Psyllid ID: psy2651
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 342 | ||||||
| 118421175 | 378 | serpin [Anopheles sinensis] | 0.666 | 0.603 | 0.4 | 1e-40 | |
| 170058774 | 377 | serine protease inhibitor 4, serpin-4 [C | 0.652 | 0.591 | 0.409 | 2e-37 | |
| 157116803 | 379 | serine protease inhibitor 4, serpin-4 [A | 0.608 | 0.548 | 0.415 | 1e-36 | |
| 157116799 | 376 | serine protease inhibitor 4, serpin-4 [A | 0.608 | 0.553 | 0.415 | 1e-36 | |
| 157116805 | 373 | serine protease inhibitor 4, serpin-4 [A | 0.608 | 0.557 | 0.415 | 2e-36 | |
| 157116801 | 386 | serine protease inhibitor 4, serpin-4 [A | 0.608 | 0.538 | 0.415 | 2e-36 | |
| 187441032 | 241 | SRPN10 protein [Anopheles gambiae] | 0.593 | 0.842 | 0.405 | 2e-35 | |
| 187441010 | 241 | SRPN10 protein [Anopheles arabiensis] gi | 0.593 | 0.842 | 0.405 | 2e-35 | |
| 187441022 | 241 | SRPN10 protein [Anopheles gambiae] gi|18 | 0.593 | 0.842 | 0.405 | 2e-35 | |
| 187441004 | 241 | SRPN10 protein [Anopheles arabiensis] gi | 0.593 | 0.842 | 0.405 | 2e-35 |
| >gi|118421175|gb|ABK88283.1| serpin [Anopheles sinensis] | Back alignment and taxonomy information |
|---|
Score = 173 bits (439), Expect = 1e-40, Method: Compositional matrix adjust.
Identities = 98/245 (40%), Positives = 141/245 (57%), Gaps = 17/245 (6%)
Query: 82 SSILDQRFNGKLHKKEDFKPFSIQLSTLVEWNLAANKKENAIISPFSLHVVLGLASFGAA 141
S +D++F G+ ++ F+I+L LV A N EN +ISPFS+ L LA+ GA
Sbjct: 2 SEAVDRQFVGQSNE------FAIKLFQLVS---AQNAGENVVISPFSISACLSLAAMGAG 52
Query: 142 GSTAEAMMKGLRIKHSETLLKDYKGIIDQLSKDYKGIIDQLSKSPELKIANKIYFAKDIE 201
G TAE M GL + + + ++ +Y+ ++ +L + +ANKIY K+
Sbjct: 53 GLTAEQMFTGLNYGSAGS-------VKSTVADNYRRLLTRLDSDSTVNVANKIYVMKNYG 105
Query: 202 LNPAYQTQAVDNFNSELGKVDFSQPPAAAKEMNDWVSNHTNDKIKDLIKADSLDASTKLV 261
+ A+ A D+F SE VDF+Q AAAK +N WV + TN+KIKDLI DSLD +++V
Sbjct: 106 IKSAFNAIATDSFRSEAESVDFAQSVAAAKTINGWVESKTNNKIKDLISPDSLDDLSRMV 165
Query: 262 LINAIHFKGKWTVPFKPEATKDGPFYLDDTNSVQVPLMFVKDSFYMYEEAGEDGFKMLEL 321
L+NA+HFKG WT F P+ T+ PF+ +T S VP+M +K F Y + GF LEL
Sbjct: 166 LVNAVHFKGTWTYQFNPQLTRPFPFWTSETESRDVPMMNIKKEF-AYNNFEDQGFSALEL 224
Query: 322 PYGVS 326
YG S
Sbjct: 225 TYGGS 229
|
Source: Anopheles sinensis Species: Anopheles sinensis Genus: Anopheles Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|170058774|ref|XP_001865070.1| serine protease inhibitor 4, serpin-4 [Culex quinquefasciatus] gi|167877746|gb|EDS41129.1| serine protease inhibitor 4, serpin-4 [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|157116803|ref|XP_001658643.1| serine protease inhibitor 4, serpin-4 [Aedes aegypti] gi|108876284|gb|EAT40509.1| AAEL007765-PD [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|157116799|ref|XP_001658641.1| serine protease inhibitor 4, serpin-4 [Aedes aegypti] gi|108876282|gb|EAT40507.1| AAEL007765-PC [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|157116805|ref|XP_001658644.1| serine protease inhibitor 4, serpin-4 [Aedes aegypti] gi|108876285|gb|EAT40510.1| AAEL007765-PB [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|157116801|ref|XP_001658642.1| serine protease inhibitor 4, serpin-4 [Aedes aegypti] gi|108876283|gb|EAT40508.1| AAEL007765-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|187441032|emb|CAO83830.1| SRPN10 protein [Anopheles gambiae] | Back alignment and taxonomy information |
|---|
| >gi|187441010|emb|CAO83819.1| SRPN10 protein [Anopheles arabiensis] gi|187441016|emb|CAO83822.1| SRPN10 protein [Anopheles arabiensis] | Back alignment and taxonomy information |
|---|
| >gi|187441022|emb|CAO83825.1| SRPN10 protein [Anopheles gambiae] gi|187441026|emb|CAO83827.1| SRPN10 protein [Anopheles gambiae] gi|187441030|emb|CAO83829.1| SRPN10 protein [Anopheles gambiae] | Back alignment and taxonomy information |
|---|
| >gi|187441004|emb|CAO83816.1| SRPN10 protein [Anopheles arabiensis] gi|187441006|emb|CAO83817.1| SRPN10 protein [Anopheles arabiensis] gi|187441008|emb|CAO83818.1| SRPN10 protein [Anopheles arabiensis] gi|187441012|emb|CAO83820.1| SRPN10 protein [Anopheles arabiensis] gi|187441014|emb|CAO83821.1| SRPN10 protein [Anopheles arabiensis] gi|187441018|emb|CAO83823.1| SRPN10 protein [Anopheles arabiensis] gi|187441020|emb|CAO83824.1| SRPN10 protein [Anopheles gambiae] gi|187441024|emb|CAO83826.1| SRPN10 protein [Anopheles gambiae] gi|187441028|emb|CAO83828.1| SRPN10 protein [Anopheles gambiae] gi|187441034|emb|CAO83831.1| SRPN10 protein [Anopheles gambiae] gi|187441036|emb|CAO83832.1| SRPN10 protein [Anopheles gambiae] gi|187441038|emb|CAO83833.1| SRPN10 protein [Anopheles gambiae] gi|187441040|emb|CAO83834.1| SRPN10 protein [Anopheles gambiae] gi|187441044|emb|CAO83836.1| SRPN10 protein [Anopheles gambiae] gi|187441046|emb|CAO83837.1| SRPN10 protein [Anopheles gambiae] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 342 | ||||||
| UNIPROTKB|Q8WSX7 | 395 | spi21F "AGAP005246-PA" [Anophe | 0.593 | 0.513 | 0.405 | 4.4e-36 | |
| FB|FBgn0024294 | 393 | Spn43Aa "Serpin 43Aa" [Drosoph | 0.614 | 0.534 | 0.358 | 8.8e-31 | |
| RGD|619896 | 410 | Serpini1 "serpin peptidase inh | 0.654 | 0.546 | 0.326 | 3e-30 | |
| UNIPROTKB|E2RLA3 | 410 | SERPINI1 "Uncharacterized prot | 0.628 | 0.524 | 0.347 | 4.9e-30 | |
| UNIPROTKB|Q99574 | 410 | SERPINI1 "Neuroserpin" [Homo s | 0.716 | 0.597 | 0.309 | 4.9e-30 | |
| UNIPROTKB|F1SH33 | 410 | SERPINI1 "Uncharacterized prot | 0.695 | 0.580 | 0.325 | 6.2e-30 | |
| UNIPROTKB|E1BCA5 | 410 | SERPINI1 "Uncharacterized prot | 0.634 | 0.529 | 0.337 | 1.3e-29 | |
| MGI|MGI:1194506 | 410 | Serpini1 "serine (or cysteine) | 0.643 | 0.536 | 0.325 | 1.3e-29 | |
| MGI|MGI:2182838 | 445 | Serpina3f "serine (or cysteine | 0.634 | 0.487 | 0.331 | 5.6e-29 | |
| UNIPROTKB|Q90935 | 410 | SERPINI1 "Neuroserpin" [Gallus | 0.675 | 0.563 | 0.334 | 7.1e-29 |
| UNIPROTKB|Q8WSX7 spi21F "AGAP005246-PA" [Anopheles gambiae (taxid:7165)] | Back alignment and assigned GO terms |
|---|
Score = 389 (142.0 bits), Expect = 4.4e-36, P = 4.4e-36
Identities = 86/212 (40%), Positives = 124/212 (58%)
Query: 115 AANKKENAIISPFSLHVVLGLASFGAAGSTAEAMMKGLRIKHSETLLKDYKGIIDQLSKD 174
A + EN +ISPFS+ L LA+ GA G TAE M L E D K + + +
Sbjct: 29 AKHAGENVVISPFSISACLSLAAMGAGGLTAEQMYSVL-----EFGAPDRKQTV---ADN 80
Query: 175 YKGIIDQLSKSPELKIANKIYFAKDIELNPAYQTQAVDNFNSELGKVDFSQPPAAAKEMN 234
Y+ ++++L+ + +ANKIY ++ + A+ A +F SE V+F++ AAAK++N
Sbjct: 81 YRRLMERLATDSTVNVANKIYVMQNYAVKGAFNAIATGSFRSEAESVNFAESAAAAKKIN 140
Query: 235 DWVSNHTNDKIKDLIKADSLDASTKLVLINAIHFKGKWTVPFKPEATKDGPFYLDDTNSV 294
WV TN+KIKDLI D+LD +++VL+NA+HFKG WT F P T+ PF+L +T S
Sbjct: 141 GWVEEKTNNKIKDLISPDALDELSRMVLVNAVHFKGTWTYQFDPSLTRPFPFWLSETESR 200
Query: 295 QVPLMFVKDSFYMYEEAGEDGFKMLELPYGVS 326
VP+M +K F + E GF LEL YG S
Sbjct: 201 DVPMMNIKKHF-AFNNFEELGFSALELTYGGS 231
|
|
| FB|FBgn0024294 Spn43Aa "Serpin 43Aa" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| RGD|619896 Serpini1 "serpin peptidase inhibitor, clade I (neuroserpin), member 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RLA3 SERPINI1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q99574 SERPINI1 "Neuroserpin" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SH33 SERPINI1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BCA5 SERPINI1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1194506 Serpini1 "serine (or cysteine) peptidase inhibitor, clade I, member 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2182838 Serpina3f "serine (or cysteine) peptidase inhibitor, clade A, member 3F" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q90935 SERPINI1 "Neuroserpin" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 342 | |||
| pfam00079 | 369 | pfam00079, Serpin, Serpin (serine protease inhibit | 6e-72 | |
| cd00172 | 364 | cd00172, SERPIN, SERine Proteinase INhibitors (ser | 6e-69 | |
| smart00093 | 359 | smart00093, SERPIN, SERine Proteinase INhibitors | 6e-56 | |
| cd02049 | 364 | cd02049, bacterial_SERPIN, SERine Proteinase INhib | 5e-44 | |
| cd02043 | 381 | cd02043, plant_SERPIN, SERine Proteinase INhibitor | 8e-41 | |
| cd02048 | 388 | cd02048, neuroserpin, Neuroserpin is a inhibitory | 7e-39 | |
| cd02051 | 377 | cd02051, PAI-1_nexin-1, Plasminogen activator inhi | 9e-39 | |
| cd02058 | 380 | cd02058, PAI-2, Plasminogen Activator Inhibitor-2 | 6e-38 | |
| cd02059 | 389 | cd02059, ovalbumin_like, The ovalbumin_like group | 4e-31 | |
| cd02056 | 361 | cd02056, alpha-1-antitrypsin_like, alpha-1-antitry | 4e-31 | |
| cd02044 | 370 | cd02044, ov-serpin, ovalbumin family of serpins (o | 3e-30 | |
| COG4826 | 410 | COG4826, COG4826, Serine protease inhibitor [Postt | 3e-30 | |
| cd02045 | 381 | cd02045, antithrombin-III_like, Antithrombin is a | 6e-29 | |
| cd02055 | 365 | cd02055, PZI, Protein Z-dependent protease inhibit | 3e-22 | |
| cd02050 | 352 | cd02050, C1_inh, C1 inhibitor (C1-Inh) is a protea | 5e-19 | |
| cd02053 | 351 | cd02053, alpha2AP, Alpha2-antiplasmin (alpha2AP) i | 7e-18 | |
| cd02052 | 374 | cd02052, PEDF, Pigment epithelium-derived factor ( | 6e-17 | |
| cd02057 | 372 | cd02057, maspin_like, Maspin (mammary serine prote | 1e-16 | |
| cd02047 | 436 | cd02047, HCII, Heparin cofactor II (HCII) inhibits | 7e-14 | |
| cd02046 | 366 | cd02046, hsp47, Heat shock protein 47 (Hsp47), als | 8e-13 | |
| cd02054 | 372 | cd02054, angiotensinogen, Angiotensinogen is part | 4e-12 | |
| PHA02948 | 373 | PHA02948, PHA02948, serine protease inhibitor-like | 5e-04 |
| >gnl|CDD|215699 pfam00079, Serpin, Serpin (serine protease inhibitor) | Back alignment and domain information |
|---|
Score = 227 bits (581), Expect = 6e-72
Identities = 83/219 (37%), Positives = 125/219 (57%), Gaps = 11/219 (5%)
Query: 115 AANKKENAIISPFSLHVVLGLASFGAAGSTAEAMMKGLRIKHS--ETLLKDYKGIIDQLS 172
+ +N SP S+ L + GA G TAE ++ L E + + ++ ++ L+
Sbjct: 16 KESPDKNIFFSPLSISTALAMLYLGARGETAEQLLSVLGFPELDDEEIHEGFQSLLSSLN 75
Query: 173 KDYKGIIDQLSKSPELKIANKIYFAKDIELNPAYQTQAVDNFNSELGKVDFSQPPAAAKE 232
K KG LKIAN+++ K ++L P + + +E+ VDFS P A K+
Sbjct: 76 KPDKG--------YTLKIANRLFVDKGLKLKPDFLQLLKKYYGAEVESVDFSDPAEARKQ 127
Query: 233 MNDWVSNHTNDKIKDLIKADSLDASTKLVLINAIHFKGKWTVPFKPEATKDGPFYLDDTN 292
+N WV TN KIKDL+ SLD T+LVL+NAI+FKGKW PF PE TK+ PF++D+
Sbjct: 128 INSWVEKKTNGKIKDLLPEGSLDPDTRLVLVNAIYFKGKWKTPFDPELTKEEPFHVDNGT 187
Query: 293 SVQVPLMFVKDSFYMYEEAGEDGFKMLELPYGVSISFII 331
+V+VP+M + +F E+ E G K+LELPY ++S +I
Sbjct: 188 TVKVPMMSQEGTFRYAEDE-ELGCKVLELPYKGNLSMLI 225
|
Structure is a multi-domain fold containing a bundle of helices and a beta sandwich. Length = 369 |
| >gnl|CDD|238101 cd00172, SERPIN, SERine Proteinase INhibitors (serpins) exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms | Back alignment and domain information |
|---|
| >gnl|CDD|214513 smart00093, SERPIN, SERine Proteinase INhibitors | Back alignment and domain information |
|---|
