumin; allergen, egg white protein, serpin; HET: SEP NAG; 1.90A {Gallus gallus} SCOP: e.1.1.1 PDB: 1ova_A* 1jti_A Back     alignment and structure
>2xn6_A Thyroxine-binding globulin; transport, cleaved protein; HET: F6Y T44; 1.29A {Homo sapiens} PDB: 2xn7_A* 2xn5_A* 2riv_A 2xn3_A* 2riw_A* Back     alignment and structure
>3ozq_A Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molitor} Back     alignment and structure
>4au2_A HSP47, serpin peptidase inhibitor, clade H (heat shock P 47), member 1, (collagen binding...; chaperone-peptide complex; 2.30A {Canis lupus familiaris} PDB: 4au3_A 4au4_A 4awr_A 4au3_B Back     alignment and structure
>2zv6_A Serpin B3; serine proteinase inhibitor, reactive site loop, acetylation, alternative splicing, cytoplasm, polymorphism, protease inhibitor; 2.70A {Homo sapiens} Back     alignment and structure
>1as4_A Antichymotrypsin, ACT; serpin, serine protease inhibitor; 2.10A {Homo sapiens} SCOP: e.1.1.1 PDB: 2ach_A* 4caa_A 3caa_A Back     alignment and structure
>3sto_A Serine protease inhibitor; serpin fold, hydrolase inhibitor; 2.41A {Schistosoma haematobium} Back     alignment and structure
>2h4r_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 2.70A {Gallus gallus} PDB: 2dut_A Back     alignment and structure
>1lj5_A Plasminogen activator inhibitor-1; beta-barrell, blood clotting; 1.80A {Homo sapiens} SCOP: e.1.1.1 PDB: 1dvn_A 1c5g_A 1a7c_A* 3q02_A 3q03_A 3r4l_A* 1oc0_A 1b3k_A 3pb1_I 1dvm_A 3eox_A 3cvm_A 1db2_A 9pai_A 3lw2_A 9pai_B Back     alignment and structure
>2ceo_A Thyroxine-binding globulin; transport, serpin, hormone trans thyroxine, disease mutation, glycoprotein; HET: T44; 2.80A {Homo sapiens} Back     alignment and structure
>2arr_A Plasminogen activator inhibitor-2; serpin, peptide binding, hydrolase inhibitor-PEPT complex; 1.55A {Homo sapiens} PDB: 2arq_A 1jrr_A 1by7_A Back     alignment and structure
>3b9f_I Protein C inhibitor; michaelis complex, acute phase, blood coagulation, cleavage of basic residues, disease mutation; HET: NAG FUC SGN IDS; 1.60A {Homo sapiens} PDB: 2ol2_A* Back     alignment and structure
>4afx_A Protein Z dependent protease inhibitor; hydrolase inhibitor, serpin, protein Z dependent inhibitor, coagulation; 2.09A {Homo sapiens} PDB: 4aju_A 3h5c_A* 3f1s_A* Back     alignment and structure
>2vdx_A Corticosteroid-binding globulin; transport protein, cortisol binding globulin, glycoprotein, lipid-binding, disease mutation, CBG, SERP cleaved; 1.84A {Homo sapiens} PDB: 2vdy_A* Back     alignment and structure
>1sek_A Serpin K; serine protease inhibitor, protease; 2.10A {Manduca sexta} SCOP: e.1.1.1 PDB: 1k9o_I Back     alignment and structure
>4dy0_A GLIA-derived nexin; serpin, protease inhibitor, thrombin, cell surface, hydrolas inhibitor; HET: IDS SGN; 2.35A {Homo sapiens} PDB: 4dy7_C Back     alignment and structure
>1wz9_A Maspin precursor; serpin, tumor suppressor, serpinb5, signaling protein; HET: CME; 2.10A {Homo sapiens} PDB: 1xu8_A 1xqg_A 1xqj_A Back     alignment and structure
>1yxa_A Serine (OR cysteine) proteinase inhibitor, clade 3N; serpin, antichymotrypsin, protease inhibitor, reactive centr plasma, hydrolase inhibitor; 2.10A {Mus musculus} Back     alignment and structure
>3f1s_A Protein Z-dependent protease inhibitor; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} PDB: 3h5c_A* Back     alignment and structure
>4ajt_A Protein Z-dependent protease inhibitor; blood clotting, ZPI; 2.50A {Mus musculus} Back     alignment and structure
>3pzf_A Serpin 2; protease inhibitor, melanization, hydrolase inhibito; 1.75A {Anopheles gambiae} Back     alignment and structure
>1qmn_A AACT, alpha-1-antichymotrypsin; serpin, serine proteinase inhibitor, partial loop insertion, loop-sheet polymerization, emphysema, disease mutation; 2.27A {Homo sapiens} SCOP: e.1.1.1 PDB: 3dlw_A Back     alignment and structure
>3kcg_I Antithrombin-III, ATIII; michaelis complex, blood coagulation, calcium, disulfide bond, EGF-like domain, glycoprotein, hemophilia, hydrolase; HET: NAG FUC MAN NTP; 1.70A {Homo sapiens} SCOP: e.1.1.1 PDB: 1e04_I* 1ath_A 1ant_L* 1br8_L 1azx_I* 1dzh_L* 1e03_L* 1dzg_L* 1e05_L* 1jvq_L* 1lk6_L* 1nq9_I* 1oyh_L* 1r1l_L* 1sr5_A* 2ant_L* 2beh_L* 2hij_L* 2znh_A* 3evj_I* ... Back     alignment and structure
>1imv_A PEDF, pigment epithelium-derived factor; serpin, angiogenesis, signaling protein; HET: NAG; 2.85A {Homo sapiens} SCOP: e.1.1.1 Back     alignment and structure
>2v95_A Corticosteroid-binding globulin; transport protein, CBG, RCL, serpin, secreted, transport, glycoprotein, lipid-binding, glucocorticoids; HET: HCY; 1.93A {Rattus norvegicus} Back     alignment and structure
>3le2_A Serpin-ZX; apoplast, glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase; 2.20A {Arabidopsis thaliana} SCOP: e.1.1.0 Back     alignment and structure
>1mtp_A Serine proteinase inhibitor (serpin), chain A; structural genomics, protease inhibitor; 1.50A {Thermobifida fusca} SCOP: e.1.1.1 Back     alignment and structure
>1jmo_A HC-II, heparin cofactor II, HLS2, serin; serpin, thrombin, protease, inhibition, inhibitor, blood CLO; HET: TYS NDG NAG; 2.20A {Homo sapiens} SCOP: e.1.1.1 PDB: 1jmj_A* Back     alignment and structure
>1sng_A COG4826: serine protease inhibitor; serine protease inhibitor (serpin), native state., hydrolase inhibitor; 1.76A {Thermobifida fusca} SCOP: e.1.1.1 Back     alignment and structure
>2wxy_C Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 2.10A {Mus musculus} PDB: 2wxx_A 2wy0_C 2wxz_A 2wxz_C 2wy1_A Back     alignment and structure
>2pef_A Serine protease inhibitor; serpin; 1.60A {Thermoanaerobacter tengcongensis} PDB: 2vh4_A 2pee_A Back     alignment and structure
>2wxw_A Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 3.30A {Homo sapiens} PDB: 2x0b_B Back     alignment and structure
>2r9y_A Alpha-2-antiplasmin; inhibitory serpin, plasmin inhibitor, AC phase, glycoprotein, protease inhibitor, secreted, serine P inhibitor, sulfation; 2.65A {Mus musculus} Back     alignment and structure
>1f0c_A ICE inhibitor; apoptosis, caspase inhibitor, protease inhibitor, serpin, viral protein; 2.26A {Cowpox virus} SCOP: e.1.1.1 PDB: 1c8o_A Back     alignment and structure
>2oay_A C1-inhibitor, plasma protease C1 inhibitor, C1 INH, C1INH; latent serpin, RCL insertion, immune system,hydrolase inhibi; HET: NAG; 2.35A {Homo sapiens} Back     alignment and structure
>1m93_B Serine proteinase inhibitor 2; serpin, CRMA, apoptosis, ICE inhibitor, viral protein; 1.65A {Cowpox virus} SCOP: e.1.1.1 Back     alignment and structure
>1m93_A Serine proteinase inhibitor 2; serpin, CRMA, apoptosis, ICE inhibitor, viral protein; 1.65A {Cowpox virus} SCOP: e.1.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 342
d1uhga_ 385 e.1.1.1 (A:) Ovalbumin {Hen (Gallus gallus) [TaxId 1e-40
d1k9oi_ 376 e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornwor 7e-40
d1lj5a_ 379 e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Hu 2e-39
d1by7a_ 381 e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Hu 2e-38
g1hle.1 375 e.1.1.1 (A:,B:) Elastase inhibitor {Horse (Equus c 3e-38
g1jjo.1 334 e.1.1.1 (A:,C:,E:) Neuroserpin {Mouse (Mus musculu 2e-37
d2b5ti1 426 e.1.1.1 (I:6-431) Antithrombin {Human (Homo sapien 7e-37
g1as4.1 369 e.1.1.1 (A:,B:) Antichymotrypsin, alpha-1 {Human ( 4e-36
d1xqga_ 378 e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: 2e-35
g1lq8.1 358 e.1.1.1 (A:,B:) Protein C inhibitor {Human (Homo s 5e-35
d1qlpa_ 372 e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sap 4e-34
d1imva_ 383 e.1.1.1 (A:) Pigment epithelium-derived factor, PE 6e-34
g1mtp.1 355 e.1.1.1 (A:,B:) Thermopin {Thermobifida fusca [Tax 9e-32
d1jmja_ 420 e.1.1.1 (A:) Heparin cofactor II (Hc-II, leuserpin 3e-31
g1m93.1 322 e.1.1.1 (A:,B:,C:) Viral serpin crmA (cytokine res 4e-28
>d1uhga_ e.1.1.1 (A:) Ovalbumin {Hen (Gallus gallus) [TaxId: 9031]} Length = 385 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Serpins
superfamily: Serpins
family: Serpins
domain: Ovalbumin
species: Hen (Gallus gallus) [TaxId: 9031]
 Score =  144 bits (363), Expect = 1e-40
 Identities = 56/225 (24%), Positives = 105/225 (46%), Gaps = 9/225 (4%)