| >gnl|CDD|239004 cd02049, bacterial_SERPIN, SERine Proteinase INhibitors (serpins), prokaryotic subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238998 cd02043, plant_SERPIN, SERine Proteinase INhibitors (serpins), plant specific subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|239003 cd02048, neuroserpin, Neuroserpin is a inhibitory member of the SERine Proteinase INhibitor (serpin) family that reacts preferentially with tissue-type plasminogen activator (tPA) | Back alignment and domain information |
|---|
| >gnl|CDD|239006 cd02051, PAI-1_nexin-1, Plasminogen activator inhibitor-1_like | Back alignment and domain information |
|---|
| >gnl|CDD|239013 cd02058, PAI-2, Plasminogen Activator Inhibitor-2 (PAI-2) | Back alignment and domain information |
|---|
| >gnl|CDD|239014 cd02059, ovalbumin_like, The ovalbumin_like group of serpins contains ovalbumin, the squamous cell carcinoma antigen 1 (SCCA1) and other closely related serpins of clade B of the serpin superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|239011 cd02056, alpha-1-antitrypsin_like, alpha-1-antitrypsin_like | Back alignment and domain information |
|---|
| >gnl|CDD|238999 cd02044, ov-serpin, ovalbumin family of serpins (ov-serpins) | Back alignment and domain information |
|---|
| >gnl|CDD|227163 COG4826, COG4826, Serine protease inhibitor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|239000 cd02045, antithrombin-III_like, Antithrombin is a serine proteinase inhibitor (serpin) which controls the process of coagulation | Back alignment and domain information |
|---|
| >gnl|CDD|239010 cd02055, PZI, Protein Z-dependent protease inhibitor (ZPI) is a member of the serpin superfamily of proteinase inhibitors (clade A10) | Back alignment and domain information |
|---|
| >gnl|CDD|239005 cd02050, C1_inh, C1 inhibitor (C1-Inh) is a protease inhibitor of the serpin family | Back alignment and domain information |
|---|
| >gnl|CDD|239008 cd02053, alpha2AP, Alpha2-antiplasmin (alpha2AP) is the primary inhibitor of plasmin, a proteinase that digests fibrin, the main component of blood clots | Back alignment and domain information |
|---|
| >gnl|CDD|239007 cd02052, PEDF, Pigment epithelium-derived factor (PEDF)_like | Back alignment and domain information |
|---|
| >gnl|CDD|239012 cd02057, maspin_like, Maspin (mammary serine proteinase inhibitor), a member of the serpin superfamily, with a multitude of effects on cells and tissues at an assortment of developmental stages | Back alignment and domain information |
|---|
| >gnl|CDD|239002 cd02047, HCII, Heparin cofactor II (HCII) inhibits thrombin, the final protease of the coagulation cascade | Back alignment and domain information |
|---|
| >gnl|CDD|239001 cd02046, hsp47, Heat shock protein 47 (Hsp47), also called colligin, because of its collagen binding ability, is a chaperone specific for procollagen | Back alignment and domain information |
|---|
| >gnl|CDD|239009 cd02054, angiotensinogen, Angiotensinogen is part of the renin-angiotensin system (RAS), which plays an important role in blood pressure regulation, renal haemodynamics, fluid and electrolyte homeostasis | Back alignment and domain information |
|---|
| >gnl|CDD|165258 PHA02948, PHA02948, serine protease inhibitor-like protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 342 | |||
| cd02057 | 372 | maspin_like Maspin (mammary serine proteinase inhi | 100.0 | |
| cd02048 | 388 | neuroserpin Neuroserpin is a inhibitory member of | 100.0 | |
| cd00172 | 364 | SERPIN SERine Proteinase INhibitors (serpins) exhi | 100.0 | |
| COG4826 | 410 | Serine protease inhibitor [Posttranslational modif | 100.0 | |
| cd02044 | 370 | ov-serpin ovalbumin family of serpins (ov-serpins) | 100.0 | |
| cd02054 | 372 | angiotensinogen Angiotensinogen is part of the ren | 100.0 | |
| cd02046 | 366 | hsp47 Heat shock protein 47 (Hsp47), also called c | 100.0 | |
| cd02059 | 389 | ovalbumin_like The ovalbumin_like group of serpins | 100.0 | |
| cd02058 | 380 | PAI-2 Plasminogen Activator Inhibitor-2 (PAI-2). P | 100.0 | |
| cd02056 | 361 | alpha-1-antitrypsin_like alpha-1-antitrypsin_like. | 100.0 | |
| cd02045 | 381 | antithrombin-III_like Antithrombin is a serine pro | 100.0 | |
| cd02051 | 377 | PAI-1_nexin-1 Plasminogen activator inhibitor-1_li | 100.0 | |
| KOG2392|consensus | 380 | 100.0 | ||
| cd02052 | 374 | PEDF Pigment epithelium-derived factor (PEDF)_like | 100.0 | |
| cd02049 | 364 | bacterial_SERPIN SERine Proteinase INhibitors (ser | 100.0 | |
| cd02055 | 365 | PZI Protein Z-dependent protease inhibitor (ZPI) i | 100.0 | |
| smart00093 | 359 | SERPIN SERine Proteinase INhibitors. | 100.0 | |
| PF00079 | 371 | Serpin: Serpin (serine protease inhibitor); InterP | 100.0 | |
| cd02047 | 436 | HCII Heparin cofactor II (HCII) inhibits thrombin, | 100.0 | |
| cd02043 | 381 | plant_SERPIN SERine Proteinase INhibitors (serpins | 100.0 | |
| PHA02948 | 373 | serine protease inhibitor-like protein; Provisiona | 100.0 | |
| cd02053 | 351 | alpha2AP Alpha2-antiplasmin (alpha2AP) is the prim | 100.0 | |
| cd02050 | 352 | C1_inh C1 inhibitor (C1-Inh) is a protease inhibit | 100.0 | |
| PHA02660 | 364 | serpin-like protein; Provisional | 100.0 |
| >cd02057 maspin_like Maspin (mammary serine proteinase inhibitor), a member of the serpin superfamily, with a multitude of effects on cells and tissues at an assortment of developmental stages | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.5e-48 Score=383.20 Aligned_cols=220 Identities=26% Similarity=0.482 Sum_probs=204.1
Q ss_pred cccccccccccCCcchhhhhhhhhhhhhcc-CCCCEEEChhhHHHHHHHHHccCChhHHHHHHHHcCCCCcccchhcccc
Q psy2651 88 RFNGKLHKKEDFKPFSIQLSTLVEWNLAAN-KKENAIISPFSLHVVLGLASFGAAGSTAEAMMKGLRIKHSETLLKDYKG 166 (342)
Q Consensus 88 ~Fa~~L~~~~~~~~~~~~~~~~~~~~l~~~-~~~Niv~SP~sI~~aLamL~~GA~G~T~~qL~~~Lgl~~~~~~~~~~~~ 166 (342)
+||++||+ ++... +++|+|+||+||+.+|+||+.||+|+|++||.++||++... +
T Consensus 7 ~F~~~l~~-----------------~~~~~~~~~Nvv~SP~si~~aL~ml~~Ga~g~T~~el~~~L~~~~~~--~----- 62 (372)
T cd02057 7 AFAVDLFK-----------------KLCEKEPTGNVVFSPICLSTSLALAQVGAKGDTANEIGKVLHFENVK--D----- 62 (372)
T ss_pred HHHHHHHH-----------------HHhccCCCCcEEECHHHHHHHHHHHHhhcCCcHHHHHHHHhCCCChh--H-----
Confidence 89999999 88765 78999999999999999999999999999999999997433 3
Q ss_pred hhHHHHHHHHHHHHHhCCCc---chhhhhhhhhccCcccchHHHHHhhhhcccccEEecCCCc-HHHHHhhchhhhcccC
Q psy2651 167 IIDQLSKDYKGIIDQLSKSP---ELKIANKIYFAKDIELNPAYQTQAVDNFNSELGKVDFSQP-PAAAKEMNDWVSNHTN 242 (342)
Q Consensus 167 ~~~~v~~~~~~l~~~l~~~~---~l~~an~lfv~~~~~l~~~F~~~~~~~y~a~v~~vdF~~~-~~a~~~IN~WV~~~T~ 242 (342)
++..++.+...+.+.. .++++|++|++++++++++|.+.++++|+++++.+||.+. ..+++.||+||+++|+
T Consensus 63 ----~~~~~~~~~~~~~~~~~~~~l~~an~l~v~~~~~~~~~f~~~~~~~y~~~~~~vdF~~~~~~a~~~IN~wv~~~T~ 138 (372)
T cd02057 63 ----VPFGFQTVTSDVSKLSSFYSLKLIKRLYVDKSLNLSTDFINSTKRPYPKELETVDFKDKLEETRGQINNSIKELTD 138 (372)
T ss_pred ----HHHHHHHHHHHHhcCCccchhHhhhhhhhhCCCCccHHHHHHHHHHhcCeeEEecCCCCHHHHHHHHHHHHHHhcc
Confidence 6777888877765432 7999999999999999999999999999999999999765 5688999999999999
Q ss_pred CccccCCCCCCCCcccceeeeeeccccccccccCCCCCCcccCeeecCCCeEEEeeeeecceeeeEEEeCCCCeEEEEEe
Q psy2651 243 DKIKDLIKADSLDASTKLVLINAIHFKGKWTVPFKPEATKDGPFYLDDTNSVQVPLMFVKDSFYMYEEAGEDGFKMLELP 322 (342)
Q Consensus 243 g~I~~ll~~~~i~~~t~lvLvNaiyFkg~W~~~F~~~~T~~~~F~~~~g~~~~VpMM~~~~~~f~y~~~~~l~~~vLELP 322 (342)
|+|++++++++++++|+++|+||+||||.|+++|++..|++++||.++|+.++||||++.+. |+|+++++++++|||||
T Consensus 139 g~I~~l~~~~~i~~~t~l~lvNa~yFkg~W~~~F~~~~T~~~~F~~~~~~~~~V~mM~~~~~-~~~~~~~~~~~~vv~LP 217 (372)
T cd02057 139 GHFENILNENSVNDQTKILVVNAAYFVGNWMKKFPESETKECPFRVNKTETKPVQMMNLEAT-FSMGYIDELNTKILELP 217 (372)
T ss_pred ChhhhcCCCCCCCCCCceeeeehheeccccCCCCCccccccCCCEECCCceEeeEhhheece-EEeEEeCCcCceEEEee
Confidence 99999999889999999999999999999999999999999999999999999999999998 99999999999999999
Q ss_pred C-CCcEEEEEeecCCCCC
Q psy2651 323 Y-GVSISFIIKSQVVPEM 339 (342)
Q Consensus 323 Y-~~~~SMlI~~~ILP~~ 339 (342)
| ++++||+| |||++
T Consensus 218 y~~~~~sm~i---iLP~~ 232 (372)
T cd02057 218 FQNKHLSMLI---LLPKD 232 (372)
T ss_pred cCCCCEEEEE---EecCc
Confidence 9 99999999 89985
|
Maspin has tumor suppressing activity against breast and prostate cancer. In general, SERine Proteinase INhibitors (serpins) exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms. Many serpins, such as antitrypsin and antichymotrypsin, function as serine protease inhibitors which regulate blood coagulation cascades. Non-inhibitory serpins perform many diverse functions such as chaperoning proteins or transporting hormones. |
| >cd02048 neuroserpin Neuroserpin is a inhibitory member of the SERine Proteinase INhibitor (serpin) family that reacts preferentially with tissue-type plasminogen activator (tPA) | Back alignment and domain information |
|---|
| >cd00172 SERPIN SERine Proteinase INhibitors (serpins) exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms | Back alignment and domain information |
|---|
| >COG4826 Serine protease inhibitor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02044 ov-serpin ovalbumin family of serpins (ov-serpins) | Back alignment and domain information |
|---|
| >cd02054 angiotensinogen Angiotensinogen is part of the renin-angiotensin system (RAS), which plays an important role in blood pressure regulation, renal haemodynamics, fluid and electrolyte homeostasis | Back alignment and domain information |
|---|
| >cd02046 hsp47 Heat shock protein 47 (Hsp47), also called colligin, because of its collagen binding ability, is a chaperone specific for procollagen | Back alignment and domain information |
|---|
| >cd02059 ovalbumin_like The ovalbumin_like group of serpins contains ovalbumin, the squamous cell carcinoma antigen 1 (SCCA1) and other closely related serpins of clade B of the serpin superfamily | Back alignment and domain information |
|---|
| >cd02058 PAI-2 Plasminogen Activator Inhibitor-2 (PAI-2) | Back alignment and domain information |
|---|
| >cd02056 alpha-1-antitrypsin_like alpha-1-antitrypsin_like | Back alignment and domain information |
|---|
| >cd02045 antithrombin-III_like Antithrombin is a serine proteinase inhibitor (serpin) which controls the process of coagulation | Back alignment and domain information |
|---|
| >cd02051 PAI-1_nexin-1 Plasminogen activator inhibitor-1_like | Back alignment and domain information |
|---|
| >KOG2392|consensus | Back alignment and domain information |
|---|
| >cd02052 PEDF Pigment epithelium-derived factor (PEDF)_like | Back alignment and domain information |
|---|
| >cd02049 bacterial_SERPIN SERine Proteinase INhibitors (serpins), prokaryotic subgroup | Back alignment and domain information |
|---|