Query: 115 AANKKENAIISPFSLHVVLGLASFGAAGSTAEAMMKGLRIKHSETL---LKDYKGIIDQL 171
             +  EN    P ++   L +   GA  ST   + K +R          ++   G    +
Sbjct: 20  VHHANENIFYCPIAIMSALAMVYLGAKDSTRTQINKVVRFDKLPGFGDSIEAQCGTSVNV 79

Query: 172 SKDYKGIIDQLSKS---PELKIANKIYFAKDIELNPAYQTQAVDNFNSELGKVDFSQPP- 227
               + I++Q++K        +A+++Y  +   + P Y     + +   L  ++F     
Sbjct: 80  HSSLRDILNQITKPNDVYSFSLASRLYAEERYPILPEYLQCVKELYRGGLEPINFQTAAD 139

Query: 228 AAAKEMNDWVSNHTNDKIKDLIKADSLDASTKLVLINAIHFKGKWTVPFKPEATKDGPFY 287
            A + +N WV + TN  I+++++  S+D+ T +VL+NAI FKG W   FK E T+  PF 
Sbjct: 140 QARELINSWVESQTNGIIRNVLQPSSVDSQTAMVLVNAIVFKGLWEKAFKDEDTQAMPFR 199

Query: 288 LDDTNSVQVPLMFVKDSFYMYEEAGEDGFKMLELPY-GVSISFII 331
           + +  S  V +M+    F +   A  +  K+LELP+   ++S ++
Sbjct: 200 VTEQESKPVQMMYQIGLFRVASMA-SEKMKILELPFASGTMSMLV 243


>d1k9oi_ e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornworm (Manduca sexta) [TaxId: 7130]} Length = 376 Back     information, alignment and structure
>d1lj5a_ e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 379 Back     information, alignment and structure
>d1by7a_ e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 381 Back     information, alignment and structure
>d2b5ti1 e.1.1.1 (I:6-431) Antithrombin {Human (Homo sapiens) [TaxId: 9606]} Length = 426 Back     information, alignment and structure
>d1xqga_ e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: 9606]} Length = 378 Back     information, alignment and structure
>d1qlpa_ e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 372 Back     information, alignment and structure
>d1imva_ e.1.1.1 (A:) Pigment epithelium-derived factor, PEDF {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d1jmja_ e.1.1.1 (A:) Heparin cofactor II (Hc-II, leuserpin 2) {Human (Homo sapiens) [TaxId: 9606]} Length = 420 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query342
d2b5ti1 426 Antithrombin {Human (Homo sapiens) [TaxId: 9606]} 100.0
g1hle.1 375 Elastase inhibitor {Horse (Equus caballus) [TaxId: 100.0
d1lj5a_ 379 Plasminogen activator inhibitor-1 {Human (Homo sap 100.0
d1k9oi_ 376 Alaserpin (serpin 1) {Tobacco hornworm (Manduca se 100.0
d1uhga_ 385 Ovalbumin {Hen (Gallus gallus) [TaxId: 9031]} 100.0
d1by7a_ 381 Plasminogen activator inhibitor-2 {Human (Homo sap 100.0
g1lq8.1 358 Protein C inhibitor {Human (Homo sapiens) [TaxId: 100.0
d1jmja_ 420 Heparin cofactor II (Hc-II, leuserpin 2) {Human (H 100.0
d1xqga_ 378 Maspin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1imva_ 383 Pigment epithelium-derived factor, PEDF {Human (Ho 100.0
g1as4.1 369 Antichymotrypsin, alpha-1 {Human (Homo sapiens) [T 100.0
d1qlpa_ 372 Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 100.0
g1mtp.1 355 Thermopin {Thermobifida fusca [TaxId: 2021]} 100.0
g1jjo.1 334 Neuroserpin {Mouse (Mus musculus) [TaxId: 10090]} 100.0
g1m93.1 322 Viral serpin crmA (cytokine response modifier prot 100.0
>d2b5ti1 e.1.1.1 (I:6-431) Antithrombin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Serpins
superfamily: Serpins
family: Serpins
domain: Antithrombin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.6e-48  Score=385.47  Aligned_cols=232  Identities=28%  Similarity=0.536  Sum_probs=208.3

Q ss_pred             ccccccccccccccccccCCcchhhhhhhhhhhhhcc--CCCCEEEChhhHHHHHHHHHccCChhHHHHHHHHcCCCCcc
Q psy2651          81 FSSILDQRFNGKLHKKEDFKPFSIQLSTLVEWNLAAN--KKENAIISPFSLHVVLGLASFGAAGSTAEAMMKGLRIKHSE  158 (342)
Q Consensus        81 ~~~~~~~~Fa~~L~~~~~~~~~~~~~~~~~~~~l~~~--~~~Niv~SP~sI~~aLamL~~GA~G~T~~qL~~~Lgl~~~~  158 (342)
                      ++++.+ +||++|||                 +++..  +++|+||||+||+.+|+||++||+|+|++||.++||++...
T Consensus        46 l~~~~~-~Fa~~l~~-----------------~l~~~~~~~~N~v~SP~si~~aLa~l~~GA~g~T~~el~~~L~~~~~~  107 (426)
T d2b5ti1          46 LSKANS-RFATTFYQ-----------------HLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTIS  107 (426)
T ss_dssp             HHHHHH-HHHHHHHH-----------------HHHHTSCTTSCEEECHHHHHHHHHHHHTTCCHHHHHHHHHHTTGGGSC
T ss_pred             HHHHHH-HHHHHHHH-----------------HHHhcCCCCCEEEECHHHHHHHHHHHHHhCchHHHHHHHHhcCCCCCC
Confidence            556666 99999999                 88754  68899999999999999999999999999999999997543