| >cd02055 PZI Protein Z-dependent protease inhibitor (ZPI) is a member of the serpin superfamily of proteinase inhibitors (clade A10) | Back alignment and domain information |
|---|
| >smart00093 SERPIN SERine Proteinase INhibitors | Back alignment and domain information |
|---|
| >PF00079 Serpin: Serpin (serine protease inhibitor); InterPro: IPR023796 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively | Back alignment and domain information |
|---|
| >cd02047 HCII Heparin cofactor II (HCII) inhibits thrombin, the final protease of the coagulation cascade | Back alignment and domain information |
|---|
| >cd02043 plant_SERPIN SERine Proteinase INhibitors (serpins), plant specific subgroup | Back alignment and domain information |
|---|
| >PHA02948 serine protease inhibitor-like protein; Provisional | Back alignment and domain information |
|---|
| >cd02053 alpha2AP Alpha2-antiplasmin (alpha2AP) is the primary inhibitor of plasmin, a proteinase that digests fibrin, the main component of blood clots | Back alignment and domain information |
|---|
| >cd02050 C1_inh C1 inhibitor (C1-Inh) is a protease inhibitor of the serpin family | Back alignment and domain information |
|---|
| >PHA02660 serpin-like protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 342 | ||||
| 3f5n_A | 407 | Structure Of Native Human Neuroserpin Length = 407 | 9e-31 | ||
| 3fgq_A | 397 | Crystal Structure Of Native Human Neuroserpin Lengt | 1e-30 | ||
| 3f02_A | 359 | Cleaved Human Neuroserpin Length = 359 | 1e-30 | ||
| 2dut_A | 423 | Crystal Structure Of A M-Loop Deletion Variant Of M | 9e-29 | ||
| 2h4q_A | 382 | Crystal Structure Of A M-Loop Deletion Variant Of M | 1e-28 | ||
| 1sek_A | 378 | The Structure Of Active Serpin K From Manduca Sexta | 3e-28 | ||
| 1k9o_I | 378 | Crystal Structure Of Michaelis Serpin-Trypsin Compl | 8e-28 | ||
| 3ozq_A | 376 | Crystal Structure Of Serpin48, Which Is A Highly Sp | 1e-27 | ||
| 2h4r_A | 415 | Crystal Structure Of Wildtype Ment In The Native Co | 1e-25 | ||
| 2h4p_A | 394 | Crystal Structure Of Wildtype Ment In The Cleaved C | 2e-25 | ||
| 1hle_A | 345 | Crystal Structure Of Cleaved Equine Leucocyte Elast | 8e-25 | ||
| 3lw2_A | 379 | Mouse Plasminogen Activator Inhibitor-1 (Pai-1) Len | 8e-25 | ||
| 1jjo_C | 261 | Crystal Structure Of Mouse Neuroserpin (Cleaved For | 1e-24 | ||
| 3le2_A | 393 | Structure Of Arabidopsis Atserpin1. Native Stressed | 2e-24 | ||
| 1c5g_A | 402 | Plasminogen Activator Inhibitor-1 Length = 402 | 6e-24 | ||
| 1dvn_A | 379 | Latent Form Of Plasminogen Activator Inhibitor-1 (P | 7e-24 | ||
| 9pai_A | 346 | Cleaved Substrate Variant Of Plasminogen Activator | 7e-24 | ||
| 1a7c_A | 379 | Human Plasminogen Activator Inhibitor Type-1 In Com | 7e-24 | ||
| 4aqh_A | 383 | Plasminogen Activator Inhibitor Type-1 In Complex W | 8e-24 | ||
| 1b3k_A | 379 | Plasminogen Activator Inhibitor-1 Length = 379 | 8e-24 | ||
| 3eox_A | 379 | High Quality Structure Of Cleaved Pai-1-Stab Length | 8e-24 | ||
| 3ut3_A | 375 | A Novel Pai-i Inhibitor And Its Structural Mechanis | 9e-24 | ||
| 1db2_A | 377 | Crystal Structure Of Native Plasminogen Activator I | 9e-24 | ||
| 3cvm_A | 392 | High Resolution Structure Of A Stable Plasminogen A | 9e-24 | ||
| 3r4l_A | 379 | Human Very Long Half Life Plasminogen Activator Inh | 2e-23 | ||
| 4dy0_A | 379 | Crystal Structure Of Native Protease Nexin-1 With H | 2e-23 | ||
| 1yxa_A | 398 | Serpina3n, A Murine Orthologue Of Human Antichymotr | 4e-23 | ||
| 1dvm_A | 379 | Active Form Of Human Pai-1 Length = 379 | 4e-23 | ||
| 4ga7_A | 389 | Crystal Structure Of Human Serpinb1 Mutant Length = | 7e-23 | ||
| 3caa_A | 341 | Cleaved Antichymotrypsin A347r Length = 341 | 7e-23 | ||
| 1as4_A | 341 | Cleaved Antichymotrypsin A349r Length = 341 | 7e-23 | ||
| 4caa_A | 341 | Cleaved Antichymotrypsin T345r Length = 341 | 8e-23 | ||
| 2ach_A | 360 | Crystal Structure Of Cleaved Human Alpha1-antichymo | 1e-22 | ||
| 3dlw_A | 411 | Antichymotrypsin Length = 411 | 1e-22 | ||
| 3q02_A | 379 | Crystal Structure Of Plasminogen Activator Inhibito | 1e-22 | ||
| 3pzf_A | 397 | 1.75a Resolution Structure Of Serpin-2 From Anophel | 4e-22 | ||
| 1qmn_A | 401 | Alpha1-Antichymotrypsin Serpin In The Delta Conform | 5e-22 | ||
| 4bb2_A | 340 | Crystal Structure Of Cleaved Corticosteroid-binding | 5e-21 | ||
| 2vdx_A | 373 | Crystal Structure Of The Reactive Loop Cleaved Cort | 1e-20 | ||
| 3nda_A | 377 | Crystal Structure Of Serpin From Tick Ixodes Ricinu | 2e-20 | ||
| 2zv6_A | 401 | Crystal Structure Of Human Squamous Cell Carcinoma | 3e-20 | ||
| 3vvj_A | 392 | Structure Of Ovalbumin From Emu (Dromaius Novaeholl | 4e-20 | ||
| 1att_A | 429 | Crystal Structure Of Cleaved Bovine Antithrombin Ii | 3e-19 | ||
| 2b4x_L | 427 | Crystal Structure Of Antithrombin-Iii Length = 427 | 4e-19 | ||
| 2hij_I | 432 | Crystal Structure Of P14 Alanine Variant Of Antithr | 5e-19 | ||
| 1ath_A | 432 | The Intact And Cleaved Human Antithrombin Iii Compl | 5e-19 | ||
| 1dzg_I | 432 | N135q-S380c-Antithrombin-Iii Length = 432 | 6e-19 | ||
| 1dzh_I | 432 | P14-Fluorescein-N135q-S380c-Antithrombin-Iii Length | 7e-19 | ||
| 2gd4_I | 443 | Crystal Structure Of The Antithrombin-S195a Factor | 8e-19 | ||
| 1by7_A | 382 | Human Plasminogen Activator Inhibitor-2. Loop (66-9 | 8e-19 | ||
| 1tb6_I | 432 | 2.5a Crystal Structure Of The Antithrombin-Thrombin | 9e-19 | ||
| 1oyh_I | 432 | Crystal Structure Of P13 Alanine Variant Of Antithr | 1e-18 | ||
| 3kcg_I | 432 | Crystal Structure Of The Antithrombin-Factor Ixa- P | 1e-18 | ||
| 2b4x_I | 427 | Crystal Structure Of Antithrombin-Iii Length = 427 | 2e-18 | ||
| 4if8_A | 414 | Structure Of Vaspin Length = 414 | 2e-18 | ||
| 3f1s_A | 385 | Crystal Structure Of Protein Z Complexed With Prote | 2e-18 | ||
| 3h5c_A | 423 | X-Ray Structure Of Protein Z-Protein Z Inhibitor Co | 2e-18 | ||
| 4afx_A | 387 | Crystal Structure Of The Reactive Loop Cleaved Zpi | 3e-18 | ||
| 2xn6_A | 350 | Crystal Structure Of Thyroxine-Binding Globulin Com | 3e-18 | ||
| 2arq_A | 382 | Human Plasminogen Activator Inhibitor-2.[loop (66-9 | 3e-18 | ||
| 2riw_A | 338 | The Reactive Loop Cleaved Human Thyroxine Binding G | 7e-18 | ||
| 2ceo_A | 379 | Thyroxine-Binding Globulin Complex With Thyroxine L | 8e-18 | ||
| 2riv_A | 343 | Crystal Structure Of The Reactive Loop Cleaved Huma | 9e-18 | ||
| 2xn5_A | 350 | Crystal Structure Of Thyroxine-Binding Globulin Com | 9e-18 | ||
| 1atu_A | 374 | Uncleaved Alpha-1-Antitrypsin Length = 374 | 2e-17 | ||
| 4eb1_I | 440 | Hyperstable In-Frame Insertion Variant Of Antithrom | 2e-17 | ||
| 2d26_A | 358 | Active Site Distortion Is Sufficient For Proteinase | 3e-17 | ||
| 1iz2_A | 394 | Interactions Causing The Kinetic Trap In Serpin Pro | 3e-17 | ||
| 1oo8_A | 394 | Crystal Structure Of A1pi-Pittsburgh In The Native | 4e-17 | ||
| 1kct_A | 394 | Alpha1-Antitrypsin Length = 394 | 6e-17 | ||
| 1qmb_A | 326 | Cleaved Alpha-1-Antitrypsin Polymer Length = 326 | 8e-17 | ||
| 1hp7_A | 394 | A 2.1 Angstrom Structure Of An Uncleaved Alpha-1-An | 2e-16 | ||
| 1ova_B | 386 | Crystal Structure Of Uncleaved Ovalbumin At 1.95 An | 2e-16 | ||
| 1ova_C | 386 | Crystal Structure Of Uncleaved Ovalbumin At 1.95 An | 2e-16 | ||
| 1ova_A | 386 | Crystal Structure Of Uncleaved Ovalbumin At 1.95 An | 2e-16 | ||
| 2v95_A | 371 | Struture Of Corticosteroid-Binding Globulin In Comp | 2e-16 | ||
| 1jti_A | 385 | Loop-Inserted Structure Of P1-P1' Cleaved Ovalbumin | 2e-16 | ||
| 1uhg_A | 385 | Crystal Structure Of S-ovalbumin At 1.9 Angstrom Re | 2e-16 | ||
| 1d5s_A | 334 | Crystal Structure Of Cleaved Antitrypsin Polymer Le | 4e-16 | ||
| 1ezx_A | 335 | Crystal Structure Of A Serpin:protease Complex Leng | 4e-16 | ||
| 7api_A | 347 | The S Variant Of Human Alpha1-Antitrypsin, Structur | 5e-16 | ||
| 2hi9_A | 363 | Crystal Structure Of Human Native Protein C Inhibit | 5e-16 | ||
| 3dy0_A | 336 | Crystal Structure Of Cleaved Pci Bound To Heparin L | 5e-16 | ||
| 1lq8_A | 346 | Crystal Structure Of Cleaved Protein C Inhibitor Le | 5e-16 | ||
| 3ndf_A | 343 | Cleaved Antitrypsin With P8-P6 Asp Length = 343 | 5e-16 | ||
| 2ol2_A | 395 | High Resolution Structure Of Native Pci In Space Gr | 6e-16 | ||
| 3t1p_A | 371 | Crystal Structure Of An Alpha-1-Antitrypsin Trimer | 6e-16 | ||
| 3ndd_A | 343 | Cleaved Antitrypsin With P10 Pro, And P9-P6 Asp Len | 6e-16 | ||
| 1psi_A | 394 | Intact Recombined Alpha1-Antitrypsin Mutant Phe 51 | 6e-16 | ||
| 3drm_A | 404 | 2.2 Angstrom Crystal Structure Of Thr114phe Alpha1- | 8e-16 | ||
| 3ne4_A | 424 | 1.8 Angstrom Structure Of Intact Native Wild-Type A | 8e-16 | ||
| 1qlp_A | 394 | 2.0 Angstrom Structure Of Intact Alpha-1-Antitrypsi | 9e-16 | ||
| 2qug_A | 394 | Crystal Structure Of Alpha-1-Antitrypsin, Crystal F | 1e-15 | ||
| 3dru_A | 404 | Crystal Structure Of Gly117phe Alpha1-Antitrypsin L | 2e-15 | ||
| 1xu8_A | 380 | The 2.8 A Structure Of A Tumour Suppressing Serpin | 7e-15 | ||
| 1wz9_A | 375 | The 2.1 A Structure Of A Tumour Suppressing Serpin | 1e-14 | ||
| 1xqg_A | 389 | 3.10 A Crystal Structure Of Maspin, Space Group P 4 | 2e-14 | ||
| 1f0c_A | 305 | Structure Of The Viral Serpin Crma Length = 305 | 6e-14 | ||
| 4ajt_A | 427 | The Cystal Structure Of Mouse Protein-Z Dependent P | 8e-14 | ||
| 1c8o_A | 300 | 2.9 A Structure Of Cleaved Viral Serpin Crma Length | 1e-13 | ||
| 1jmo_A | 480 | Crystal Structure Of The Heparin Cofactor Ii-S195a | 7e-13 | ||
| 1jmj_A | 480 | Crystal Structure Of Native Heparin Cofactor Ii Len | 1e-12 | ||
| 3sto_A | 406 | Serpin From The Trematode Schistosoma Haematobium L | 5e-12 | ||
| 1imv_A | 398 | 2.85 A Crystal Structure Of Pedf Length = 398 | 6e-11 | ||
| 2r9y_A | 430 | Structure Of Antiplasmin Length = 430 | 8e-11 | ||
| 4au2_A | 392 | Crystal Structure Of A Hsp47-Collagen Complex Lengt | 8e-11 | ||
| 2oay_A | 390 | Crystal Structure Of Latent Human C1-Inhibitor Leng | 2e-10 | ||
| 4au3_A | 392 | Crystal Structure Of A Hsp47-Collagen Complex Lengt | 5e-09 | ||
| 4au3_B | 392 | Crystal Structure Of A Hsp47-Collagen Complex Lengt | 5e-09 | ||
| 1m93_B | 245 | 1.65 A Structure Of Cleaved Viral Serpin Crma Lengt | 9e-09 | ||
| 2pef_A | 373 | Crystal Structure Of A Thermophilic Serpin, Tengpin | 2e-07 | ||
| 2pee_A | 387 | Crystal Structure Of A Thermophilic Serpin, Tengpin | 2e-07 | ||
| 2vh4_A | 381 | Structure Of A Loop C-sheet Serpin Polymer Length = | 2e-07 | ||
| 1mtp_A | 323 | The X-Ray Crystal Structure Of A Serpin From A Ther | 4e-07 | ||
| 1sng_A | 370 | Structure Of A Thermophilic Serpin In The Native St | 1e-06 |
| >pdb|3F5N|A Chain A, Structure Of Native Human Neuroserpin Length = 407 | Back alignment and structure |
|
| >pdb|3FGQ|A Chain A, Crystal Structure Of Native Human Neuroserpin Length = 397 | Back alignment and structure |
| >pdb|3F02|A Chain A, Cleaved Human Neuroserpin Length = 359 | Back alignment and structure |
| >pdb|2DUT|A Chain A, Crystal Structure Of A M-Loop Deletion Variant Of Ment In The Native Conformation Length = 423 | Back alignment and structure |
| >pdb|2H4Q|A Chain A, Crystal Structure Of A M-Loop Deletion Variant Of Ment In The Cleaved Conformation Length = 382 | Back alignment and structure |
| >pdb|1SEK|A Chain A, The Structure Of Active Serpin K From Manduca Sexta And A Model For Serpin-Protease Complex Formation Length = 378 | Back alignment and structure |
| >pdb|1K9O|I Chain I, Crystal Structure Of Michaelis Serpin-Trypsin Complex Length = 378 | Back alignment and structure |
| >pdb|3OZQ|A Chain A, Crystal Structure Of Serpin48, Which Is A Highly Specific Serpin In The Insect Tenebrio Molitor Length = 376 | Back alignment and structure |
| >pdb|2H4R|A Chain A, Crystal Structure Of Wildtype Ment In The Native Conformation Length = 415 | Back alignment and structure |
| >pdb|2H4P|A Chain A, Crystal Structure Of Wildtype Ment In The Cleaved Conformation Length = 394 | Back alignment and structure |
| >pdb|1HLE|A Chain A, Crystal Structure Of Cleaved Equine Leucocyte Elastase Inhibitor Determined At 1.95 Angstroms Resolution Length = 345 | Back alignment and structure |
| >pdb|3LW2|A Chain A, Mouse Plasminogen Activator Inhibitor-1 (Pai-1) Length = 379 | Back alignment and structure |
| >pdb|1JJO|C Chain C, Crystal Structure Of Mouse Neuroserpin (Cleaved Form) Length = 261 | Back alignment and structure |
| >pdb|3LE2|A Chain A, Structure Of Arabidopsis Atserpin1. Native Stressed Conforma Length = 393 | Back alignment and structure |
| >pdb|1C5G|A Chain A, Plasminogen Activator Inhibitor-1 Length = 402 | Back alignment and structure |
| >pdb|1DVN|A Chain A, Latent Form Of Plasminogen Activator Inhibitor-1 (Pai-1) Length = 379 | Back alignment and structure |
| >pdb|9PAI|A Chain A, Cleaved Substrate Variant Of Plasminogen Activator Inhibitor-1 Length = 346 | Back alignment and structure |
| >pdb|1A7C|A Chain A, Human Plasminogen Activator Inhibitor Type-1 In Complex With A Pentapeptide Length = 379 | Back alignment and structure |
| >pdb|4AQH|A Chain A, Plasminogen Activator Inhibitor Type-1 In Complex With The Inhibitor Az3976 Length = 383 | Back alignment and structure |
| >pdb|1B3K|A Chain A, Plasminogen Activator Inhibitor-1 Length = 379 | Back alignment and structure |
| >pdb|3EOX|A Chain A, High Quality Structure Of Cleaved Pai-1-Stab Length = 379 | Back alignment and structure |
| >pdb|3UT3|A Chain A, A Novel Pai-i Inhibitor And Its Structural Mechanism Length = 375 | Back alignment and structure |
| >pdb|1DB2|A Chain A, Crystal Structure Of Native Plasminogen Activator Inhibitor- 1 Length = 377 | Back alignment and structure |
| >pdb|3CVM|A Chain A, High Resolution Structure Of A Stable Plasminogen Activator Inhibitor Type-1 In Its Protease Cleaved Form Length = 392 | Back alignment and structure |
| >pdb|3R4L|A Chain A, Human Very Long Half Life Plasminogen Activator Inhibitor Type-1 Length = 379 | Back alignment and structure |
| >pdb|4DY0|A Chain A, Crystal Structure Of Native Protease Nexin-1 With Heparin Length = 379 | Back alignment and structure |
| >pdb|1YXA|A Chain A, Serpina3n, A Murine Orthologue Of Human Antichymotrypsin Length = 398 | Back alignment and structure |
| >pdb|1DVM|A Chain A, Active Form Of Human Pai-1 Length = 379 | Back alignment and structure |
| >pdb|4GA7|A Chain A, Crystal Structure Of Human Serpinb1 Mutant Length = 389 | Back alignment and structure |
| >pdb|3CAA|A Chain A, Cleaved Antichymotrypsin A347r Length = 341 | Back alignment and structure |
| >pdb|1AS4|A Chain A, Cleaved Antichymotrypsin A349r Length = 341 | Back alignment and structure |
| >pdb|4CAA|A Chain A, Cleaved Antichymotrypsin T345r Length = 341 | Back alignment and structure |
| >pdb|2ACH|A Chain A, Crystal Structure Of Cleaved Human Alpha1-antichymotrypsin At 2.7 Angstroms Resolution And Its Comparison With Other Serpins Length = 360 | Back alignment and structure |
| >pdb|3DLW|A Chain A, Antichymotrypsin Length = 411 | Back alignment and structure |
| >pdb|3Q02|A Chain A, Crystal Structure Of Plasminogen Activator Inhibitor-1 In A Metastable Active Conformation. Length = 379 | Back alignment and structure |
| >pdb|3PZF|A Chain A, 1.75a Resolution Structure Of Serpin-2 From Anopheles Gambiae Length = 397 | Back alignment and structure |
| >pdb|1QMN|A Chain A, Alpha1-Antichymotrypsin Serpin In The Delta Conformation (Partial Loop Insertion) Length = 401 | Back alignment and structure |
| >pdb|4BB2|A Chain A, Crystal Structure Of Cleaved Corticosteroid-binding Globulin In Complex With Progesterone Length = 340 | Back alignment and structure |
| >pdb|2VDX|A Chain A, Crystal Structure Of The Reactive Loop Cleaved Corticosteroid Binding Globulin Length = 373 | Back alignment and structure |
| >pdb|3NDA|A Chain A, Crystal Structure Of Serpin From Tick Ixodes Ricinus Length = 377 | Back alignment and structure |
| >pdb|2ZV6|A Chain A, Crystal Structure Of Human Squamous Cell Carcinoma Antigen 1 Length = 401 | Back alignment and structure |
| >pdb|3VVJ|A Chain A, Structure Of Ovalbumin From Emu (Dromaius Novaehollandiae) Length = 392 | Back alignment and structure |
| >pdb|1ATT|A Chain A, Crystal Structure Of Cleaved Bovine Antithrombin Iii At 3.2 Angstroms Resolution Length = 429 | Back alignment and structure |
| >pdb|2B4X|L Chain L, Crystal Structure Of Antithrombin-Iii Length = 427 | Back alignment and structure |
| >pdb|2HIJ|I Chain I, Crystal Structure Of P14 Alanine Variant Of Antithrombin Length = 432 | Back alignment and structure |
| >pdb|1ATH|A Chain A, The Intact And Cleaved Human Antithrombin Iii Complex As A Model For Serpin-Proteinase Interactions Length = 432 | Back alignment and structure |
| >pdb|1DZG|I Chain I, N135q-S380c-Antithrombin-Iii Length = 432 | Back alignment and structure |
| >pdb|1DZH|I Chain I, P14-Fluorescein-N135q-S380c-Antithrombin-Iii Length = 432 | Back alignment and structure |
| >pdb|2GD4|I Chain I, Crystal Structure Of The Antithrombin-S195a Factor Xa-Pentasaccharide Complex Length = 443 | Back alignment and structure |
| >pdb|1BY7|A Chain A, Human Plasminogen Activator Inhibitor-2. Loop (66-98) Deletion Mutant Length = 382 | Back alignment and structure |
| >pdb|1TB6|I Chain I, 2.5a Crystal Structure Of The Antithrombin-Thrombin-Heparin Ternary Complex Length = 432 | Back alignment and structure |
| >pdb|1OYH|I Chain I, Crystal Structure Of P13 Alanine Variant Of Antithrombin Length = 432 | Back alignment and structure |
| >pdb|3KCG|I Chain I, Crystal Structure Of The Antithrombin-Factor Ixa- Pentasaccharide Complex Length = 432 | Back alignment and structure |
| >pdb|2B4X|I Chain I, Crystal Structure Of Antithrombin-Iii Length = 427 | Back alignment and structure |
| >pdb|4IF8|A Chain A, Structure Of Vaspin Length = 414 | Back alignment and structure |
| >pdb|3F1S|A Chain A, Crystal Structure Of Protein Z Complexed With Protein Z-Dependent Inhibitor Length = 385 | Back alignment and structure |
| >pdb|3H5C|A Chain A, X-Ray Structure Of Protein Z-Protein Z Inhibitor Complex Length = 423 | Back alignment and structure |
| >pdb|4AFX|A Chain A, Crystal Structure Of The Reactive Loop Cleaved Zpi In I2 Space Group Length = 387 | Back alignment and structure |
| >pdb|2XN6|A Chain A, Crystal Structure Of Thyroxine-Binding Globulin Complexed With Thyroxine-Fluoresein Length = 350 | Back alignment and structure |
| >pdb|2ARQ|A Chain A, Human Plasminogen Activator Inhibitor-2.[loop (66-98) Deletion Mutant] Complexed With Peptide N-Acetyl-Teaaagdggvmtgr-Oh Length = 382 | Back alignment and structure |
| >pdb|2RIW|A Chain A, The Reactive Loop Cleaved Human Thyroxine Binding Globulin Complexed With Thyroxine Length = 338 | Back alignment and structure |
| >pdb|2CEO|A Chain A, Thyroxine-Binding Globulin Complex With Thyroxine Length = 379 | Back alignment and structure |
| >pdb|2RIV|A Chain A, Crystal Structure Of The Reactive Loop Cleaved Human Thyroxine Binding Globulin Length = 343 | Back alignment and structure |
| >pdb|2XN5|A Chain A, Crystal Structure Of Thyroxine-Binding Globulin Complexed With Furosemide Length = 350 | Back alignment and structure |
| >pdb|1ATU|A Chain A, Uncleaved Alpha-1-Antitrypsin Length = 374 | Back alignment and structure |
| >pdb|4EB1|I Chain I, Hyperstable In-Frame Insertion Variant Of Antithrombin Length = 440 | Back alignment and structure |
| >pdb|2D26|A Chain A, Active Site Distortion Is Sufficient For Proteinase Inhibit Second Crystal Structure Of Covalent Serpin-Proteinase Complex Length = 358 | Back alignment and structure |
| >pdb|1IZ2|A Chain A, Interactions Causing The Kinetic Trap In Serpin Protein Folding Length = 394 | Back alignment and structure |
| >pdb|1OO8|A Chain A, Crystal Structure Of A1pi-Pittsburgh In The Native Conformation Length = 394 | Back alignment and structure |
| >pdb|1KCT|A Chain A, Alpha1-Antitrypsin Length = 394 | Back alignment and structure |
| >pdb|1QMB|A Chain A, Cleaved Alpha-1-Antitrypsin Polymer Length = 326 | Back alignment and structure |
| >pdb|1HP7|A Chain A, A 2.1 Angstrom Structure Of An Uncleaved Alpha-1-Antitrypsin Shows Variability Of The Reactive Center And Other Loops Length = 394 | Back alignment and structure |
| >pdb|1OVA|B Chain B, Crystal Structure Of Uncleaved Ovalbumin At 1.95 Angstroms Resolution Length = 386 | Back alignment and structure |
| >pdb|1OVA|C Chain C, Crystal Structure Of Uncleaved Ovalbumin At 1.95 Angstroms Resolution Length = 386 | Back alignment and structure |
| >pdb|1OVA|A Chain A, Crystal Structure Of Uncleaved Ovalbumin At 1.95 Angstroms Resolution Length = 386 | Back alignment and structure |
| >pdb|2V95|A Chain A, Struture Of Corticosteroid-Binding Globulin In Complex With Cortisol Length = 371 | Back alignment and structure |
| >pdb|1JTI|A Chain A, Loop-Inserted Structure Of P1-P1' Cleaved Ovalbumin Mutant R339t Length = 385 | Back alignment and structure |
| >pdb|1UHG|A Chain A, Crystal Structure Of S-ovalbumin At 1.9 Angstrom Resolution Length = 385 | Back alignment and structure |
| >pdb|1D5S|A Chain A, Crystal Structure Of Cleaved Antitrypsin Polymer Length = 334 | Back alignment and structure |
| >pdb|1EZX|A Chain A, Crystal Structure Of A Serpin:protease Complex Length = 335 | Back alignment and structure |
| >pdb|7API|A Chain A, The S Variant Of Human Alpha1-Antitrypsin, Structure And Implications For Function And Metabolism Length = 347 | Back alignment and structure |
| >pdb|2HI9|A Chain A, Crystal Structure Of Human Native Protein C Inhibitor Length = 363 | Back alignment and structure |
| >pdb|3DY0|A Chain A, Crystal Structure Of Cleaved Pci Bound To Heparin Length = 336 | Back alignment and structure |
| >pdb|1LQ8|A Chain A, Crystal Structure Of Cleaved Protein C Inhibitor Length = 346 | Back alignment and structure |
| >pdb|3NDF|A Chain A, Cleaved Antitrypsin With P8-P6 Asp Length = 343 | Back alignment and structure |
| >pdb|2OL2|A Chain A, High Resolution Structure Of Native Pci In Space Group P21 Length = 395 | Back alignment and structure |
| >pdb|3T1P|A Chain A, Crystal Structure Of An Alpha-1-Antitrypsin Trimer Length = 371 | Back alignment and structure |
| >pdb|3NDD|A Chain A, Cleaved Antitrypsin With P10 Pro, And P9-P6 Asp Length = 343 | Back alignment and structure |
| >pdb|1PSI|A Chain A, Intact Recombined Alpha1-Antitrypsin Mutant Phe 51 To Leu Length = 394 | Back alignment and structure |
| >pdb|3DRM|A Chain A, 2.2 Angstrom Crystal Structure Of Thr114phe Alpha1- Antitrypsin Length = 404 | Back alignment and structure |
| >pdb|3NE4|A Chain A, 1.8 Angstrom Structure Of Intact Native Wild-Type Alpha-1-Antitrypsin Length = 424 | Back alignment and structure |
| >pdb|1QLP|A Chain A, 2.0 Angstrom Structure Of Intact Alpha-1-Antitrypsin: A Canonical Template For Active Serpins Length = 394 | Back alignment and structure |
| >pdb|2QUG|A Chain A, Crystal Structure Of Alpha-1-Antitrypsin, Crystal Form A Length = 394 | Back alignment and structure |
| >pdb|3DRU|A Chain A, Crystal Structure Of Gly117phe Alpha1-Antitrypsin Length = 404 | Back alignment and structure |
| >pdb|1XU8|A Chain A, The 2.8 A Structure Of A Tumour Suppressing Serpin Length = 380 | Back alignment and structure |
| >pdb|1WZ9|A Chain A, The 2.1 A Structure Of A Tumour Suppressing Serpin Length = 375 | Back alignment and structure |
| >pdb|1XQG|A Chain A, 3.10 A Crystal Structure Of Maspin, Space Group P 4 21 2 Length = 389 | Back alignment and structure |
| >pdb|1F0C|A Chain A, Structure Of The Viral Serpin Crma Length = 305 | Back alignment and structure |
| >pdb|4AJT|A Chain A, The Cystal Structure Of Mouse Protein-Z Dependent Protease Inhibitor(Mzpi) Length = 427 | Back alignment and structure |
| >pdb|1C8O|A Chain A, 2.9 A Structure Of Cleaved Viral Serpin Crma Length = 300 | Back alignment and structure |
| >pdb|1JMO|A Chain A, Crystal Structure Of The Heparin Cofactor Ii-S195a Thrombin Complex Length = 480 | Back alignment and structure |
| >pdb|1JMJ|A Chain A, Crystal Structure Of Native Heparin Cofactor Ii Length = 480 | Back alignment and structure |
| >pdb|3STO|A Chain A, Serpin From The Trematode Schistosoma Haematobium Length = 406 | Back alignment and structure |
| >pdb|1IMV|A Chain A, 2.85 A Crystal Structure Of Pedf Length = 398 | Back alignment and structure |
| >pdb|2R9Y|A Chain A, Structure Of Antiplasmin Length = 430 | Back alignment and structure |
| >pdb|4AU2|A Chain A, Crystal Structure Of A Hsp47-Collagen Complex Length = 392 | Back alignment and structure |
| >pdb|2OAY|A Chain A, Crystal Structure Of Latent Human C1-Inhibitor Length = 390 | Back alignment and structure |
| >pdb|4AU3|A Chain A, Crystal Structure Of A Hsp47-Collagen Complex Length = 392 | Back alignment and structure |
| >pdb|4AU3|B Chain B, Crystal Structure Of A Hsp47-Collagen Complex Length = 392 | Back alignment and structure |
| >pdb|1M93|B Chain B, 1.65 A Structure Of Cleaved Viral Serpin Crma Length = 245 | Back alignment and structure |
| >pdb|2PEF|A Chain A, Crystal Structure Of A Thermophilic Serpin, Tengpin, In The Latent State Length = 373 | Back alignment and structure |
| >pdb|2PEE|A Chain A, Crystal Structure Of A Thermophilic Serpin, Tengpin, In The Native State Length = 387 | Back alignment and structure |
| >pdb|2VH4|A Chain A, Structure Of A Loop C-sheet Serpin Polymer Length = 381 | Back alignment and structure |
| >pdb|1MTP|A Chain A, The X-Ray Crystal Structure Of A Serpin From A Thermophilic Prokaryote Length = 323 | Back alignment and structure |
| >pdb|1SNG|A Chain A, Structure Of A Thermophilic Serpin In The Native State Length = 370 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 342 | |||
| 3ozq_A | 376 | Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molito | 2e-76 | |
| 1sek_A | 378 | Serpin K; serine protease inhibitor, protease; 2.1 | 1e-75 | |
| 1wz9_A | 375 | Maspin precursor; serpin, tumor suppressor, serpin | 2e-74 | |
| 1lj5_A | 379 | Plasminogen activator inhibitor-1; beta-barrell, b | 2e-74 | |
| 3f5n_A | 407 | Neuroserpin; cleaved form, fenib, human, tissue PL | 7e-73 | |
| 3le2_A | 393 | Serpin-ZX; apoplast, glycoprotein, protease inhibi | 9e-73 | |
| 1hle_A | 345 | Horse leukocyte elastase inhibitor; hydrolase inhi | 1e-72 | |
| 3kcg_I | 432 | Antithrombin-III, ATIII; michaelis complex, blood | 2e-72 | |
| 3f02_A | 359 | Neuroserpin; cleaved form, fenib, human, disease M | 7e-72 | |
| 3pzf_A | 397 | Serpin 2; protease inhibitor, melanization, hydrol | 2e-71 | |
| 3nda_A | 377 | Serpin-2; vaccination target, TICK, hydrolase inhi | 2e-71 | |
| 3f1s_A | 385 | Protein Z-dependent protease inhibitor; PZ, ZPI, c | 5e-71 | |
| 1mtp_A | 323 | Serine proteinase inhibitor (serpin), chain A; str | 7e-71 | |
| 2arr_A | 382 | Plasminogen activator inhibitor-2; serpin, peptide | 2e-70 | |
| 1sng_A | 370 | COG4826: serine protease inhibitor; serine proteas | 2e-70 | |
| 2pef_A | 373 | Serine protease inhibitor; serpin; 1.60A {Thermoan | 4e-70 | |
| 4dy0_A | 379 | GLIA-derived nexin; serpin, protease inhibitor, th | 5e-70 | |
| 2h4r_A | 415 | MENT, heterochromatin-associated protein MENT; ser | 1e-69 | |
| 1yxa_A | 398 | Serine (OR cysteine) proteinase inhibitor, clade 3 | 2e-69 | |
| 2h4p_A | 394 | MENT, heterochromatin-associated protein MENT; ser | 3e-69 | |
| 1uhg_A | 385 | Ovalbumin, S-ovalbumin; allergen, egg white protei | 3e-69 | |
| 3sto_A | 406 | Serine protease inhibitor; serpin fold, hydrolase | 3e-69 | |
| 4au2_A | 392 | HSP47, serpin peptidase inhibitor, clade H (heat s | 3e-69 | |
| 2zv6_A | 401 | Serpin B3; serine proteinase inhibitor, reactive s | 3e-69 | |
| 3b9f_I | 395 | Protein C inhibitor; michaelis complex, acute phas | 1e-68 | |
| 1as4_A | 341 | Antichymotrypsin, ACT; serpin, serine protease inh | 1e-68 | |
| 2vdx_A | 373 | Corticosteroid-binding globulin; transport protein | 2e-68 | |
| 3dy0_A | 336 | N-terminus plasma serine protease inhibitor; serpi | 6e-68 | |
| 1qmn_A | 401 | AACT, alpha-1-antichymotrypsin; serpin, serine pro | 1e-67 | |
| 3ndd_A | 343 | Alpha-1-antitrypsin; serpin, hydrolase inhibitor; | 4e-67 | |
| 1jmo_A | 480 | HC-II, heparin cofactor II, HLS2, serin; serpin, t | 4e-67 | |
| 3ne4_A | 424 | Alpha-1-antitrypsin; serpin, LUNG disease, liver d | 5e-67 | |
| 2ceo_A | 379 | Thyroxine-binding globulin; transport, serpin, hor | 7e-67 | |
| 1imv_A | 398 | PEDF, pigment epithelium-derived factor; serpin, a | 9e-67 | |
| 2r9y_A | 430 | Alpha-2-antiplasmin; inhibitory serpin, plasmin in | 3e-66 | |
| 2xn6_A | 350 | Thyroxine-binding globulin; transport, cleaved pro | 5e-66 | |
| 2oay_A | 390 | C1-inhibitor, plasma protease C1 inhibitor, C1 INH | 2e-65 | |
| 2v95_A | 371 | Corticosteroid-binding globulin; transport protein | 2e-64 | |
| 1f0c_A | 305 | ICE inhibitor; apoptosis, caspase inhibitor, prote | 2e-61 | |
| 2wxw_A | 453 | Angiotensinogen, serpin A8; glycoprotein, hyperten | 6e-61 | |
| 2wxy_C | 453 | Angiotensinogen, serpin A8; glycoprotein, hyperten | 3e-60 | |
| 1m93_B | 245 | Serine proteinase inhibitor 2; serpin, CRMA, apopt | 7e-52 | |
| 1m93_A | 55 | Serine proteinase inhibitor 2; serpin, CRMA, apopt | 8e-08 |
| >3ozq_A Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molitor} Length = 376 | Back alignment and structure |
|---|
Score = 238 bits (610), Expect = 2e-76
Identities = 71/219 (32%), Positives = 111/219 (50%), Gaps = 11/219 (5%)
Query: 114 LAANKKENAIISPFSLHVVLGLASFGAAGSTAEAMMKGLRIKHSETLLKDYKGIIDQLSK 173
+ +K N ++SPFS +L LA G G TAE + + L + G ++
Sbjct: 26 VLKTEKANFLVSPFSAATLLALAQSGCRGDTAEEIRQVLH----------FVGDREKAEG 75
Query: 174 DYKGIIDQLSKS-PELKIANKIYFAKDIELNPAYQTQAVDNFNSELGKVDFSQPPAAAKE 232
K ++ +L+ L ANKIY + + +Q AV+ + ++ VDFS+ AAK
Sbjct: 76 AVKEVLSKLTNEEYTLHTANKIYVKTNFSVREEFQKIAVEVYGAQSENVDFSEKNDAAKL 135
Query: 233 MNDWVSNHTNDKIKDLIKADSLDASTKLVLINAIHFKGKWTVPFKPEATKDGPFYLDDTN 292
MN WV T KI++L+ + L+ T++VLINA++F KW VPF P T+ F+
Sbjct: 136 MNAWVEEQTQHKIQNLVDPEILNNLTRVVLINALYFNAKWLVPFPPFHTRKSDFHKSAKE 195
Query: 293 SVQVPLMFVKDSFYMYEEAGEDGFKMLELPYGVSISFII 331
VQV M++ + ++ Y E K+LELP+ S I
Sbjct: 196 VVQVDTMYLDEQYFNYYECHHLDAKLLELPFKGGASLTI 234
|
| >1sek_A Serpin K; serine protease inhibitor, protease; 2.10A {Manduca sexta} SCOP: e.1.1.1 PDB: 1k9o_I Length = 378 | Back alignment and structure |
|---|
| >1wz9_A Maspin precursor; serpin, tumor suppressor, serpinb5, signaling protein; HET: CME; 2.10A {Homo sapiens} PDB: 1xu8_A 1xqg_A 1xqj_A Length = 375 | Back alignment and structure |
|---|
| >1lj5_A Plasminogen activator inhibitor-1; beta-barrell, blood clotting; 1.80A {Homo sapiens} SCOP: e.1.1.1 PDB: 1dvn_A 1c5g_A 1a7c_A* 3q02_A 3q03_A 3r4l_A* 1oc0_A 1b3k_A 3pb1_I 1dvm_A 3eox_A 3cvm_A 1db2_A 9pai_A 3lw2_A 9pai_B Length = 379 | Back alignment and structure |
|---|
| >3f5n_A Neuroserpin; cleaved form, fenib, human, tissue PLAS activator, hydrolase inhibitor; 3.15A {Homo sapiens} Length = 407 | Back alignment and structure |
|---|
| >3le2_A Serpin-ZX; apoplast, glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase; 2.20A {Arabidopsis thaliana} Length = 393 | Back alignment and structure |
|---|
| >1hle_A Horse leukocyte elastase inhibitor; hydrolase inhibitor(serine proteinase); 1.95A {Equus caballus} SCOP: e.1.1.1 Length = 345 | Back alignment and structure |
|---|
| >3kcg_I Antithrombin-III, ATIII; michaelis complex, blood coagulation, calcium, disulfide bond, EGF-like domain, glycoprotein, hemophilia, hydrolase; HET: NAG FUC MAN NTP; 1.70A {Homo sapiens} PDB: 1e04_I* 1ath_A 1ant_L* 1br8_L 1azx_I* 1dzh_L* 1e03_L* 1dzg_L* 1e05_L* 1jvq_L* 1lk6_L* 1nq9_I* 1oyh_L* 1r1l_L* 1sr5_A* 2ant_L* 2beh_L* 2hij_L* 2znh_A* 3evj_I* ... Length = 432 | Back alignment and structure |
|---|
| >3f02_A Neuroserpin; cleaved form, fenib, human, disease MUT glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase inhibitor; 1.80A {Homo sapiens} PDB: 3fgq_A 1jjo_C 1jjo_A Length = 359 | Back alignment and structure |
|---|
| >3pzf_A Serpin 2; protease inhibitor, melanization, hydrolase inhibito; 1.75A {Anopheles gambiae} Length = 397 | Back alignment and structure |
|---|
| >3nda_A Serpin-2; vaccination target, TICK, hydrolase inhibitor; HET: 1PE; 1.80A {Ixodes ricinus} Length = 377 | Back alignment and structure |
|---|
| >3f1s_A Protein Z-dependent protease inhibitor; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} PDB: 3h5c_A* Length = 385 | Back alignment and structure |
|---|
| >1mtp_A Serine proteinase inhibitor (serpin), chain A; structural genomics, protease inhibitor; 1.50A {Thermobifida fusca} SCOP: e.1.1.1 Length = 323 | Back alignment and structure |
|---|
| >2arr_A Plasminogen activator inhibitor-2; serpin, peptide binding, hydrolase inhibitor-PEPT complex; 1.55A {Homo sapiens} PDB: 2arq_A 1jrr_A 1by7_A Length = 382 | Back alignment and structure |
|---|
| >1sng_A COG4826: serine protease inhibitor; serine protease inhibitor (serpin), native state., hydrolase inhibitor; 1.76A {Thermobifida fusca} SCOP: e.1.1.1 Length = 370 | Back alignment and structure |
|---|
| >2pef_A Serine protease inhibitor; serpin; 1.60A {Thermoanaerobacter tengcongensis} PDB: 2vh4_A 2pee_A Length = 373 | Back alignment and structure |
|---|
| >4dy0_A GLIA-derived nexin; serpin, protease inhibitor, thrombin, cell surface, hydrolas inhibitor; HET: IDS SGN; 2.35A {Homo sapiens} PDB: 4dy7_C Length = 379 | Back alignment and structure |
|---|
| >2h4r_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 2.70A {Gallus gallus} PDB: 2dut_A Length = 415 | Back alignment and structure |
|---|
| >1yxa_A Serine (OR cysteine) proteinase inhibitor, clade 3N; serpin, antichymotrypsin, protease inhibitor, reactive centr plasma, hydrolase inhibitor; 2.10A {Mus musculus} Length = 398 | Back alignment and structure |
|---|
| >2h4p_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 1.70A {Gallus gallus} PDB: 2h4q_A Length = 394 | Back alignment and structure |
|---|
| >1uhg_A Ovalbumin, S-ovalbumin; allergen, egg white protein, serpin; HET: SEP NAG; 1.90A {Gallus gallus} SCOP: e.1.1.1 PDB: 1ova_A* 1jti_A Length = 385 | Back alignment and structure |
|---|
| >3sto_A Serine protease inhibitor; serpin fold, hydrolase inhibitor; 2.41A {Schistosoma haematobium} Length = 406 | Back alignment and structure |
|---|
| >4au2_A HSP47, serpin peptidase inhibitor, clade H (heat shock P 47), member 1, (collagen binding...; chaperone-peptide complex; 2.30A {Canis lupus familiaris} PDB: 4au3_A 4au4_A 4awr_A 4au3_B Length = 392 | Back alignment and structure |
|---|
| >2zv6_A Serpin B3; serine proteinase inhibitor, reactive site loop, acetylation, alternative splicing, cytoplasm, polymorphism, protease inhibitor; 2.70A {Homo sapiens} Length = 401 | Back alignment and structure |
|---|
| >3b9f_I Protein C inhibitor; michaelis complex, acute phase, blood coagulation, cleavage of basic residues, disease mutation; HET: NAG FUC SGN IDS; 1.60A {Homo sapiens} PDB: 2ol2_A* Length = 395 | Back alignment and structure |
|---|
| >1as4_A Antichymotrypsin, ACT; serpin, serine protease inhibitor; 2.10A {Homo sapiens} SCOP: e.1.1.1 PDB: 2ach_A* 4caa_A 3caa_A Length = 341 | Back alignment and structure |
|---|
| >2vdx_A Corticosteroid-binding globulin; transport protein, cortisol binding globulin, glycoprotein, lipid-binding, disease mutation, CBG, SERP cleaved; 1.84A {Homo sapiens} PDB: 2vdy_A* Length = 373 | Back alignment and structure |
|---|
| >3dy0_A N-terminus plasma serine protease inhibitor; serpin, blood clotting, hydrolase inhibitor; HET: IDS SGN; 1.55A {Homo sapiens} PDB: 1lq8_A* 2hi9_A* Length = 336 | Back alignment and structure |
|---|
| >1qmn_A AACT, alpha-1-antichymotrypsin; serpin, serine proteinase inhibitor, partial loop insertion, loop-sheet polymerization, emphysema, disease mutation; 2.27A {Homo sapiens} SCOP: e.1.1.1 PDB: 3dlw_A Length = 401 | Back alignment and structure |
|---|
| >3ndd_A Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 1.50A {Homo sapiens} PDB: 3ndf_A 7api_A* 8api_A* 9api_A* 1d5s_A 1ezx_A 3t1p_A 2d26_A 1qmb_A Length = 343 | Back alignment and structure |
|---|
| >1jmo_A HC-II, heparin cofactor II, HLS2, serin; serpin, thrombin, protease, inhibition, inhibitor, blood CLO; HET: TYS NDG NAG; 2.20A {Homo sapiens} SCOP: e.1.1.1 PDB: 1jmj_A* Length = 480 | Back alignment and structure |
|---|
| >3ne4_A Alpha-1-antitrypsin; serpin, LUNG disease, liver disease, polymerisation, hydrolase inhibitor; 1.81A {Homo sapiens} PDB: 1qlp_A 2qug_A 3cwl_A 3cwm_A* 1psi_A 3drm_A 1kct_A 3dru_A 1hp7_A 1iz2_A* 1oph_A 1oo8_A 1atu_A 1d5s_B 1qmb_B Length = 424 | Back alignment and structure |
|---|
| >2ceo_A Thyroxine-binding globulin; transport, serpin, hormone trans thyroxine, disease mutation, glycoprotein; HET: T44; 2.80A {Homo sapiens} Length = 379 | Back alignment and structure |
|---|
| >1imv_A PEDF, pigment epithelium-derived factor; serpin, angiogenesis, signaling protein; HET: NAG; 2.85A {Homo sapiens} SCOP: e.1.1.1 Length = 398 | Back alignment and structure |
|---|
| >2r9y_A Alpha-2-antiplasmin; inhibitory serpin, plasmin inhibitor, AC phase, glycoprotein, protease inhibitor, secreted, serine P inhibitor, sulfation; 2.65A {Mus musculus} Length = 430 | Back alignment and structure |
|---|
| >2xn6_A Thyroxine-binding globulin; transport, cleaved protein; HET: F6Y T44; 1.29A {Homo sapiens} PDB: 2xn7_A* 2xn5_A* 2riv_A 2xn3_A* 2riw_A* Length = 350 | Back alignment and structure |
|---|
| >2oay_A C1-inhibitor, plasma protease C1 inhibitor, C1 INH, C1INH; latent serpin, RCL insertion, immune system,hydrolase inhibi; HET: NAG; 2.35A {Homo sapiens} Length = 390 | Back alignment and structure |
|---|
| >2v95_A Corticosteroid-binding globulin; transport protein, CBG, RCL, serpin, secreted, transport, glycoprotein, lipid-binding, glucocorticoids; HET: HCY; 1.93A {Rattus norvegicus} Length = 371 | Back alignment and structure |
|---|
| >1f0c_A ICE inhibitor; apoptosis, caspase inhibitor, protease inhibitor, serpin, viral protein; 2.26A {Cowpox virus} SCOP: e.1.1.1 PDB: 1c8o_A Length = 305 | Back alignment and structure |
|---|
| >2wxw_A Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 3.30A {Homo sapiens} PDB: 2x0b_B Length = 453 | Back alignment and structure |
|---|
| >2wxy_C Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 2.10A {Mus musculus} PDB: 2wxx_A 2wy0_C 2wxz_A 2wxz_C 2wy1_A Length = 453 | Back alignment and structure |
|---|
| >1m93_B Serine proteinase inhibitor 2; serpin, CRMA, apoptosis, ICE inhibitor, viral protein; 1.65A {Cowpox virus} SCOP: e.1.1.1 Length = 245 | Back alignment and structure |
|---|
| >1m93_A Serine proteinase inhibitor 2; serpin, CRMA, apoptosis, ICE inhibitor, viral protein; 1.65A {Cowpox virus} SCOP: e.1.1.1 Length = 55 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 342 | |||
| 3f02_A | 359 | Neuroserpin; cleaved form, fenib, human, disease M | 100.0 | |
| 1hle_A | 345 | Horse leukocyte elastase inhibitor; hydrolase inhi | 100.0 | |
| 3ndd_A | 343 | Alpha-1-antitrypsin; serpin, hydrolase inhibitor; | 100.0 | |
| 3dy0_A | 336 | N-terminus plasma serine protease inhibitor; serpi | 100.0 | |
| 3f5n_A | 407 | Neuroserpin; cleaved form, fenib, human, tissue PL | 100.0 | |
| 3ne4_A | 424 | Alpha-1-antitrypsin; serpin, LUNG disease, liver d | 100.0 | |
| 2h4p_A | 394 | MENT, heterochromatin-associated protein MENT; ser | 100.0 | |
| 3nda_A | 377 | Serpin-2; vaccination target, TICK, hydrolase inhi | 100.0 | |
| 4ga7_A | 389 | Leukocyte elastase inhibitor; serpin, conformation | 100.0 | |
| 1uhg_A | 385 | Ovalbumin, S-ovalbumin; allergen, egg white protei | 100.0 | |
| 2xn6_A | 350 | Thyroxine-binding globulin; transport, cleaved pro | 100.0 | |
| 3ozq_A | 376 | Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molito | 100.0 | |
| 4au2_A | 392 | HSP47, serpin peptidase inhibitor, clade H (heat s | 100.0 | |
| 2zv6_A | 401 | Serpin B3; serine proteinase inhibitor, reactive s | 100.0 | |
| 1as4_A | 341 | Antichymotrypsin, ACT; serpin, serine protease inh | 100.0 | |
| 3sto_A | 406 | Serine protease inhibitor; serpin fold, hydrolase | 100.0 | |
| 2h4r_A | 415 | MENT, heterochromatin-associated protein MENT; ser | 100.0 | |
| 1lj5_A | 379 | Plasminogen activator inhibitor-1; beta-barrell, b | 100.0 | |
| 2ceo_A | 379 | Thyroxine-binding globulin; transport, serpin, hor | 100.0 | |
| 2arr_A | 382 | Plasminogen activator inhibitor-2; serpin, peptide | 100.0 | |
| 3b9f_I | 395 | Protein C inhibitor; michaelis complex, acute phas | 100.0 | |
| 4afx_A | 387 | Protein Z dependent protease inhibitor; hydrolase | 100.0 | |
| 2vdx_A | 373 | Corticosteroid-binding globulin; transport protein | 100.0 | |
| 1sek_A | 378 | Serpin K; serine protease inhibitor, protease; 2.1 | 100.0 | |
| 4dy0_A | 379 | GLIA-derived nexin; serpin, protease inhibitor, th | 100.0 | |
| 1wz9_A | 375 | Maspin precursor; serpin, tumor suppressor, serpin | 100.0 | |
| 1yxa_A | 398 | Serine (OR cysteine) proteinase inhibitor, clade 3 | 100.0 | |
| 3f1s_A | 385 | Protein Z-dependent protease inhibitor; PZ, ZPI, c | 100.0 | |
| 4ajt_A | 427 | Protein Z-dependent protease inhibitor; blood clot | 100.0 | |
| 3pzf_A | 397 | Serpin 2; protease inhibitor, melanization, hydrol | 100.0 | |
| 1qmn_A | 401 | AACT, alpha-1-antichymotrypsin; serpin, serine pro | 100.0 | |
| 3kcg_I | 432 | Antithrombin-III, ATIII; michaelis complex, blood | 100.0 | |
| 1imv_A | 398 | PEDF, pigment epithelium-derived factor; serpin, a | 100.0 | |
| 2v95_A | 371 | Corticosteroid-binding globulin; transport protein | 100.0 | |
| 3le2_A | 393 | Serpin-ZX; apoplast, glycoprotein, protease inhibi | 100.0 | |
| 1mtp_A | 323 | Serine proteinase inhibitor (serpin), chain A; str | 100.0 | |
| 1jmo_A | 480 | HC-II, heparin cofactor II, HLS2, serin; serpin, t | 100.0 | |
| 1sng_A | 370 | COG4826: serine protease inhibitor; serine proteas | 100.0 | |
| 2wxy_C | 453 | Angiotensinogen, serpin A8; glycoprotein, hyperten | 100.0 | |
| 2pef_A | 373 | Serine protease inhibitor; serpin; 1.60A {Thermoan | 100.0 | |
| 2wxw_A | 453 | Angiotensinogen, serpin A8; glycoprotein, hyperten | 100.0 | |
| 2r9y_A | 430 | Alpha-2-antiplasmin; inhibitory serpin, plasmin in | 100.0 | |
| 1f0c_A | 305 | ICE inhibitor; apoptosis, caspase inhibitor, prote | 100.0 | |
| 2oay_A | 390 | C1-inhibitor, plasma protease C1 inhibitor, C1 INH | 100.0 | |
| 1m93_B | 245 | Serine proteinase inhibitor 2; serpin, CRMA, apopt | 100.0 | |
| 1m93_A | 55 | Serine proteinase inhibitor 2; serpin, CRMA, apopt | 99.38 |
| >3f02_A Neuroserpin; cleaved form, fenib, human, disease MUT glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase inhibitor; 1.80A {Homo sapiens} PDB: 3fgq_A 1jjo_C 1jjo_A | Back alignment and structure |
|---|
Probab=100.00 E-value=2.2e-54 Score=421.35 Aligned_cols=230 Identities=30% Similarity=0.531 Sum_probs=205.3
Q ss_pred cccccccccccccccccccCCcchhhhhhhhhhhhhcc-CCCCEEEChhhHHHHHHHHHccCChhHHHHHHHHcCCCCcc
Q psy2651 80 SFSSILDQRFNGKLHKKEDFKPFSIQLSTLVEWNLAAN-KKENAIISPFSLHVVLGLASFGAAGSTAEAMMKGLRIKHSE 158 (342)
Q Consensus 80 ~~~~~~~~~Fa~~L~~~~~~~~~~~~~~~~~~~~l~~~-~~~Niv~SP~sI~~aLamL~~GA~G~T~~qL~~~Lgl~~~~ 158 (342)
.++++.+ +||++||+ ++.+. +++|+||||+||+.+|+|+++||+|+|++||.++||++...
T Consensus 18 ~l~~~~~-~Fa~~L~~-----------------~l~~~~~~~Niv~SP~Si~~aLaml~~GA~G~T~~ql~~~L~~~~~~ 79 (359)
T 3f02_A 18 FPEEAIA-DLSVNMYN-----------------RLRATGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLK 79 (359)
T ss_dssp ---CHHH-HHHHHHHH-----------------HHHHHSTTCCEEECHHHHHHHHHHHHHHCCHHHHHHHHHHHTCCC--
T ss_pred HHHHHHH-HHHHHHHH-----------------HHhhcCCCCCEEEcHHHHHHHHHHHHhhcCChHHHHHHHHhCCCCCC
Confidence 4556667 99999999 88776 78999999999999999999999999999999999998654
Q ss_pred cchhcccchhHHHHHHHHHHHHHhCCCc---chhhhhhhhhccCcccchHHHHHhhhhcccccEEecCCCcHHHHHhhch
Q psy2651 159 TLLKDYKGIIDQLSKDYKGIIDQLSKSP---ELKIANKIYFAKDIELNPAYQTQAVDNFNSELGKVDFSQPPAAAKEMND 235 (342)
Q Consensus 159 ~~~~~~~~~~~~v~~~~~~l~~~l~~~~---~l~~an~lfv~~~~~l~~~F~~~~~~~y~a~v~~vdF~~~~~a~~~IN~ 235 (342)
..+ ++..|+.++..+.+.+ .+.+||+||+++++++.++|++.++++|+++++.+||.+++.+++.||+
T Consensus 80 ~~~---------~~~~~~~l~~~l~~~~~~~~l~~an~l~~~~~~~l~~~f~~~~~~~y~a~~~~vdF~~~~~a~~~IN~ 150 (359)
T 3f02_A 80 NGE---------EFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINK 150 (359)
T ss_dssp --C---------HHHHHHCC----------CEEEEEEEEEEETTCCCCHHHHHHHHHHHCCEEEEECTTSHHHHHHHHHH
T ss_pred HHH---------HHHHHHHHHHHHhcCCCCcEEEEEEEEEEeCCCccchHHHHHHHHHhcCceEEcCCCCHHHHHHHHHH
Confidence 334 8888998888776433 8999999999999999999999999999999999999988889999999
Q ss_pred hhhcccCCccccCCCCCCCCcccceeeeeeccccccccccCCCCCCcccCeeecCCCeEEEeeeeecceeeeEEEeCCCC
Q psy2651 236 WVSNHTNDKIKDLIKADSLDASTKLVLINAIHFKGKWTVPFKPEATKDGPFYLDDTNSVQVPLMFVKDSFYMYEEAGEDG 315 (342)
Q Consensus 236 WV~~~T~g~I~~ll~~~~i~~~t~lvLvNaiyFkg~W~~~F~~~~T~~~~F~~~~g~~~~VpMM~~~~~~f~y~~~~~l~ 315 (342)
||+++|+|+|++++++++++++|+++|+||+||||.|+++|++.+|++++|+..+|++++||||++.+. |+|+++++++
T Consensus 151 WV~~~T~gkI~~ll~~~~l~~~t~lvLvNaiyFkg~W~~~F~~~~T~~~~F~~~~g~~v~V~mM~~~~~-~~y~~~~~l~ 229 (359)
T 3f02_A 151 WVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGE-FYYGEFSDGS 229 (359)
T ss_dssp HHHHTTTTCSCCSSCGGGCSTTEEEEEEEEEEEEEEBSSCCCGGGCEEEEEECTTSCEEEEEEEEEEEE-EEEEEEECCC
T ss_pred HHHhhhCCcccccCCcccCCCCceEEEEeHHHHhHHhhccCCcccceeeeeEecCCcEEEccceEeece-EeEEEccCcC
Confidence 999999999999999999999999999999999999999999999999999999999999999999998 9999999998
Q ss_pred e------EEEEEeC-CCcEEEEEeecCCCCCC
Q psy2651 316 F------KMLELPY-GVSISFIIKSQVVPEMG 340 (342)
Q Consensus 316 ~------~vLELPY-~~~~SMlI~~~ILP~~g 340 (342)
+ +|||||| ++++||+| |||+++
T Consensus 230 a~~~~~~~vleLPY~~~~~sm~i---iLP~~~ 258 (359)
T 3f02_A 230 NEAGGIYQVLEIPYEGDEISMML---VLSRQE 258 (359)
T ss_dssp ---CCEEEEEEEEBTTSSEEEEE---EECCTT
T ss_pred cccccccEEEEeEcCCCcEEEEE---EEcCCC
Confidence 8 9999999 99999999 899986
|
| >1hle_A Horse leukocyte elastase inhibitor; hydrolase inhibitor(serine proteinase); 1.95A {Equus caballus} SCOP: e.1.1.1 | Back alignment and structure |
|---|
| >3ndd_A Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 1.50A {Homo sapiens} PDB: 3ndf_A 7api_A* 8api_A* 9api_A* 1d5s_A 1ezx_A 3t1p_A 2d26_A 1qmb_A | Back alignment and structure |
|---|
| >3dy0_A N-terminus plasma serine protease inhibitor; serpin, blood clotting, hydrolase inhibitor; HET: IDS SGN; 1.55A {Homo sapiens} PDB: 1lq8_A* 2hi9_A* | Back alignment and structure |
|---|
| >3f5n_A Neuroserpin; cleaved form, fenib, human, tissue PLAS activator, hydrolase inhibitor; 3.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3ne4_A Alpha-1-antitrypsin; serpin, LUNG disease, liver disease, polymerisation, hydrolase inhibitor; 1.81A {Homo sapiens} PDB: 1qlp_A 2qug_A 3cwl_A 3cwm_A* 1psi_A 3drm_A 1kct_A 3dru_A 1hp7_A 1iz2_A* 1oph_A 1oo8_A 1atu_A 1d5s_B 1qmb_B | Back alignment and structure |
|---|
| >2h4p_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 1.70A {Gallus gallus} PDB: 2h4q_A | Back alignment and structure |
|---|
| >3nda_A Serpin-2; vaccination target, TICK, hydrolase inhibitor; HET: 1PE; 1.80A {Ixodes ricinus} | Back alignment and structure |
|---|
| >4ga7_A Leukocyte elastase inhibitor; serpin, conformational change, serine protease inhibitor, Ca inhibitor, chymase inhibitor, chymotrypsin inhibitor; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1uhg_A Ovalbumin, S-ovalbumin; allergen, egg white protein, serpin; HET: SEP NAG; 1.90A {Gallus gallus} SCOP: e.1.1.1 PDB: 1ova_A* 1jti_A | Back alignment and structure |
|---|
| >2xn6_A Thyroxine-binding globulin; transport, cleaved protein; HET: F6Y T44; 1.29A {Homo sapiens} PDB: 2xn7_A* 2xn5_A* 2riv_A 2xn3_A* 2riw_A* | Back alignment and structure |
|---|
| >3ozq_A Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molitor} | Back alignment and structure |
|---|
| >4au2_A HSP47, serpin peptidase inhibitor, clade H (heat shock P 47), member 1, (collagen binding...; chaperone-peptide complex; 2.30A {Canis lupus familiaris} PDB: 4au3_A 4au4_A 4awr_A 4au3_B | Back alignment and structure |
|---|
| >2zv6_A Serpin B3; serine proteinase inhibitor, reactive site loop, acetylation, alternative splicing, cytoplasm, polymorphism, protease inhibitor; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1as4_A Antichymotrypsin, ACT; serpin, serine protease inhibitor; 2.10A {Homo sapiens} SCOP: e.1.1.1 PDB: 2ach_A* 4caa_A 3caa_A | Back alignment and structure |
|---|
| >3sto_A Serine protease inhibitor; serpin fold, hydrolase inhibitor; 2.41A {Schistosoma haematobium} | Back alignment and structure |
|---|
| >2h4r_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 2.70A {Gallus gallus} PDB: 2dut_A | Back alignment and structure |
|---|
| >1lj5_A Plasminogen activator inhibitor-1; beta-barrell, blood clotting; 1.80A {Homo sapiens} SCOP: e.1.1.1 PDB: 1dvn_A 1c5g_A 1a7c_A* 3q02_A 3q03_A 3r4l_A* 1oc0_A 1b3k_A 3pb1_I 1dvm_A 3eox_A 3cvm_A 1db2_A 9pai_A 3lw2_A 9pai_B | Back alignment and structure |
|---|
| >2ceo_A Thyroxine-binding globulin; transport, serpin, hormone trans thyroxine, disease mutation, glycoprotein; HET: T44; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2arr_A Plasminogen activator inhibitor-2; serpin, peptide binding, hydrolase inhibitor-PEPT complex; 1.55A {Homo sapiens} PDB: 2arq_A 1jrr_A 1by7_A | Back alignment and structure |
|---|
| >3b9f_I Protein C inhibitor; michaelis complex, acute phase, blood coagulation, cleavage of basic residues, disease mutation; HET: NAG FUC SGN IDS; 1.60A {Homo sapiens} PDB: 2ol2_A* | Back alignment and structure |
|---|
| >4afx_A Protein Z dependent protease inhibitor; hydrolase inhibitor, serpin, protein Z dependent inhibitor, coagulation; 2.09A {Homo sapiens} PDB: 4aju_A 3h5c_A* 3f1s_A* | Back alignment and structure |
|---|
| >2vdx_A Corticosteroid-binding globulin; transport protein, cortisol binding globulin, glycoprotein, lipid-binding, disease mutation, CBG, SERP cleaved; 1.84A {Homo sapiens} PDB: 2vdy_A* | Back alignment and structure |
|---|
| >1sek_A Serpin K; serine protease inhibitor, protease; 2.10A {Manduca sexta} SCOP: e.1.1.1 PDB: 1k9o_I | Back alignment and structure |
|---|
| >4dy0_A GLIA-derived nexin; serpin, protease inhibitor, thrombin, cell surface, hydrolas inhibitor; HET: IDS SGN; 2.35A {Homo sapiens} PDB: 4dy7_C | Back alignment and structure |
|---|
| >1wz9_A Maspin precursor; serpin, tumor suppressor, serpinb5, signaling protein; HET: CME; 2.10A {Homo sapiens} PDB: 1xu8_A 1xqg_A 1xqj_A | Back alignment and structure |
|---|
| >1yxa_A Serine (OR cysteine) proteinase inhibitor, clade 3N; serpin, antichymotrypsin, protease inhibitor, reactive centr plasma, hydrolase inhibitor; 2.10A {Mus musculus} | Back alignment and structure |
|---|
| >3f1s_A Protein Z-dependent protease inhibitor; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} PDB: 3h5c_A* | Back alignment and structure |
|---|
| >4ajt_A Protein Z-dependent protease inhibitor; blood clotting, ZPI; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3pzf_A Serpin 2; protease inhibitor, melanization, hydrolase inhibito; 1.75A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1qmn_A AACT, alpha-1-antichymotrypsin; serpin, serine proteinase inhibitor, partial loop insertion, loop-sheet polymerization, emphysema, disease mutation; 2.27A {Homo sapiens} SCOP: e.1.1.1 PDB: 3dlw_A | Back alignment and structure |
|---|
| >3kcg_I Antithrombin-III, ATIII; michaelis complex, blood coagulation, calcium, disulfide bond, EGF-like domain, glycoprotein, hemophilia, hydrolase; HET: NAG FUC MAN NTP; 1.70A {Homo sapiens} SCOP: e.1.1.1 PDB: 1e04_I* 1ath_A 1ant_L* 1br8_L 1azx_I* 1dzh_L* 1e03_L* 1dzg_L* 1e05_L* 1jvq_L* 1lk6_L* 1nq9_I* 1oyh_L* 1r1l_L* 1sr5_A* 2ant_L* 2beh_L* 2hij_L* 2znh_A* 3evj_I* ... | Back alignment and structure |
|---|
| >1imv_A PEDF, pigment epithelium-derived factor; serpin, angiogenesis, signaling protein; HET: NAG; 2.85A {Homo sapiens} SCOP: e.1.1.1 | Back alignment and structure |
|---|
| >2v95_A Corticosteroid-binding globulin; transport protein, CBG, RCL, serpin, secreted, transport, glycoprotein, lipid-binding, glucocorticoids; HET: HCY; 1.93A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3le2_A Serpin-ZX; apoplast, glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase; 2.20A {Arabidopsis thaliana} SCOP: e.1.1.0 | Back alignment and structure |
|---|
| >1mtp_A Serine proteinase inhibitor (serpin), chain A; structural genomics, protease inhibitor; 1.50A {Thermobifida fusca} SCOP: e.1.1.1 | Back alignment and structure |
|---|
| >1jmo_A HC-II, heparin cofactor II, HLS2, serin; serpin, thrombin, protease, inhibition, inhibitor, blood CLO; HET: TYS NDG NAG; 2.20A {Homo sapiens} SCOP: e.1.1.1 PDB: 1jmj_A* | Back alignment and structure |
|---|
| >1sng_A COG4826: serine protease inhibitor; serine protease inhibitor (serpin), native state., hydrolase inhibitor; 1.76A {Thermobifida fusca} SCOP: e.1.1.1 | Back alignment and structure |
|---|
| >2wxy_C Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 2.10A {Mus musculus} PDB: 2wxx_A 2wy0_C 2wxz_A 2wxz_C 2wy1_A | Back alignment and structure |
|---|
| >2pef_A Serine protease inhibitor; serpin; 1.60A {Thermoanaerobacter tengcongensis} PDB: 2vh4_A 2pee_A | Back alignment and structure |
|---|
| >2wxw_A Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 3.30A {Homo sapiens} PDB: 2x0b_B | Back alignment and structure |
|---|
| >2r9y_A Alpha-2-antiplasmin; inhibitory serpin, plasmin inhibitor, AC phase, glycoprotein, protease inhibitor, secreted, serine P inhibitor, sulfation; 2.65A {Mus musculus} | Back alignment and structure |
|---|
| >1f0c_A ICE inhibitor; apoptosis, caspase inhibitor, protease inhibitor, serpin, viral protein; 2.26A {Cowpox virus} SCOP: e.1.1.1 PDB: 1c8o_A | Back alignment and structure |
|---|
| >2oay_A C1-inhibitor, plasma protease C1 inhibitor, C1 INH, C1INH; latent serpin, RCL insertion, immune system,hydrolase inhibi; HET: NAG; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1m93_B Serine proteinase inhibitor 2; serpin, CRMA, apoptosis, ICE inhibitor, viral protein; 1.65A {Cowpox virus} SCOP: e.1.1.1 | Back alignment and structure |
|---|
| >1m93_A Serine proteinase inhibitor 2; serpin, CRMA, apoptosis, ICE inhibitor, viral protein; 1.65A {Cowpox virus} SCOP: e.1.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 342 | ||||
| d1uhga_ | 385 | e.1.1.1 (A:) Ovalbumin {Hen (Gallus gallus) [TaxId | 1e-40 | |
| d1k9oi_ | 376 | e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornwor | 7e-40 | |
| d1lj5a_ | 379 | e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Hu | 2e-39 | |
| d1by7a_ | 381 | e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Hu | 2e-38 | |
| g1hle.1 | 375 | e.1.1.1 (A:,B:) Elastase inhibitor {Horse (Equus c | 3e-38 | |
| g1jjo.1 | 334 | e.1.1.1 (A:,C:,E:) Neuroserpin {Mouse (Mus musculu | 2e-37 | |
| d2b5ti1 | 426 | e.1.1.1 (I:6-431) Antithrombin {Human (Homo sapien | 7e-37 | |
| g1as4.1 | 369 | e.1.1.1 (A:,B:) Antichymotrypsin, alpha-1 {Human ( | 4e-36 | |
| d1xqga_ | 378 | e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: | 2e-35 | |
| g1lq8.1 | 358 | e.1.1.1 (A:,B:) Protein C inhibitor {Human (Homo s | 5e-35 | |
| d1qlpa_ | 372 | e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sap | 4e-34 | |
| d1imva_ | 383 | e.1.1.1 (A:) Pigment epithelium-derived factor, PE | 6e-34 | |
| g1mtp.1 | 355 | e.1.1.1 (A:,B:) Thermopin {Thermobifida fusca [Tax | 9e-32 | |
| d1jmja_ | 420 | e.1.1.1 (A:) Heparin cofactor II (Hc-II, leuserpin | 3e-31 | |
| g1m93.1 | 322 | e.1.1.1 (A:,B:,C:) Viral serpin crmA (cytokine res | 4e-28 |
| >d1uhga_ e.1.1.1 (A:) Ovalbumin {Hen (Gallus gallus) [TaxId: 9031]} Length = 385 | Back information, alignment and structure |
|---|
class: Multi-domain proteins (alpha and beta) fold: Serpins superfamily: Serpins family: Serpins domain: Ovalbumin species: Hen (Gallus gallus) [TaxId: 9031]
Score = 144 bits (363), Expect = 1e-40
Identities = 56/225 (24%), Positives = 105/225 (46%), Gaps = 9/225 (4%)
Query: 115 AANKKENAIISPFSLHVVLGLASFGAAGSTAEAMMKGLRIKHSETL---LKDYKGIIDQL 171
+ EN P ++ L + GA ST + K +R ++ G +
Sbjct: 20 VHHANENIFYCPIAIMSALAMVYLGAKDSTRTQINKVVRFDKLPGFGDSIEAQCGTSVNV 79
Query: 172 SKDYKGIIDQLSKS---PELKIANKIYFAKDIELNPAYQTQAVDNFNSELGKVDFSQPP- 227
+ I++Q++K +A+++Y + + P Y + + L ++F
Sbjct: 80 HSSLRDILNQITKPNDVYSFSLASRLYAEERYPILPEYLQCVKELYRGGLEPINFQTAAD 139
Query: 228 AAAKEMNDWVSNHTNDKIKDLIKADSLDASTKLVLINAIHFKGKWTVPFKPEATKDGPFY 287
A + +N WV + TN I+++++ S+D+ T +VL+NAI FKG W FK E T+ PF
Sbjct: 140 QARELINSWVESQTNGIIRNVLQPSSVDSQTAMVLVNAIVFKGLWEKAFKDEDTQAMPFR 199
Query: 288 LDDTNSVQVPLMFVKDSFYMYEEAGEDGFKMLELPY-GVSISFII 331
+ + S V +M+ F + A + K+LELP+ ++S ++
Sbjct: 200 VTEQESKPVQMMYQIGLFRVASMA-SEKMKILELPFASGTMSMLV 243
|
| >d1k9oi_ e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornworm (Manduca sexta) [TaxId: 7130]} Length = 376 | Back information, alignment and structure |
|---|
| >d1lj5a_ e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 379 | Back information, alignment and structure |
|---|
| >d1by7a_ e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 381 | Back information, alignment and structure |
|---|
| >d2b5ti1 e.1.1.1 (I:6-431) Antithrombin {Human (Homo sapiens) [TaxId: 9606]} Length = 426 | Back information, alignment and structure |
|---|
| >d1xqga_ e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: 9606]} Length = 378 | Back information, alignment and structure |
|---|
| >d1qlpa_ e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 372 | Back information, alignment and structure |
|---|
| >d1imva_ e.1.1.1 (A:) Pigment epithelium-derived factor, PEDF {Human (Homo sapiens) [TaxId: 9606]} Length = 383 | Back information, alignment and structure |
|---|
| >d1jmja_ e.1.1.1 (A:) Heparin cofactor II (Hc-II, leuserpin 2) {Human (Homo sapiens) [TaxId: 9606]} Length = 420 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 342 | |||
| d2b5ti1 | 426 | Antithrombin {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| g1hle.1 | 375 | Elastase inhibitor {Horse (Equus caballus) [TaxId: | 100.0 | |
| d1lj5a_ | 379 | Plasminogen activator inhibitor-1 {Human (Homo sap | 100.0 | |
| d1k9oi_ | 376 | Alaserpin (serpin 1) {Tobacco hornworm (Manduca se | 100.0 | |
| d1uhga_ | 385 | Ovalbumin {Hen (Gallus gallus) [TaxId: 9031]} | 100.0 | |
| d1by7a_ | 381 | Plasminogen activator inhibitor-2 {Human (Homo sap | 100.0 | |
| g1lq8.1 | 358 | Protein C inhibitor {Human (Homo sapiens) [TaxId: | 100.0 | |
| d1jmja_ | 420 | Heparin cofactor II (Hc-II, leuserpin 2) {Human (H | 100.0 | |
| d1xqga_ | 378 | Maspin {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1imva_ | 383 | Pigment epithelium-derived factor, PEDF {Human (Ho | 100.0 | |
| g1as4.1 | 369 | Antichymotrypsin, alpha-1 {Human (Homo sapiens) [T | 100.0 | |
| d1qlpa_ | 372 | Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: | 100.0 | |
| g1mtp.1 | 355 | Thermopin {Thermobifida fusca [TaxId: 2021]} | 100.0 | |
| g1jjo.1 | 334 | Neuroserpin {Mouse (Mus musculus) [TaxId: 10090]} | 100.0 | |
| g1m93.1 | 322 | Viral serpin crmA (cytokine response modifier prot | 100.0 |
| >d2b5ti1 e.1.1.1 (I:6-431) Antithrombin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Multi-domain proteins (alpha and beta) fold: Serpins superfamily: Serpins family: Serpins domain: Antithrombin species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=1.6e-48 Score=385.47 Aligned_cols=232 Identities=28% Similarity=0.536 Sum_probs=208.3
Q ss_pred ccccccccccccccccccCCcchhhhhhhhhhhhhcc--CCCCEEEChhhHHHHHHHHHccCChhHHHHHHHHcCCCCcc
Q psy2651 81 FSSILDQRFNGKLHKKEDFKPFSIQLSTLVEWNLAAN--KKENAIISPFSLHVVLGLASFGAAGSTAEAMMKGLRIKHSE 158 (342)
Q Consensus 81 ~~~~~~~~Fa~~L~~~~~~~~~~~~~~~~~~~~l~~~--~~~Niv~SP~sI~~aLamL~~GA~G~T~~qL~~~Lgl~~~~ 158 (342)
++++.+ +||++||| +++.. +++|+||||+||+.+|+||++||+|+|++||.++||++...
T Consensus 46 l~~~~~-~Fa~~l~~-----------------~l~~~~~~~~N~v~SP~si~~aLa~l~~GA~g~T~~el~~~L~~~~~~ 107 (426)
T d2b5ti1 46 LSKANS-RFATTFYQ-----------------HLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTIS 107 (426)
T ss_dssp HHHHHH-HHHHHHHH-----------------HHHHTSCTTSCEEECHHHHHHHHHHHHTTCCHHHHHHHHHHTTGGGSC
T ss_pred HHHHHH-HHHHHHHH-----------------HHHhcCCCCCEEEECHHHHHHHHHHHHHhCchHHHHHHHHhcCCCCCC
Confidence 556666 99999999 88754 68899999999999999999999999999999999997543
Q ss_pred cchhcccchhHHHHHHHHHHHHHhCCCc----chhhhhhhhhccCcccchHHHHHhhhhcccccEEecCCCc-HHHHHhh
Q psy2651 159 TLLKDYKGIIDQLSKDYKGIIDQLSKSP----ELKIANKIYFAKDIELNPAYQTQAVDNFNSELGKVDFSQP-PAAAKEM 233 (342)
Q Consensus 159 ~~~~~~~~~~~~v~~~~~~l~~~l~~~~----~l~~an~lfv~~~~~l~~~F~~~~~~~y~a~v~~vdF~~~-~~a~~~I 233 (342)
... .+.++..++.+...+.... .+.++|+||++++++++++|++.++++|+++++.+||.++ +.++..|
T Consensus 108 ~~~------~~~~~~~~~~l~~~l~~~~~~~~~l~~an~l~v~~~~~~~~~f~~~~~~~y~a~~~~vdF~~~~~~a~~~I 181 (426)
T d2b5ti1 108 EKT------SDQIHFFFAKLNCRLYRKANKASKLVSANRLFGDKSLTFNETYQDISELVYGAKLQPLDFKENAEQSRAAI 181 (426)
T ss_dssp HHH------HHTHHHHHHHHHHHHTSCCCSSEEEEEEEEEEEETTSCCCHHHHHHHHHHHSSCCEEECTTTCHHHHHHHH
T ss_pred cch------HHHHHHHHHHHHHHHhccCCCCcEEeeeehhhhcccccchHHHHHHHHHhcCCeEEEecccccHHHHHHHH
Confidence 111 1127888888887764322 7999999999999999999999999999999999999875 5678899
Q ss_pred chhhhcccCCccccCCCCCCCCcccceeeeeeccccccccccCCCCCCcccCeeecCCCeEEEeeeeecceeeeEEEeCC
Q psy2651 234 NDWVSNHTNDKIKDLIKADSLDASTKLVLINAIHFKGKWTVPFKPEATKDGPFYLDDTNSVQVPLMFVKDSFYMYEEAGE 313 (342)
Q Consensus 234 N~WV~~~T~g~I~~ll~~~~i~~~t~lvLvNaiyFkg~W~~~F~~~~T~~~~F~~~~g~~~~VpMM~~~~~~f~y~~~~~ 313 (342)
|+||+++|+|+|++++++++++++|.++|+||+||||.|+++|++..|..++|+..+|+.++||||++.+. |+|++.++
T Consensus 182 N~wv~~~T~g~I~~~~~~~~l~~~t~l~Lvna~yFkg~W~~~F~~~~T~~~~F~~~~~~~v~v~mM~~~~~-~~~~~~~~ 260 (426)
T d2b5ti1 182 NKWVSNKTEGRITDVIPSEAINELTVLVLVNTIYFKGLWKSKFSPENTRKELFYKADGESCSASMMYQEGK-FRYRRVAE 260 (426)
T ss_dssp HHHHHHHTTTSCSCSSCTTCSCTTCCEEEEEEEEEEEEBSSCCCGGGCEEEEECCSSSCCEEEEEEEEEEE-EEEEECGG
T ss_pred HHHHHHhcCCCccCCCCccCCCchhHHHHHhhhhhccccccCccccccccceeecCCCeEEEeecceeecc-eeeEEccC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999998 99988755
Q ss_pred CCeEEEEEeC-CCcEEEEEeecCCCCCCC
Q psy2651 314 DGFKMLELPY-GVSISFIIKSQVVPEMGR 341 (342)
Q Consensus 314 l~~~vLELPY-~~~~SMlI~~~ILP~~g~ 341 (342)
++++||||| ++++||+| |||+++.
T Consensus 261 -~~~vveLPy~~~~~sm~i---iLP~~~~ 285 (426)
T d2b5ti1 261 -GTQVLELPFKGDDITMVL---ILPKPEK 285 (426)
T ss_dssp -GCEEEEEEBTTSSEEEEE---EECCSSS
T ss_pred -CeEEEEeecCCCceEEEE---EecCCCC
Confidence 899999999 99999999 8999764
|
| >d1lj5a_ e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k9oi_ e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornworm (Manduca sexta) [TaxId: 7130]} | Back information, alignment and structure |
|---|
| >d1uhga_ e.1.1.1 (A:) Ovalbumin {Hen (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1by7a_ e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jmja_ e.1.1.1 (A:) Heparin cofactor II (Hc-II, leuserpin 2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xqga_ e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1imva_ e.1.1.1 (A:) Pigment epithelium-derived factor, PEDF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qlpa_ e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|