Q ss_pred             cchhcccchhHHHHHHHHHHHHHhCCCc----chhhhhhhhhccCcccchHHHHHhhhhcccccEEecCCCc-HHHHHhh
Q psy2651         159 TLLKDYKGIIDQLSKDYKGIIDQLSKSP----ELKIANKIYFAKDIELNPAYQTQAVDNFNSELGKVDFSQP-PAAAKEM  233 (342)
Q Consensus       159 ~~~~~~~~~~~~v~~~~~~l~~~l~~~~----~l~~an~lfv~~~~~l~~~F~~~~~~~y~a~v~~vdF~~~-~~a~~~I  233 (342)
                      ...      .+.++..++.+...+....    .+.++|+||++++++++++|++.++++|+++++.+||.++ +.++..|
T Consensus       108 ~~~------~~~~~~~~~~l~~~l~~~~~~~~~l~~an~l~v~~~~~~~~~f~~~~~~~y~a~~~~vdF~~~~~~a~~~I  181 (426)
T d2b5ti1         108 EKT------SDQIHFFFAKLNCRLYRKANKASKLVSANRLFGDKSLTFNETYQDISELVYGAKLQPLDFKENAEQSRAAI  181 (426)
T ss_dssp             HHH------HHTHHHHHHHHHHHHTSCCCSSEEEEEEEEEEEETTSCCCHHHHHHHHHHHSSCCEEECTTTCHHHHHHHH
T ss_pred             cch------HHHHHHHHHHHHHHHhccCCCCcEEeeeehhhhcccccchHHHHHHHHHhcCCeEEEecccccHHHHHHHH
Confidence            111      1127888888887764322    7999999999999999999999999999999999999875 5678899


Q ss_pred             chhhhcccCCccccCCCCCCCCcccceeeeeeccccccccccCCCCCCcccCeeecCCCeEEEeeeeecceeeeEEEeCC
Q psy2651         234 NDWVSNHTNDKIKDLIKADSLDASTKLVLINAIHFKGKWTVPFKPEATKDGPFYLDDTNSVQVPLMFVKDSFYMYEEAGE  313 (342)
Q Consensus       234 N~WV~~~T~g~I~~ll~~~~i~~~t~lvLvNaiyFkg~W~~~F~~~~T~~~~F~~~~g~~~~VpMM~~~~~~f~y~~~~~  313 (342)
                      |+||+++|+|+|++++++++++++|.++|+||+||||.|+++|++..|..++|+..+|+.++||||++.+. |+|++.++
T Consensus       182 N~wv~~~T~g~I~~~~~~~~l~~~t~l~Lvna~yFkg~W~~~F~~~~T~~~~F~~~~~~~v~v~mM~~~~~-~~~~~~~~  260 (426)
T d2b5ti1         182 NKWVSNKTEGRITDVIPSEAINELTVLVLVNTIYFKGLWKSKFSPENTRKELFYKADGESCSASMMYQEGK-FRYRRVAE  260 (426)
T ss_dssp             HHHHHHHTTTSCSCSSCTTCSCTTCCEEEEEEEEEEEEBSSCCCGGGCEEEEECCSSSCCEEEEEEEEEEE-EEEEECGG
T ss_pred             HHHHHHhcCCCccCCCCccCCCchhHHHHHhhhhhccccccCccccccccceeecCCCeEEEeecceeecc-eeeEEccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999998 99988755


Q ss_pred             CCeEEEEEeC-CCcEEEEEeecCCCCCCC
Q psy2651         314 DGFKMLELPY-GVSISFIIKSQVVPEMGR  341 (342)
Q Consensus       314 l~~~vLELPY-~~~~SMlI~~~ILP~~g~  341 (342)
                       ++++||||| ++++||+|   |||+++.
T Consensus       261 -~~~vveLPy~~~~~sm~i---iLP~~~~  285 (426)
T d2b5ti1         261 -GTQVLELPFKGDDITMVL---ILPKPEK  285 (426)
T ss_dssp             -GCEEEEEEBTTSSEEEEE---EECCSSS
T ss_pred             -CeEEEEeecCCCceEEEE---EecCCCC
Confidence             899999999 99999999   8999764



>d1lj5a_ e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9oi_ e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornworm (Manduca sexta) [TaxId: 7130]} Back     information, alignment and structure
>d1uhga_ e.1.1.1 (A:) Ovalbumin {Hen (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1by7a_ e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmja_ e.1.1.1 (A:) Heparin cofactor II (Hc-II, leuserpin 2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqga_ e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1imva_ e.1.1.1 (A:) Pigment epithelium-derived factor, PEDF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qlpa_ e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure