Psyllid ID: psy2677

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MGDEELPAGWEKRMSRSSGHHYYLNIYTKESQWDRPTKPAEASGGPEQVQCSHLLVKHKESRKPYSWRDDNITRSKEEAIELVKSYREQINTGKASFGELASKFSDCSSAKRSGDLGPFGRGTMQKPFEDAAFSLKVGEMSEPVLTESGVHIILRTA
ccccccccccEEEEEcccccEEEEEccccccccccccccccccccccEEEEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccccccccccccHHHHHHHHccccccccccEEccccEEEEEEEc
ccccccccccEEEEEcccccEEEEEcccccccccccccccccccccccEEEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHcccccccccccccccccccccccHHHHHHHHcccccccccccccccEEEEEEcc
mgdeelpagwekrmsrssghhyylniytkesqwdrptkpaeasggpeqvqCSHLLVKhkesrkpyswrddnitRSKEEAIELVKSYREQINTGKASFGELaskfsdcssakrsgdlgpfgrgtmqkpfeDAAFSLkvgemsepvltesgvhiILRTA
mgdeelpagwekrmsrssghhYYLNIYTkesqwdrpTKPAEASGGPEQVQCSHLlvkhkesrkpyswrddnitrsKEEAIELVKSYREQINTGKASFGELASKFSDCSSAKRSGDLGPFGRGTMQKPFEDAAFSLKVgemsepvltesgvhiilrta
MGDEELPAGWEKRMSRSSGHHYYLNIYTKESQWDRPTKPAEASGGPEQVQCSHLLVKHKESRKPYSWRDDNITRSKEEAIELVKSYREQINTGKASFGELASKFSDCSSAKRSGDLGPFGRGTMQKPFEDAAFSLKVGEMSEPVLTESGVHIILRTA
*******************HHYYLNIYTK************************************************************************************************************************VHII****
***EELPAGWEKRMSRSSGHHYYLNIYTKESQW***************VQCSHLLVKHKESR*************KEEAIELVKSYREQINTGKASFGE*****************GPFGRGTMQKPFEDAAFSLKVGEMSEPVLTESGVHIILRTA
************RMSRSSGHHYYLNIYTKESQ****************VQCSHLLVKHKESRKPYSWRDDNITRSKEEAIELVKSYREQINTGKASFGELASKFSDCSSAKRSGDLGPFGRGTMQKPFEDAAFSLKVGEMSEPVLTESGVHIILRTA
*****LPAGWEKRMSRSSGHHYYLNIYTKESQWDRPTKP****GGPEQVQCSHLLVKHKE******W******RSKEEAIELVKSYREQINTGKASFGEL*S*F*DC******GDLGPFGRGTMQKPFEDAAFSLKVGEMSEPVLTESGVHIILRTA
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDEELPAGWEKRMSRSSGHHYYLNIYTKESQWDRPTKPAEASGGPEQVQCSHLLVKHKESRKPYSWRDDNITRSKEEAIELVKSYREQINTGKASFGELASKFSDCSSAKRSGDLGPFGRGTMQKPFEDAAFSLKVGEMSEPVLTESGVHIILRTA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query157 2.2.26 [Sep-21-2011]
Q9QUR7165 Peptidyl-prolyl cis-trans yes N/A 0.993 0.945 0.615 7e-53
Q5BIN5163 Peptidyl-prolyl cis-trans yes N/A 0.993 0.957 0.617 1e-52
Q13526163 Peptidyl-prolyl cis-trans yes N/A 0.993 0.957 0.611 2e-52
Q4R383163 Peptidyl-prolyl cis-trans N/A N/A 0.993 0.957 0.604 2e-51
P54353166 Putative peptidyl-prolyl yes N/A 0.980 0.927 0.611 2e-49
P0C1J8150 Peptidyl-prolyl cis-trans N/A N/A 0.949 0.993 0.529 6e-43
O74448175 Peptidyl-prolyl cis-trans yes N/A 0.993 0.891 0.477 4e-37
O60045182 Peptidyl-prolyl cis-trans N/A N/A 0.955 0.824 0.447 6e-34
Q9SL42119 Peptidyl-prolyl cis-trans yes N/A 0.707 0.932 0.573 1e-32
Q94G00121 Peptidyl-prolyl cis-trans N/A N/A 0.732 0.950 0.554 1e-31
>sp|Q9QUR7|PIN1_MOUSE Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Mus musculus GN=Pin1 PE=1 SV=1 Back     alignment and function desciption
 Score =  205 bits (522), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 101/164 (61%), Positives = 121/164 (73%), Gaps = 8/164 (4%)

Query: 1   MGDEE-LPAGWEKRMSRSSGHHYYLNIYTKESQWDRPTKPA-------EASGGPEQVQCS 52
           M DEE LP GWEKRMSRSSG  YY N  T  SQW+RP+  +          G P +V+CS
Sbjct: 1   MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGGSTVGGSSKNGQGEPAKVRCS 60

Query: 53  HLLVKHKESRKPYSWRDDNITRSKEEAIELVKSYREQINTGKASFGELASKFSDCSSAKR 112
           HLLVKH +SR+P SWR + ITRSKEEA+EL+  Y ++I +G+  F  LAS+FSDCSSAK 
Sbjct: 61  HLLVKHSQSRRPSSWRQEKITRSKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKA 120

Query: 113 SGDLGPFGRGTMQKPFEDAAFSLKVGEMSEPVLTESGVHIILRT 156
            GDLGPF RG MQKPFEDA+F+L+ GEMS PV T+SG+HIILRT
Sbjct: 121 RGDLGPFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRT 164
Essential PPIase that regulates mitosis presumably by interacting with NIMA and attenuating its mitosis-promoting activity. Displays a preference for an acidic residue N-terminal to the isomerized proline bond. Catalyzes pSer/Thr-Pro cis/trans isomerizations. Down-regulates kinase activity of BTK. Can transactivate multiple oncogenes and induce centrosome amplification, chromosome instability and cell transformation (By similarity). Required for the efficient dephosphorylation and recycling of RAF1 after mitogen activation.
Mus musculus (taxid: 10090)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q5BIN5|PIN1_BOVIN Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Bos taurus GN=PIN1 PE=2 SV=1 Back     alignment and function description
>sp|Q13526|PIN1_HUMAN Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Homo sapiens GN=PIN1 PE=1 SV=1 Back     alignment and function description
>sp|Q4R383|PIN1_MACFA Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Macaca fascicularis GN=PIN1 PE=2 SV=1 Back     alignment and function description
>sp|P54353|DOD_DROME Putative peptidyl-prolyl cis-trans isomerase dodo OS=Drosophila melanogaster GN=dod PE=2 SV=3 Back     alignment and function description
>sp|P0C1J8|PIN1_RHIO9 Peptidyl-prolyl cis-trans isomerase pin1 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=pin1 PE=3 SV=1 Back     alignment and function description
>sp|O74448|PIN1_SCHPO Peptidyl-prolyl cis-trans isomerase pin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pin1 PE=4 SV=1 Back     alignment and function description
>sp|O60045|SSP1_NEUCR Peptidyl-prolyl cis-trans isomerase ssp-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ssp-1 PE=1 SV=3 Back     alignment and function description
>sp|Q9SL42|PIN1_ARATH Peptidyl-prolyl cis-trans isomerase Pin1 OS=Arabidopsis thaliana GN=PIN1 PE=1 SV=1 Back     alignment and function description
>sp|Q94G00|PIN1_MALDO Peptidyl-prolyl cis-trans isomerase Pin1 OS=Malus domestica GN=PIN1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
332025211162 Peptidyl-prolyl cis-trans isomerase NIMA 1.0 0.969 0.771 1e-68
380016984162 PREDICTED: peptidyl-prolyl cis-trans iso 1.0 0.969 0.771 1e-68
340718429162 PREDICTED: peptidyl-prolyl cis-trans iso 1.0 0.969 0.765 1e-68
332375258159 unknown [Dendroctonus ponderosae] 1.0 0.987 0.773 2e-68
383860249162 PREDICTED: peptidyl-prolyl cis-trans iso 1.0 0.969 0.765 2e-68
91079624159 PREDICTED: similar to dodo [Tribolium ca 1.0 0.987 0.767 3e-68
66563115162 PREDICTED: peptidyl-prolyl cis-trans iso 1.0 0.969 0.765 3e-68
307190110162 Peptidyl-prolyl cis-trans isomerase NIMA 0.993 0.962 0.770 1e-67
156541340162 PREDICTED: protein dodo-like isoform 1 [ 1.0 0.969 0.728 6e-66
242023877160 peptidyl-prolyl cis-trans isomerase NIMA 0.987 0.968 0.757 5e-65
>gi|332025211|gb|EGI65389.1| Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 141/162 (87%), Gaps = 5/162 (3%)

Query: 1   MGDEELPAGWEKRMSRSSGHHYYLNIYTKESQWDRPTKPAEASG-----GPEQVQCSHLL 55
           M DEELPAGWEKR+SRS+G HYYLNIYTKESQWDRP KPA+ SG     GPE+VQCSHLL
Sbjct: 1   MADEELPAGWEKRLSRSTGQHYYLNIYTKESQWDRPDKPADPSGNGKTDGPEEVQCSHLL 60

Query: 56  VKHKESRKPYSWRDDNITRSKEEAIELVKSYREQINTGKASFGELASKFSDCSSAKRSGD 115
           VKH  SR+P SWR++NITRSKEEA++LVKSYREQI +GKA+F ELASK+SDCSSAKR GD
Sbjct: 61  VKHSGSRRPSSWREENITRSKEEALDLVKSYREQIASGKATFAELASKYSDCSSAKRGGD 120

Query: 116 LGPFGRGTMQKPFEDAAFSLKVGEMSEPVLTESGVHIILRTA 157
           LGPF RG MQKPFE AAF+LKVGE+S PV T+SG+HII RTA
Sbjct: 121 LGPFSRGAMQKPFEQAAFALKVGELSSPVHTDSGIHIIQRTA 162

Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380016984|ref|XP_003692447.1| PREDICTED: peptidyl-prolyl cis-trans isomerase NIMA-interacting 1-like [Apis florea] Back     alignment and taxonomy information
>gi|340718429|ref|XP_003397670.1| PREDICTED: peptidyl-prolyl cis-trans isomerase NIMA-interacting 1-like [Bombus terrestris] gi|350401937|ref|XP_003486313.1| PREDICTED: peptidyl-prolyl cis-trans isomerase NIMA-interacting 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332375258|gb|AEE62770.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|383860249|ref|XP_003705603.1| PREDICTED: peptidyl-prolyl cis-trans isomerase NIMA-interacting 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|91079624|ref|XP_967576.1| PREDICTED: similar to dodo [Tribolium castaneum] gi|270004471|gb|EFA00919.1| hypothetical protein TcasGA2_TC003825 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|66563115|ref|XP_624205.1| PREDICTED: peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|307190110|gb|EFN74266.1| Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|156541340|ref|XP_001599709.1| PREDICTED: protein dodo-like isoform 1 [Nasonia vitripennis] gi|345485284|ref|XP_003425232.1| PREDICTED: protein dodo-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|242023877|ref|XP_002432357.1| peptidyl-prolyl cis-trans isomerase NIMA-interacting, putative [Pediculus humanus corporis] gi|212517780|gb|EEB19619.1| peptidyl-prolyl cis-trans isomerase NIMA-interacting, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
ZFIN|ZDB-GENE-040426-1714159 pin1 "protein (peptidyl-prolyl 0.980 0.968 0.658 4.9e-53
RGD|1310299160 Pin1 "peptidylprolyl cis/trans 0.993 0.975 0.635 2.2e-50
MGI|MGI:1346036165 Pin1 "protein (peptidyl-prolyl 0.993 0.945 0.615 5.8e-50
UNIPROTKB|Q5BIN5163 PIN1 "Peptidyl-prolyl cis-tran 0.993 0.957 0.623 1.2e-49
UNIPROTKB|Q13526163 PIN1 "Peptidyl-prolyl cis-tran 0.993 0.957 0.617 2.5e-49
UNIPROTKB|F1P6C1163 PIN1 "Uncharacterized protein" 0.993 0.957 0.611 3.2e-49
UNIPROTKB|F1S3G5163 PIN1 "Peptidyl-prolyl cis-tran 0.980 0.944 0.609 6.7e-49
FB|FBgn0015379166 dod "dodo" [Drosophila melanog 0.980 0.927 0.611 1.6e-47
WB|WBGene00022448161 pinn-1 [Caenorhabditis elegans 0.987 0.962 0.572 5e-44
POMBASE|SPCC16C4.03175 pin1 "peptidyl-prolyl cis-tran 0.751 0.674 0.588 4.5e-38
ZFIN|ZDB-GENE-040426-1714 pin1 "protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 549 (198.3 bits), Expect = 4.9e-53, P = 4.9e-53
 Identities = 102/155 (65%), Positives = 127/155 (81%)

Query:     3 DEELPAGWEKRMSRSSGHHYYLNIYTKESQWDRPT-KPAEASGGPEQVQCSHLLVKHKES 61
             DE+LP+GWEKRMSRSSG  YY N  T  SQW+RP+   A+ +G  E+V+CSHLLVKH +S
Sbjct:     4 DEKLPSGWEKRMSRSSGRVYYFNHITNASQWERPSGSGADGAGDVEKVRCSHLLVKHSQS 63

Query:    62 RKPYSWRDDNITRSKEEAIELVKSYREQINTGKASFGELASKFSDCSSAKRSGDLGPFGR 121
             R+P SWR++NITRSK+EA++L++ Y EQI +G+  F  LAS+FSDCSSA+  GDLG FGR
Sbjct:    64 RRPSSWREENITRSKDEALQLIQKYIEQIKSGEEEFESLASQFSDCSSARNGGDLGLFGR 123

Query:   122 GTMQKPFEDAAFSLKVGEMSEPVLTESGVHIILRT 156
             G MQKPFEDA+F+LKVG+MS PV T+SGVHIILRT
Sbjct:   124 GQMQKPFEDASFALKVGDMSGPVFTDSGVHIILRT 158
GO:0016853 "isomerase activity" evidence=IEA
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=IEA
GO:0006457 "protein folding" evidence=IEA
RGD|1310299 Pin1 "peptidylprolyl cis/trans isomerase, NIMA-interacting 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1346036 Pin1 "protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5BIN5 PIN1 "Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q13526 PIN1 "Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P6C1 PIN1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1S3G5 PIN1 "Peptidyl-prolyl cis-trans isomerase NIMA interacting 1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0015379 dod "dodo" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00022448 pinn-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
POMBASE|SPCC16C4.03 pin1 "peptidyl-prolyl cis-trans isomerase Pin1" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O74448PIN1_SCHPO5, ., 2, ., 1, ., 80.47720.99360.8914yesN/A
Q13526PIN1_HUMAN5, ., 2, ., 1, ., 80.61110.99360.9570yesN/A
Q5BIN5PIN1_BOVIN5, ., 2, ., 1, ., 80.61720.99360.9570yesN/A
Q9QUR7PIN1_MOUSE5, ., 2, ., 1, ., 80.61580.99360.9454yesN/A
Q4R383PIN1_MACFA5, ., 2, ., 1, ., 80.60490.99360.9570N/AN/A
P54353DOD_DROME5, ., 2, ., 1, ., 80.61110.98080.9277yesN/A
P0C1J8PIN1_RHIO95, ., 2, ., 1, ., 80.52940.94900.9933N/AN/A
P22696ESS1_YEAST5, ., 2, ., 1, ., 80.46870.96810.8941yesN/A
Q9SL42PIN1_ARATH5, ., 2, ., 1, ., 80.57390.70700.9327yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.976
4th Layer5.2.1.80.991

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
PTZ00356115 PTZ00356, PTZ00356, peptidyl-prolyl cis-trans isom 1e-56
pfam0063994 pfam00639, Rotamase, PPIC-type PPIASE domain 5e-31
pfam13616114 pfam13616, Rotamase_3, PPIC-type PPIASE domain 5e-18
COG0760320 COG0760, SurA, Parvulin-like peptidyl-prolyl isome 7e-17
PRK03095287 PRK03095, prsA, peptidylprolyl isomerase; Reviewed 7e-14
TIGR02933256 TIGR02933, nifM_nitrog, nitrogen fixation protein 3e-12
PRK03002285 PRK03002, prsA, peptidylprolyl isomerase; Reviewed 4e-12
PRK02998283 PRK02998, prsA, peptidylprolyl isomerase; Reviewed 3e-11
PRK1544193 PRK15441, PRK15441, peptidyl-prolyl cis-trans isom 8e-11
PRK00059336 PRK00059, prsA, peptidylprolyl isomerase; Provisio 2e-09
PRK10770413 PRK10770, PRK10770, peptidyl-prolyl cis-trans isom 2e-09
pfam0039730 pfam00397, WW, WW domain 5e-08
cd0020131 cd00201, WW, Two conserved tryptophans domain; als 6e-08
smart0045633 smart00456, WW, Domain with 2 conserved Trp (W) re 3e-07
PRK04405298 PRK04405, prsA, peptidylprolyl isomerase; Provisio 1e-05
>gnl|CDD|185573 PTZ00356, PTZ00356, peptidyl-prolyl cis-trans isomerase (PPIase); Provisional Back     alignment and domain information 
 Score =  172 bits (438), Expect = 1e-56
 Identities = 67/114 (58%), Positives = 85/114 (74%), Gaps = 1/114 (0%)

Query: 45  GPEQVQCSHLLVKHKESRKPYSWR-DDNITRSKEEAIELVKSYREQINTGKASFGELASK 103
             + V+ +HLL+KH  SR P S R    +TRSKEEAI+ +  +REQI +G+ +F E+A +
Sbjct: 2   EGDTVRAAHLLIKHTGSRNPVSRRTGKPVTRSKEEAIKELAKWREQIVSGEKTFEEIARQ 61

Query: 104 FSDCSSAKRSGDLGPFGRGTMQKPFEDAAFSLKVGEMSEPVLTESGVHIILRTA 157
            SDC SA + GDLG FGRG MQKPFEDAAF+LKVGE+S+ V T+SGVHIILR A
Sbjct: 62  RSDCGSAAKGGDLGFFGRGQMQKPFEDAAFALKVGEISDIVHTDSGVHIILRLA 115

Length = 115
>gnl|CDD|216038 pfam00639, Rotamase, PPIC-type PPIASE domain Back     alignment and domain information
>gnl|CDD|222266 pfam13616, Rotamase_3, PPIC-type PPIASE domain Back     alignment and domain information
>gnl|CDD|223831 COG0760, SurA, Parvulin-like peptidyl-prolyl isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|179537 PRK03095, prsA, peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>gnl|CDD|131979 TIGR02933, nifM_nitrog, nitrogen fixation protein NifM Back     alignment and domain information
>gnl|CDD|101162 PRK03002, prsA, peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>gnl|CDD|179522 PRK02998, prsA, peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>gnl|CDD|185338 PRK15441, PRK15441, peptidyl-prolyl cis-trans isomerase C; Provisional Back     alignment and domain information
>gnl|CDD|234605 PRK00059, prsA, peptidylprolyl isomerase; Provisional Back     alignment and domain information
>gnl|CDD|236758 PRK10770, PRK10770, peptidyl-prolyl cis-trans isomerase SurA; Provisional Back     alignment and domain information
>gnl|CDD|215899 pfam00397, WW, WW domain Back     alignment and domain information
>gnl|CDD|238122 cd00201, WW, Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs Back     alignment and domain information
>gnl|CDD|197736 smart00456, WW, Domain with 2 conserved Trp (W) residues Back     alignment and domain information
>gnl|CDD|235295 PRK04405, prsA, peptidylprolyl isomerase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 157
KOG3259|consensus163 100.0
PF13616117 Rotamase_3: PPIC-type PPIASE domain; PDB: 3RFW_A 3 99.96
PTZ00356115 peptidyl-prolyl cis-trans isomerase (PPIase); Prov 99.95
PF0063995 Rotamase: PPIC-type PPIASE domain; InterPro: IPR00 99.94
PRK1544193 peptidyl-prolyl cis-trans isomerase C; Provisional 99.93
TIGR02933256 nifM_nitrog nitrogen fixation protein NifM. Member 99.93
PRK10770 413 peptidyl-prolyl cis-trans isomerase SurA; Provisio 99.91
PRK04405298 prsA peptidylprolyl isomerase; Provisional 99.87
PRK10770413 peptidyl-prolyl cis-trans isomerase SurA; Provisio 99.87
PRK02998283 prsA peptidylprolyl isomerase; Reviewed 99.86
PRK03002285 prsA peptidylprolyl isomerase; Reviewed 99.85
PRK03095287 prsA peptidylprolyl isomerase; Reviewed 99.85
KOG3258|consensus133 99.82
PRK01326310 prsA foldase protein PrsA; Reviewed 99.8
PRK00059336 prsA peptidylprolyl isomerase; Provisional 99.79
PRK10788 623 periplasmic folding chaperone; Provisional 99.78
PRK12450309 foldase protein PrsA; Reviewed 99.76
TIGR02925232 cis_trans_EpsD peptidyl-prolyl cis-trans isomerase 99.75
COG0760320 SurA Parvulin-like peptidyl-prolyl isomerase [Post 99.51
PF13145121 Rotamase_2: PPIC-type PPIASE domain; PDB: 3NRK_A 2 98.85
PF0039731 WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp 97.92
smart0045632 WW Domain with 2 conserved Trp (W) residues. Also 97.67
cd0020131 WW Two conserved tryptophans domain; also known as 97.09
KOG1891|consensus271 96.86
PRK10788 623 periplasmic folding chaperone; Provisional 94.14
KOG1891|consensus271 91.28
>KOG3259|consensus Back     alignment and domain information 
Probab=100.00  E-value=3e-40  Score=231.39  Aligned_cols=157  Identities=66%  Similarity=1.082  Sum_probs=148.1

Q ss_pred             CCCCCCCcchhhhcccCCCceeeEeeecccccccCCCCCCCC-----CCCCCcEEEEEEEeeccCCCCCCCCCccchhhh
Q psy2677           1 MGDEELPAGWEKRMSRSSGHHYYLNIYTKESQWDRPTKPAEA-----SGGPEQVQCSHLLVKHKESRKPYSWRDDNITRS   75 (157)
Q Consensus         1 ~~~~~~p~~w~~~~~~~~~~~y~~n~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~Ili~~~~~~~~~~~~~~~~~~~   75 (157)
                      |+.+.||.+|+++.+++.++.||.|+.|+..||+.|......     ...|++|++.||||+......|++|..++++.+
T Consensus         2 ~~~~~LP~~Wekr~Srs~gr~YyfN~~T~~SqWe~P~~t~~~~~~~~~~~p~~Vr~sHlLVKH~~SRrpsSwr~~~it~s   81 (163)
T KOG3259|consen    2 ADEEKLPPGWEKRMSRSSGRPYYFNTETNESQWERPSGTSKSGGKIGQGEPARVRCSHLLVKHKGSRRPSSWRSENITRS   81 (163)
T ss_pred             cccccCCchhheeccccCCCcceeccccchhhccCCCccccccccccCCCccceeEEEEEEccccCCCCcccccccchhh
Confidence            567789999999999999999999999999999999875532     346899999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHhcChhhHHHHHHhhCCCchhhcCCCcccccCCCCcHHHHHHHhcCCCCCccccEEeCCeEEEEEE
Q psy2677          76 KEEAIELVKSYREQINTGKASFGELASKFSDCSSAKRSGDLGPFGRGTMQKPFEDAAFSLKVGEMSEPVLTESGVHIILR  155 (157)
Q Consensus        76 ~~~A~~~~~~i~~~l~~g~~~F~~lA~~yS~~~~~~~gG~lg~~~~~~l~~~~~~av~~l~~Geis~pi~t~~G~hIi~v  155 (157)
                      +++|.++|+.+.+.|++|..+|.+||+++|+|+++..|||||+|.+++|-++|+++.|.|++|++|+||.|+.|+|||+-
T Consensus        82 keeA~~llk~~~~~l~~g~~~f~elA~q~SdCSSaKRGGDLG~fgrgqMqk~FEdaafaL~~ge~SgiV~t~SG~HiI~R  161 (163)
T KOG3259|consen   82 KEEALDLLKGYHEDLKSGSGDFEELAKQRSDCSSAKRGGDLGFFGRGQMQKPFEDAAFALKVGEMSGIVDTDSGVHIIYR  161 (163)
T ss_pred             HHHHHHHHHHhHHHhhcCcccHHHHHHhhcChhhhccCCcccccccccccccchhhhhhcccccccCceecCCceEEEEe
Confidence            99999999999999999988999999999999999999999999999999999999999999999999999999999986


Q ss_pred             eC
Q psy2677         156 TA  157 (157)
Q Consensus       156 ~~  157 (157)
                      .+
T Consensus       162 ~~  163 (163)
T KOG3259|consen  162 TA  163 (163)
T ss_pred             cC
Confidence            53

>PF13616 Rotamase_3: PPIC-type PPIASE domain; PDB: 3RFW_A 3UI5_A 3UI4_A 1FJD_A 1EQ3_A 1ZK6_A Back     alignment and domain information
>PTZ00356 peptidyl-prolyl cis-trans isomerase (PPIase); Provisional Back     alignment and domain information
>PF00639 Rotamase: PPIC-type PPIASE domain; InterPro: IPR000297 Peptidylprolyl isomerase (5 Back     alignment and domain information
>PRK15441 peptidyl-prolyl cis-trans isomerase C; Provisional Back     alignment and domain information
>TIGR02933 nifM_nitrog nitrogen fixation protein NifM Back     alignment and domain information
>PRK10770 peptidyl-prolyl cis-trans isomerase SurA; Provisional Back     alignment and domain information
>PRK04405 prsA peptidylprolyl isomerase; Provisional Back     alignment and domain information
>PRK10770 peptidyl-prolyl cis-trans isomerase SurA; Provisional Back     alignment and domain information
>PRK02998 prsA peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>PRK03002 prsA peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>PRK03095 prsA peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>KOG3258|consensus Back     alignment and domain information
>PRK01326 prsA foldase protein PrsA; Reviewed Back     alignment and domain information
>PRK00059 prsA peptidylprolyl isomerase; Provisional Back     alignment and domain information
>PRK10788 periplasmic folding chaperone; Provisional Back     alignment and domain information
>PRK12450 foldase protein PrsA; Reviewed Back     alignment and domain information
>TIGR02925 cis_trans_EpsD peptidyl-prolyl cis-trans isomerase, EpsD family Back     alignment and domain information
>COG0760 SurA Parvulin-like peptidyl-prolyl isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13145 Rotamase_2: PPIC-type PPIASE domain; PDB: 3NRK_A 2KGJ_A Back     alignment and domain information
>PF00397 WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp5 or WWP domain The WW domain is a short conserved region in a number of unrelated proteins, which folds as a stable, triple stranded beta-sheet Back     alignment and domain information
>smart00456 WW Domain with 2 conserved Trp (W) residues Back     alignment and domain information
>cd00201 WW Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs Back     alignment and domain information
>KOG1891|consensus Back     alignment and domain information
>PRK10788 periplasmic folding chaperone; Provisional Back     alignment and domain information
>KOG1891|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
1pin_A163 Pin1 Peptidyl-Prolyl Cis-Trans Isomerase From Homo 2e-53
1f8a_B167 Structural Basis For The Phosphoserine-Proline Reco 3e-53
2zqv_A163 Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl 4e-53
2zr4_A163 Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl 5e-53
2zr5_A163 Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl 1e-52
2zr6_A163 Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl 2e-52
2zqt_A163 Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl 2e-52
3tc5_A166 Selective Targeting Of Disease-Relevant Protein Bin 2e-52
2itk_A167 Human Pin1 Bound To D-Peptide Length = 167 2e-52
2zqs_A163 Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl 3e-52
2zqu_A163 Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl 5e-52
3kad_A167 Structure-Guided Design Of Alpha-Amino Acid-Derived 9e-52
3tcz_A158 Human Pin1 Bound To Cis Peptidomimetic Inhibitor Le 2e-51
2f21_A162 Human Pin1 Fip Mutant Length = 162 2e-50
1zcn_A161 Human Pin1 Ng Mutant Length = 161 2e-50
1nmw_A114 Solution Structure Of The Ppiase Domain Of Human Pi 2e-40
3ik8_A123 Structure-Based Design Of Novel Pin1 Inhibitors (I) 5e-40
3kac_A123 Structure-Guided Design Of Alpha-Amino Acid-Derived 5e-40
1yw5_A177 Peptidyl-Prolyl Isomerase Ess1 From Candida Albican 3e-34
1j6y_A139 Solution Structure Of Pin1at From Arabidopsis Thali 2e-33
2lj4_A115 Solution Structure Of The Tbpin1 Length = 115 2e-20
2rqs_A97 3d Structure Of Pin From The Psychrophilic Archeon 4e-16
2jzv_A111 Solution Structure Of S. Aureus Prsa-Ppiase Length 4e-11
1jns_A92 Nmr Structure Of The E. Coli Peptidyl-Prolyl CisTRA 4e-10
1zk6_A93 Nmr Solution Structure Of B. Subtilis Prsa Ppiase L 7e-10
3rfw_A252 The Virulence Factor Peb4 And The Periplasmic Prote 4e-08
1eq3_A96 Nmr Structure Of Human Parvulin Hpar14 Length = 96 3e-07
3ui4_A101 0.8 A Resolution Crystal Structure Of Human Parvuli 3e-07
1i6c_A39 Solution Structure Of Pin1 Ww Domain Length = 39 4e-07
1fjd_A104 Human Parvulin-Like Peptidyl Prolyl CisTRANS ISOMER 5e-07
2lb3_A36 Structure Of The Ww Domain Of Pin1 In Complex With 5e-07
2kcf_A36 The Nmr Solution Structure Of The Isolated Apo Pin1 5e-07
1m5y_A408 Crystallographic Structure Of Sura, A Molecular Cha 6e-05
4g2p_A110 Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isom 1e-04
>pdb|1PIN|A Chain A, Pin1 Peptidyl-Prolyl Cis-Trans Isomerase From Homo Sapiens Length = 163 Back     alignment and structure 
Iteration: 1

 Score =  204 bits (518), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 121/162 (74%), Gaps = 6/162 (3%)
Query: 1   MGDEE-LPAGWEKRMSRSSGHHYYLNIYTKESQWDRPTKPAEASGG-----PEQVQCSHL 54
           M DEE LP GWEKRMSRSSG  YY N  T  SQW+RP+  + + G      P +V+CSHL
Sbjct: 1   MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL 60
Query: 55  LVKHKESRKPYSWRDDNITRSKEEAIELVKSYREQINTGKASFGELASKFSDCSSAKRSG 114
           LVKH +SR+P SWR + ITR+KEEA+EL+  Y ++I +G+  F  LAS+FSDCSSAK  G
Sbjct: 61  LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG 120
Query: 115 DLGPFGRGTMQKPFEDAAFSLKVGEMSEPVLTESGVHIILRT 156
           DLG F RG MQKPFEDA+F+L+ GEMS PV T+SG+HIILRT
Sbjct: 121 DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRT 162
>pdb|1F8A|B Chain B, Structural Basis For The Phosphoserine-Proline Recognition By Group Iv Ww Domains Length = 167 Back     alignment and structure
>pdb|2ZQV|A Chain A, Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl Cis-Trans Isomerase Length = 163 Back     alignment and structure
>pdb|2ZR4|A Chain A, Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl Cis-Trans Isomerase Length = 163 Back     alignment and structure
>pdb|2ZR5|A Chain A, Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl Cis-Trans Isomerase Length = 163 Back     alignment and structure
>pdb|2ZR6|A Chain A, Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl Cis-Trans Isomerase Length = 163 Back     alignment and structure
>pdb|2ZQT|A Chain A, Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl Cis-Trans Isomerase Length = 163 Back     alignment and structure
>pdb|3TC5|A Chain A, Selective Targeting Of Disease-Relevant Protein Binding Domains By O- Phosphorylated Natural Product Derivatives Length = 166 Back     alignment and structure
>pdb|2ITK|A Chain A, Human Pin1 Bound To D-Peptide Length = 167 Back     alignment and structure
>pdb|2ZQS|A Chain A, Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl Cis-Trans Isomerase Length = 163 Back     alignment and structure
>pdb|2ZQU|A Chain A, Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl Cis-Trans Isomerase Length = 163 Back     alignment and structure
>pdb|3KAD|A Chain A, Structure-Guided Design Of Alpha-Amino Acid-Derived Pin1 Inhibitors Length = 167 Back     alignment and structure
>pdb|3TCZ|A Chain A, Human Pin1 Bound To Cis Peptidomimetic Inhibitor Length = 158 Back     alignment and structure
>pdb|2F21|A Chain A, Human Pin1 Fip Mutant Length = 162 Back     alignment and structure
>pdb|1ZCN|A Chain A, Human Pin1 Ng Mutant Length = 161 Back     alignment and structure
>pdb|1NMW|A Chain A, Solution Structure Of The Ppiase Domain Of Human Pin1 Length = 114 Back     alignment and structure
>pdb|3IK8|A Chain A, Structure-Based Design Of Novel Pin1 Inhibitors (I) Length = 123 Back     alignment and structure
>pdb|3KAC|A Chain A, Structure-Guided Design Of Alpha-Amino Acid-Derived Pin1 Inhibitors Length = 123 Back     alignment and structure
>pdb|1YW5|A Chain A, Peptidyl-Prolyl Isomerase Ess1 From Candida Albicans Length = 177 Back     alignment and structure
>pdb|1J6Y|A Chain A, Solution Structure Of Pin1at From Arabidopsis Thaliana Length = 139 Back     alignment and structure
>pdb|2LJ4|A Chain A, Solution Structure Of The Tbpin1 Length = 115 Back     alignment and structure
>pdb|2RQS|A Chain A, 3d Structure Of Pin From The Psychrophilic Archeon Cenarcheaum Symbiosum (Cspin) Length = 97 Back     alignment and structure
>pdb|2JZV|A Chain A, Solution Structure Of S. Aureus Prsa-Ppiase Length = 111 Back     alignment and structure
>pdb|1JNS|A Chain A, Nmr Structure Of The E. Coli Peptidyl-Prolyl CisTRANS- Isomerase Parvulin 10 Length = 92 Back     alignment and structure
>pdb|1ZK6|A Chain A, Nmr Solution Structure Of B. Subtilis Prsa Ppiase Length = 93 Back     alignment and structure
>pdb|3RFW|A Chain A, The Virulence Factor Peb4 And The Periplasmic Protein Cj1289 Are Two Structurally-Related Sura-Like Chaperones In The Human Pathogen Campylobacter Jejuni Length = 252 Back     alignment and structure
>pdb|1EQ3|A Chain A, Nmr Structure Of Human Parvulin Hpar14 Length = 96 Back     alignment and structure
>pdb|3UI4|A Chain A, 0.8 A Resolution Crystal Structure Of Human Parvulin 14 Length = 101 Back     alignment and structure
>pdb|1I6C|A Chain A, Solution Structure Of Pin1 Ww Domain Length = 39 Back     alignment and structure
>pdb|1FJD|A Chain A, Human Parvulin-Like Peptidyl Prolyl CisTRANS ISOMERASE, Hpar14 Length = 104 Back     alignment and structure
>pdb|2LB3|A Chain A, Structure Of The Ww Domain Of Pin1 In Complex With A Human Phosphorylated Smad3 Derived Peptide Length = 36 Back     alignment and structure
>pdb|2KCF|A Chain A, The Nmr Solution Structure Of The Isolated Apo Pin1 Ww Domain Length = 36 Back     alignment and structure
>pdb|1M5Y|A Chain A, Crystallographic Structure Of Sura, A Molecular Chaperone That Facilitates Outer Membrane Porin Folding Length = 408 Back     alignment and structure
>pdb|4G2P|A Chain A, Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase Domain Ii Of Molecular Chaperone Sura From Salmonella Enterica Subsp. Enterica Serovar Typhimurium Str. 14028s Length = 110 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
3tc5_A166 Peptidyl-prolyl CIS-trans isomerase NIMA-interact; 3e-74
1yw5_A177 Peptidyl prolyl CIS/trans isomerase; WW-domain, pp 2e-69
3i6c_A123 Peptidyl-prolyl CIS-trans isomerase NIMA- interact 3e-58
1j6y_A139 Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN 1e-57
2jzv_A111 Foldase protein PRSA; ppiase, parvulin, proline is 7e-45
2rqs_A97 Parvulin-like peptidyl-prolyl isomerase; CIS/trans 6e-34
4g2p_A110 Chaperone SURA; structural genomics, PSI-biology, 5e-31
1jns_A92 Peptidyl-prolyl CIS-trans isomerase C; alpha-beta 5e-30
3gpk_A112 PPIC-type peptidyl-prolyl CIS-trans isomerase; rot 1e-29
1zk6_A93 Foldase protein PRSA; alpha/beta structure, isomer 3e-29
2pv1_A103 Chaperone SURA; surviVal protein A, peptidyl-proly 7e-29
2kgj_A102 Peptidyl-prolyl CIS-trans isomerase D; prolyl isom 1e-25
3ui4_A101 Peptidyl-prolyl CIS-trans isomerase NIMA-interact; 3e-25
3rfw_A252 Cell-binding factor 2; SURA-like, chaperone; 2.20A 2e-24
3nrk_A325 LIC12922; NC domain, parvulin domain, SURA homolog 6e-22
1m5y_A408 SurviVal protein, surviVal protein SURA; surviVal 4e-18
1m5y_A 408 SurviVal protein, surviVal protein SURA; surviVal 1e-15
2jv4_A54 Peptidyl-prolyl CIS/trans isomerase; ppiase domain 3e-15
2dmv_A43 Itchy homolog E3 ubiquitin protein ligase; WW doma 2e-11
1wr3_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 2e-09
2ysh_A40 GAS-7, growth-arrest-specific protein 7; WW domain 3e-09
2ysb_A49 Salvador homolog 1 protein; WW domain, structural 4e-09
1wr4_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 5e-09
2kyk_A39 E3 ubiquitin-protein ligase itchy homolog; LMP2A, 6e-09
1jmq_A46 YAP65, 65 kDa YES-associated protein; polyproline 6e-09
1ymz_A43 CC45; artificial protein, computational design, un 7e-09
2djy_A42 SMAD ubiquitination regulatory factor 2; beta shee 1e-08
2zaj_A49 Membrane-associated guanylate kinase, WW and PDZ d 2e-08
2law_A38 Yorkie homolog; YAP, SMAD1, CDK, signal transducti 3e-08
3rgc_A252 Possible periplasmic protein; ppiase, chaperone; 2 6e-08
3l4h_A109 E3 ubiquitin-protein ligase HECW1; E3 ligase, WW d 6e-08
2ysd_A57 Membrane-associated guanylate kinase, WW and PDZ d 6e-08
2kpz_A49 E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV 8e-08
1wr7_A41 NEDD4-2; all-beta, ligase; NMR {Mus musculus} Leng 1e-07
2dwv_A49 Salvador homolog 1 protein; WW domain, dimer, stru 1e-07
2ez5_W46 Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW doma 2e-07
2jmf_A53 E3 ubiquitin-protein ligase suppressor of deltex; 2e-07
1i5h_W50 Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, 2e-07
1tk7_A88 CG4244-PB; WW domain, notch, signaling protein; NM 4e-07
1tk7_A88 CG4244-PB; WW domain, notch, signaling protein; NM 1e-05
2l4j_A46 YES-associated protein 2 (YAP2); WW domain, medaka 4e-07
1e0m_A37 Wwprototype; SH3 prototype, protein design, de nov 5e-07
2kxq_A90 E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG 5e-07
2kxq_A90 E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG 1e-06
2yse_A60 Membrane-associated guanylate kinase, WW and PDZ d 7e-07
2ysf_A40 E3 ubiquitin-protein ligase itchy homolog; AIP4, N 2e-06
2ysg_A40 Syntaxin-binding protein 4; synip, STXBP4, WW doma 2e-06
1o6w_A75 PRP40, PRE-mRNA processing protein PRP40; WW domai 1e-05
1o6w_A75 PRP40, PRE-mRNA processing protein PRP40; WW domai 3e-04
2l5f_A92 PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA 2e-05
1wmv_A54 WWOX, WW domain containing oxidoreductase; all-bet 3e-05
2e45_A55 Fe65 protein, amyloid beta A4 precursor protein-bi 4e-05
2ysc_A39 Amyloid beta A4 precursor protein-binding family B 8e-05
2jxw_A75 WW domain-binding protein 4; WW domain containing 3e-04
2jx8_A52 Hpcif1, phosphorylated CTD-interacting factor 1; p 5e-04
>3tc5_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; PIN1 mutant (R14A), oncogenic transformation, small molecule cycle, rotamase, phosphoprotein; HET: 3T5 P6G; 1.40A {Homo sapiens} PDB: 2itk_A* 2q5a_A* 2xp3_A* 2xp4_A* 2xp5_A* 2xp7_A* 2xp8_A* 2xp9_A* 2xpa_A* 2xpb_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 3ntp_A* 3odk_A* 3oob_A* 2zr6_A* 1f8a_B* ... Length = 166 Back     alignment and structure
 Score =  218 bits (556), Expect = 3e-74
 Identities = 98/162 (60%), Positives = 119/162 (73%), Gaps = 6/162 (3%)

Query: 1   MGDEE-LPAGWEKRMSRSSGHHYYLNIYTKESQWDRPTKPA-----EASGGPEQVQCSHL 54
           M DEE LP GWEK MSRSSG  YY N  T  SQW+RP+  +        G P +V+CSHL
Sbjct: 4   MADEEKLPPGWEKAMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL 63

Query: 55  LVKHKESRKPYSWRDDNITRSKEEAIELVKSYREQINTGKASFGELASKFSDCSSAKRSG 114
           LVKH +SR+P SWR + ITR+KEEA+EL+  Y ++I +G+  F  LAS+FSDCSSAK  G
Sbjct: 64  LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG 123

Query: 115 DLGPFGRGTMQKPFEDAAFSLKVGEMSEPVLTESGVHIILRT 156
           DLG F RG MQKPFEDA+F+L+ GEMS PV T+SG+HIILRT
Sbjct: 124 DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRT 165
>1yw5_A Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} Length = 177 Back     alignment and structure
>3i6c_A Peptidyl-prolyl CIS-trans isomerase NIMA- interacting 1; SBDD, small molecule, ppiase, cell cycle, nucleus, phosphoprotein, rotamase; HET: GIA; 1.30A {Homo sapiens} PDB: 3ik8_A 3ikd_A* 3ikg_A* 3jyj_A* 3kac_A* 1nmw_A Length = 123 Back     alignment and structure
>1j6y_A Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN1, phosphorylation; NMR {Arabidopsis thaliana} SCOP: d.26.1.1 Length = 139 Back     alignment and structure
>2jzv_A Foldase protein PRSA; ppiase, parvulin, proline isomerase, lipoprotein, membrane, palmitate, rotamase; NMR {Staphylococcus aureus} Length = 111 Back     alignment and structure
>2rqs_A Parvulin-like peptidyl-prolyl isomerase; CIS/trans isomerisation, cenarcheaum symbiosum, low temperat NIMA-kinase, PIN1, cell cycle; NMR {Cenarchaeum symbiosum} Length = 97 Back     alignment and structure
>4g2p_A Chaperone SURA; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, pcsep; 1.82A {Salmonella enterica subsp} Length = 110 Back     alignment and structure
>1jns_A Peptidyl-prolyl CIS-trans isomerase C; alpha-beta sandwich, CIS peptide bond; NMR {Escherichia coli} SCOP: d.26.1.1 PDB: 1jnt_A Length = 92 Back     alignment and structure
>3gpk_A PPIC-type peptidyl-prolyl CIS-trans isomerase; rotamase,ppiase domain, 11189O3,PSI2., structural genomics; 1.55A {Novosphingobium aromaticivorans} Length = 112 Back     alignment and structure
>1zk6_A Foldase protein PRSA; alpha/beta structure, isomerase; NMR {Bacillus subtilis} Length = 93 Back     alignment and structure
>2pv1_A Chaperone SURA; surviVal protein A, peptidyl-prolyl CIS-trans isomerase domain, peptide, complex; 1.30A {Escherichia coli} SCOP: d.26.1.1 PDB: 2pv2_A Length = 103 Back     alignment and structure
>2kgj_A Peptidyl-prolyl CIS-trans isomerase D; prolyl isomerase, parvulin, cell inner membrane, cell membrane, membrane, rotamase, stress response; NMR {Escherichia coli} Length = 102 Back     alignment and structure
>3ui4_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; peptidyl-prolyl-isomerase; 0.80A {Homo sapiens} PDB: 3ui5_A 1fjd_A 1eq3_A Length = 101 Back     alignment and structure
>3rfw_A Cell-binding factor 2; SURA-like, chaperone; 2.20A {Campylobacter jejuni} Length = 252 Back     alignment and structure
>3nrk_A LIC12922; NC domain, parvulin domain, SURA homology, probable chaperon unknown function; 3.10A {Leptospira interrogans serovar copenhaorganism_taxid} Length = 325 Back     alignment and structure
>1m5y_A SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} SCOP: a.223.1.2 d.26.1.1 d.26.1.1 PDB: 2pv3_A Length = 408 Back     alignment and structure
>1m5y_A SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} SCOP: a.223.1.2 d.26.1.1 d.26.1.1 PDB: 2pv3_A Length = 408 Back     alignment and structure
>2jv4_A Peptidyl-prolyl CIS/trans isomerase; ppiase domain, WW domain group IV, rotamase; NMR {Emericella nidulans} Length = 54 Back     alignment and structure
>2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} Length = 36 Back     alignment and structure
>2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 Back     alignment and structure
>2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1 Length = 49 Back     alignment and structure
>1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A* Length = 36 Back     alignment and structure
>2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens} Length = 39 Back     alignment and structure
>1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A* Length = 46 Back     alignment and structure
>1ymz_A CC45; artificial protein, computational design, unknown function; NMR {Synthetic} SCOP: k.22.1.1 Length = 43 Back     alignment and structure
>2djy_A SMAD ubiquitination regulatory factor 2; beta sheet, polyproline type II helix, PPII, ligase/signaling protein complex; NMR {Homo sapiens} PDB: 2lb1_A Length = 42 Back     alignment and structure
>2zaj_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; BAI1-associated protein 1 (BAP-1); NMR {Homo sapiens} Length = 49 Back     alignment and structure
>2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens} Length = 38 Back     alignment and structure
>3rgc_A Possible periplasmic protein; ppiase, chaperone; 2.30A {Campylobacter jejuni} Length = 252 Back     alignment and structure
>3l4h_A E3 ubiquitin-protein ligase HECW1; E3 ligase, WW domain, UBL-conjugation pathway, structural GE structural genomics consortium, SGC, coiled coil; HET: MSE; 1.80A {Homo sapiens} Length = 109 Back     alignment and structure
>2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 57 Back     alignment and structure
>2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A* Length = 49 Back     alignment and structure
>1wr7_A NEDD4-2; all-beta, ligase; NMR {Mus musculus} Length = 41 Back     alignment and structure
>2dwv_A Salvador homolog 1 protein; WW domain, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 49 Back     alignment and structure
>2ez5_W Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW domain, PY motif, binding affinity, signalling protein,ligase; NMR {Drosophila melanogaster} Length = 46 Back     alignment and structure
>2jmf_A E3 ubiquitin-protein ligase suppressor of deltex; WW domain, solution, complex, ligase/signaling protein complex; NMR {Drosophila melanogaster} SCOP: b.72.1.1 PDB: 2op7_A Length = 53 Back     alignment and structure
>1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A* Length = 50 Back     alignment and structure
>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Length = 88 Back     alignment and structure
>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Length = 88 Back     alignment and structure
>2l4j_A YES-associated protein 2 (YAP2); WW domain, medaka, transcription; NMR {Oryzias latipes} Length = 46 Back     alignment and structure
>1e0m_A Wwprototype; SH3 prototype, protein design, de novo protein; NMR {} SCOP: k.22.1.1 Length = 37 Back     alignment and structure
>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Length = 90 Back     alignment and structure
>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Length = 90 Back     alignment and structure
>2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 60 Back     alignment and structure
>2ysf_A E3 ubiquitin-protein ligase itchy homolog; AIP4, NAPP1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 Back     alignment and structure
>2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 Back     alignment and structure
>1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 Length = 75 Back     alignment and structure
>1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 Length = 75 Back     alignment and structure
>2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1wmv_A WWOX, WW domain containing oxidoreductase; all-beta, apoptosis; NMR {Homo sapiens} Length = 54 Back     alignment and structure
>2e45_A Fe65 protein, amyloid beta A4 precursor protein-binding family B member 1; triple-stranded beta-sheet; NMR {Homo sapiens} SCOP: b.72.1.1 Length = 55 Back     alignment and structure
>2ysc_A Amyloid beta A4 precursor protein-binding family B member 3; Fe65-like protein 2, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 Length = 39 Back     alignment and structure
>2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2jx8_A Hpcif1, phosphorylated CTD-interacting factor 1; protein fragment, WW domain, triple-standed beta-sheet, alpha-helix, nucleus, phosphorylation; NMR {Homo sapiens} Length = 52 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
3tc5_A166 Peptidyl-prolyl CIS-trans isomerase NIMA-interact; 100.0
1yw5_A177 Peptidyl prolyl CIS/trans isomerase; WW-domain, pp 100.0
3i6c_A123 Peptidyl-prolyl CIS-trans isomerase NIMA- interact 100.0
2lj4_A115 Peptidyl-prolyl CIS-trans isomerase/rotamase, PUT; 100.0
4g2p_A110 Chaperone SURA; structural genomics, PSI-biology, 99.97
3gpk_A112 PPIC-type peptidyl-prolyl CIS-trans isomerase; rot 99.97
2pv1_A103 Chaperone SURA; surviVal protein A, peptidyl-proly 99.97
2jzv_A111 Foldase protein PRSA; ppiase, parvulin, proline is 99.97
1j6y_A139 Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN 99.96
1jns_A92 Peptidyl-prolyl CIS-trans isomerase C; alpha-beta 99.96
2rqs_A97 Parvulin-like peptidyl-prolyl isomerase; CIS/trans 99.96
1zk6_A93 Foldase protein PRSA; alpha/beta structure, isomer 99.96
3ui4_A101 Peptidyl-prolyl CIS-trans isomerase NIMA-interact; 99.95
2kgj_A102 Peptidyl-prolyl CIS-trans isomerase D; prolyl isom 99.94
3nrk_A325 LIC12922; NC domain, parvulin domain, SURA homolog 99.88
3rfw_A252 Cell-binding factor 2; SURA-like, chaperone; 2.20A 99.87
1m5y_A 408 SurviVal protein, surviVal protein SURA; surviVal 99.87
1m5y_A408 SurviVal protein, surviVal protein SURA; surviVal 99.84
3rgc_A252 Possible periplasmic protein; ppiase, chaperone; 2 99.59
2jv4_A54 Peptidyl-prolyl CIS/trans isomerase; ppiase domain 98.84
2dmv_A43 Itchy homolog E3 ubiquitin protein ligase; WW doma 98.64
2ysf_A40 E3 ubiquitin-protein ligase itchy homolog; AIP4, N 98.6
1wr4_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 98.57
2zaj_A49 Membrane-associated guanylate kinase, WW and PDZ d 98.56
2ez5_W46 Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW doma 98.54
2ysg_A40 Syntaxin-binding protein 4; synip, STXBP4, WW doma 98.53
2djy_A42 SMAD ubiquitination regulatory factor 2; beta shee 98.53
1wr3_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 98.51
2ysb_A49 Salvador homolog 1 protein; WW domain, structural 98.49
2dwv_A49 Salvador homolog 1 protein; WW domain, dimer, stru 98.47
2law_A38 Yorkie homolog; YAP, SMAD1, CDK, signal transducti 98.47
1wr7_A41 NEDD4-2; all-beta, ligase; NMR {Mus musculus} 98.46
2ysc_A39 Amyloid beta A4 precursor protein-binding family B 98.42
2yse_A60 Membrane-associated guanylate kinase, WW and PDZ d 98.41
2kyk_A39 E3 ubiquitin-protein ligase itchy homolog; LMP2A, 98.38
2ysh_A40 GAS-7, growth-arrest-specific protein 7; WW domain 98.38
1i5h_W50 Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, 98.37
2l4j_A46 YES-associated protein 2 (YAP2); WW domain, medaka 98.36
2kpz_A49 E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV 98.36
2jmf_A53 E3 ubiquitin-protein ligase suppressor of deltex; 98.34
2ho2_A38 Fe65 protein, amyloid beta A4 protein-binding fami 98.34
1wmv_A54 WWOX, WW domain containing oxidoreductase; all-bet 98.31
2ysd_A57 Membrane-associated guanylate kinase, WW and PDZ d 98.27
1e0m_A37 Wwprototype; SH3 prototype, protein design, de nov 98.25
2jx8_A52 Hpcif1, phosphorylated CTD-interacting factor 1; p 98.17
1ymz_A43 CC45; artificial protein, computational design, un 98.13
1jmq_A46 YAP65, 65 kDa YES-associated protein; polyproline 98.12
2e45_A55 Fe65 protein, amyloid beta A4 precursor protein-bi 98.01
3l4h_A109 E3 ubiquitin-protein ligase HECW1; E3 ligase, WW d 97.92
2kxq_A90 E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG 97.81
1tk7_A88 CG4244-PB; WW domain, notch, signaling protein; NM 97.74
2kxq_A90 E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG 97.62
1tk7_A88 CG4244-PB; WW domain, notch, signaling protein; NM 97.44
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 97.31
3olm_A 429 E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {S 97.26
2ysi_A40 Transcription elongation regulator 1; Ca150, FBP28 97.22
1e0n_A27 Hypothetical protein; YJQ8WW domain, WW domain, sa 97.06
1ywi_A41 Formin-binding protein 3; WW domain, class II, pro 97.04
2l5f_A92 PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA 96.84
1o6w_A75 PRP40, PRE-mRNA processing protein PRP40; WW domai 96.63
1e0l_A37 Formin binding protein; SH3 domain, WW domain, FBP 96.26
2jxw_A75 WW domain-binding protein 4; WW domain containing 95.37
2l5f_A92 PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA 95.2
1o6w_A75 PRP40, PRE-mRNA processing protein PRP40; WW domai 94.79
2jxw_A75 WW domain-binding protein 4; WW domain containing 93.08
2dk1_A50 WW domain-binding protein 4; WBP-4, formin- bindin 92.65
2dk7_A73 Transcription elongation regulator 1; structural g 84.39
>3tc5_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; PIN1 mutant (R14A), oncogenic transformation, small molecule cycle, rotamase, phosphoprotein; HET: 3T5 P6G; 1.40A {Homo sapiens} PDB: 2itk_A* 2q5a_A* 2xp3_A* 2xp4_A* 2xp5_A* 2xp7_A* 2xp8_A* 2xp9_A* 2xpa_A* 2xpb_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 3ntp_A* 3odk_A* 3oob_A* 2zr6_A* 1f8a_B* ... Back     alignment and structure
Probab=100.00  E-value=9.6e-45  Score=265.68  Aligned_cols=157  Identities=62%  Similarity=1.086  Sum_probs=136.0

Q ss_pred             CCC-CCCCcchhhhcccCCCceeeEeeecccccccCCCCCCC-----CCCCCCcEEEEEEEeeccCCCCCCCCCccchhh
Q psy2677           1 MGD-EELPAGWEKRMSRSSGHHYYLNIYTKESQWDRPTKPAE-----ASGGPEQVQCSHLLVKHKESRKPYSWRDDNITR   74 (157)
Q Consensus         1 ~~~-~~~p~~w~~~~~~~~~~~y~~n~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~Ili~~~~~~~~~~~~~~~~~~   74 (157)
                      |+| ++||+||+.+.+.+.++.||+|+.|+.++|+.|..++.     ....+++|+++||||+..+.+.|.+++.+++.+
T Consensus         4 m~~~~~LP~gWe~~~~~~~g~~yy~n~~t~~t~We~P~~~~~~~~~~~~~~~~~v~~~HILi~~~~~~~p~~~~~~~~~~   83 (166)
T 3tc5_A            4 MADEEKLPPGWEKAMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITR   83 (166)
T ss_dssp             ------CCTTEEEEECTTTCCEEEEETTTCCEESSCC-------------CCSCEEEEEEEECCTTSSSCCBTTBSSCCC
T ss_pred             CCCCCCCCCCceEEEcCCCCCEEEEECCCCCEEecCCCCCcccccccccccccceeEeeeEEecccccCccccchhhhhh
Confidence            677 67999999999988999999999999999999987654     256789999999999988877777777777778


Q ss_pred             hHHHHHHHHHHHHHHHhcChhhHHHHHHhhCCCchhhcCCCcccccCCCCcHHHHHHHhcCCCCCccccEEeCCeEEEEE
Q psy2677          75 SKEEAIELVKSYREQINTGKASFGELASKFSDCSSAKRSGDLGPFGRGTMQKPFEDAAFSLKVGEMSEPVLTESGVHIIL  154 (157)
Q Consensus        75 ~~~~A~~~~~~i~~~l~~g~~~F~~lA~~yS~~~~~~~gG~lg~~~~~~l~~~~~~av~~l~~Geis~pi~t~~G~hIi~  154 (157)
                      ++++|++++++|+++|++|+.+|++||++||+++++.+||||||+..++|+++|++++|+|++|+||+||+|++|||||+
T Consensus        84 ~~~~A~~~~~~i~~~l~~g~~~F~~lA~~~Sd~~sa~~GGdLG~~~~~~l~~~f~~a~f~l~~GeiS~pv~t~~G~hIi~  163 (166)
T 3tc5_A           84 TKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIIL  163 (166)
T ss_dssp             CHHHHHHHHHHHHHHHHHTSSCHHHHHHHHCSSGGGGGTTEEEEECTTSSCHHHHHHHHHSCTTCBCCCEEETTEEEEEE
T ss_pred             HHHHHHHHHHHHHHHHHcCccCHHHHHHHhCcccHHhcCCccceecccccCHHHHHHHHhCCCCCCcccEEECCEEEEEE
Confidence            89999999999999999985699999999999999999999999999999999999999999999999999999999999


Q ss_pred             EeC
Q psy2677         155 RTA  157 (157)
Q Consensus       155 v~~  157 (157)
                      |++
T Consensus       164 v~e  166 (166)
T 3tc5_A          164 RTE  166 (166)
T ss_dssp             ECC
T ss_pred             EeC
Confidence            975
>1yw5_A Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} Back     alignment and structure
>3i6c_A Peptidyl-prolyl CIS-trans isomerase NIMA- interacting 1; SBDD, small molecule, ppiase, cell cycle, nucleus, phosphoprotein, rotamase; HET: GIA; 1.30A {Homo sapiens} PDB: 3ik8_A 3ikd_A* 3ikg_A* 3jyj_A* 3kac_A* 1nmw_A Back     alignment and structure
>2lj4_A Peptidyl-prolyl CIS-trans isomerase/rotamase, PUT; tbpin1; NMR {Trypanosoma brucei} Back     alignment and structure
>4g2p_A Chaperone SURA; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, pcsep; 1.82A {Salmonella enterica subsp} Back     alignment and structure
>3gpk_A PPIC-type peptidyl-prolyl CIS-trans isomerase; rotamase,ppiase domain, 11189O3,PSI2., structural genomics; 1.55A {Novosphingobium aromaticivorans} Back     alignment and structure
>2pv1_A Chaperone SURA; surviVal protein A, peptidyl-prolyl CIS-trans isomerase domain, peptide, complex; 1.30A {Escherichia coli} SCOP: d.26.1.1 PDB: 2pv2_A Back     alignment and structure
>2jzv_A Foldase protein PRSA; ppiase, parvulin, proline isomerase, lipoprotein, membrane, palmitate, rotamase; NMR {Staphylococcus aureus} Back     alignment and structure
>1j6y_A Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN1, phosphorylation; NMR {Arabidopsis thaliana} SCOP: d.26.1.1 Back     alignment and structure
>1jns_A Peptidyl-prolyl CIS-trans isomerase C; alpha-beta sandwich, CIS peptide bond; NMR {Escherichia coli} SCOP: d.26.1.1 PDB: 1jnt_A Back     alignment and structure
>2rqs_A Parvulin-like peptidyl-prolyl isomerase; CIS/trans isomerisation, cenarcheaum symbiosum, low temperat NIMA-kinase, PIN1, cell cycle; NMR {Cenarchaeum symbiosum} Back     alignment and structure
>1zk6_A Foldase protein PRSA; alpha/beta structure, isomerase; NMR {Bacillus subtilis} Back     alignment and structure
>3ui4_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; peptidyl-prolyl-isomerase; 0.80A {Homo sapiens} SCOP: d.26.1.1 PDB: 3ui5_A 3ui6_A 1fjd_A 1eq3_A Back     alignment and structure
>2kgj_A Peptidyl-prolyl CIS-trans isomerase D; prolyl isomerase, parvulin, cell inner membrane, cell membrane, membrane, rotamase, stress response; NMR {Escherichia coli} Back     alignment and structure
>3nrk_A LIC12922; NC domain, parvulin domain, SURA homology, probable chaperon unknown function; 3.10A {Leptospira interrogans serovar copenhaorganism_taxid} Back     alignment and structure
>3rfw_A Cell-binding factor 2; SURA-like, chaperone; 2.20A {Campylobacter jejuni} Back     alignment and structure
>1m5y_A SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} SCOP: a.223.1.2 d.26.1.1 d.26.1.1 PDB: 2pv3_A Back     alignment and structure
>1m5y_A SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} SCOP: a.223.1.2 d.26.1.1 d.26.1.1 PDB: 2pv3_A Back     alignment and structure
>3rgc_A Possible periplasmic protein; ppiase, chaperone; 2.30A {Campylobacter jejuni} Back     alignment and structure
>2jv4_A Peptidyl-prolyl CIS/trans isomerase; ppiase domain, WW domain group IV, rotamase; NMR {Emericella nidulans} Back     alignment and structure
>2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysf_A E3 ubiquitin-protein ligase itchy homolog; AIP4, NAPP1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A* Back     alignment and structure
>2zaj_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; BAI1-associated protein 1 (BAP-1); NMR {Homo sapiens} Back     alignment and structure
>2ez5_W Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW domain, PY motif, binding affinity, signalling protein,ligase; NMR {Drosophila melanogaster} Back     alignment and structure
>2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2djy_A SMAD ubiquitination regulatory factor 2; beta sheet, polyproline type II helix, PPII, ligase/signaling protein complex; NMR {Homo sapiens} PDB: 2lb1_A Back     alignment and structure
>1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} Back     alignment and structure
>2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1 Back     alignment and structure
>2dwv_A Salvador homolog 1 protein; WW domain, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens} Back     alignment and structure
>1wr7_A NEDD4-2; all-beta, ligase; NMR {Mus musculus} Back     alignment and structure
>2ysc_A Amyloid beta A4 precursor protein-binding family B member 3; Fe65-like protein 2, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens} Back     alignment and structure
>2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A* Back     alignment and structure
>2l4j_A YES-associated protein 2 (YAP2); WW domain, medaka, transcription; NMR {Oryzias latipes} Back     alignment and structure
>2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A* Back     alignment and structure
>2jmf_A E3 ubiquitin-protein ligase suppressor of deltex; WW domain, solution, complex, ligase/signaling protein complex; NMR {Drosophila melanogaster} SCOP: b.72.1.1 PDB: 2op7_A Back     alignment and structure
>2ho2_A Fe65 protein, amyloid beta A4 protein-binding family B member 1; WW domain, beta sheet, Fe65, protein binding; 1.33A {Homo sapiens} SCOP: b.72.1.1 PDB: 2idh_A* 2oei_A Back     alignment and structure
>1wmv_A WWOX, WW domain containing oxidoreductase; all-beta, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>1e0m_A Wwprototype; SH3 prototype, protein design, de novo protein; NMR {} SCOP: k.22.1.1 Back     alignment and structure
>2jx8_A Hpcif1, phosphorylated CTD-interacting factor 1; protein fragment, WW domain, triple-standed beta-sheet, alpha-helix, nucleus, phosphorylation; NMR {Homo sapiens} Back     alignment and structure
>1ymz_A CC45; artificial protein, computational design, unknown function; NMR {Synthetic} SCOP: k.22.1.1 Back     alignment and structure
>1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A* Back     alignment and structure
>2e45_A Fe65 protein, amyloid beta A4 precursor protein-binding family B member 1; triple-stranded beta-sheet; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>3l4h_A E3 ubiquitin-protein ligase HECW1; E3 ligase, WW domain, UBL-conjugation pathway, structural GE structural genomics consortium, SGC, coiled coil; HET: MSE; 1.80A {Homo sapiens} Back     alignment and structure
>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Back     alignment and structure
>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Back     alignment and structure
>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Back     alignment and structure
>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>3olm_A E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2ysi_A Transcription elongation regulator 1; Ca150, FBP28, WW domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.22.1.1 Back     alignment and structure
>1e0n_A Hypothetical protein; YJQ8WW domain, WW domain, saccharomyces cerevisae, YJQ8 protein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 Back     alignment and structure
>1ywi_A Formin-binding protein 3; WW domain, class II, proline-rich peptides, protein-protein interactions, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1ywj_A 1zr7_A 2dyf_A Back     alignment and structure
>2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 Back     alignment and structure
>1e0l_A Formin binding protein; SH3 domain, WW domain, FBP28, signal transduction; NMR {Mus musculus} SCOP: b.72.1.1 PDB: 2jup_W 2rly_W 2rm0_W 2nnt_A Back     alignment and structure
>2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 Back     alignment and structure
>2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dk1_A WW domain-binding protein 4; WBP-4, formin- binding protein 21, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>2dk7_A Transcription elongation regulator 1; structural genomics, WW domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 157
d1pina2119 d.26.1.1 (A:45-163) Mitotic rotamase PIN1, domain 2e-35
d1j6ya_120 d.26.1.1 (A:) Mitotic rotamase PIN1, domain 2 {Tha 6e-34
d1m5ya3108 d.26.1.1 (A:279-386) Porin chaperone SurA, PPIase 7e-18
d1jnsa_92 d.26.1.1 (A:) Parvulin 10 (rotamase C) {Escherichi 5e-16
d2pv2a1103 d.26.1.1 (A:172-274) Porin chaperone SurA, PPIase 1e-13
d1eq3a_96 d.26.1.1 (A:) Parvulin {Human (Homo sapiens), hpar 2e-13
d1pina134 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Ho 7e-13
d1jmqa_46 b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens 2e-09
d1i5hw_50 b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain 4e-09
d1tk7a145 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) 4e-08
d2jmfa133 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII 6e-08
d2rm0w137 b.72.1.1 (W:1-37) Formin binding protein FBP28 dom 2e-05
d1o6wa246 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's 1e-04
d1o6wa129 b.72.1.1 (A:1-29) Splicing factor prp40 {Baker's y 0.002
d2dk1a138 b.72.1.1 (A:7-44) WW domain-binding protein 4, WBP 0.002
d1ywia128 b.72.1.1 (A:15-42) Huntingtin-interacting protein 0.002
>d1pina2 d.26.1.1 (A:45-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: Mitotic rotamase PIN1, domain 2
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  117 bits (294), Expect = 2e-35
 Identities = 73/117 (62%), Positives = 91/117 (77%)

Query: 40  AEASGGPEQVQCSHLLVKHKESRKPYSWRDDNITRSKEEAIELVKSYREQINTGKASFGE 99
               G P +V+CSHLLVKH +SR+P SWR + ITR+KEEA+EL+  Y ++I +G+  F  
Sbjct: 2   KNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFES 61

Query: 100 LASKFSDCSSAKRSGDLGPFGRGTMQKPFEDAAFSLKVGEMSEPVLTESGVHIILRT 156
           LAS+FSDCSSAK  GDLG F RG MQKPFEDA+F+L+ GEMS PV T+SG+HIILRT
Sbjct: 62  LASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRT 118
>d1j6ya_ d.26.1.1 (A:) Mitotic rotamase PIN1, domain 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 120 Back     information, alignment and structure
>d1m5ya3 d.26.1.1 (A:279-386) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]} Length = 108 Back     information, alignment and structure
>d1jnsa_ d.26.1.1 (A:) Parvulin 10 (rotamase C) {Escherichia coli [TaxId: 562]} Length = 92 Back     information, alignment and structure
>d2pv2a1 d.26.1.1 (A:172-274) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]} Length = 103 Back     information, alignment and structure
>d1eq3a_ d.26.1.1 (A:) Parvulin {Human (Homo sapiens), hpar14 [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} Length = 34 Back     information, alignment and structure
>d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]} Length = 46 Back     information, alignment and structure
>d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 50 Back     information, alignment and structure
>d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 45 Back     information, alignment and structure
>d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 33 Back     information, alignment and structure
>d2rm0w1 b.72.1.1 (W:1-37) Formin binding protein FBP28 domain {Domestic mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1o6wa2 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 46 Back     information, alignment and structure
>d1o6wa1 b.72.1.1 (A:1-29) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 29 Back     information, alignment and structure
>d2dk1a1 b.72.1.1 (A:7-44) WW domain-binding protein 4, WBP4 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1ywia1 b.72.1.1 (A:15-42) Huntingtin-interacting protein HYPA/FBP11 {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
d1pina2119 Mitotic rotamase PIN1, domain 2 {Human (Homo sapie 100.0
d1j6ya_120 Mitotic rotamase PIN1, domain 2 {Thale cress (Arab 99.97
d1m5ya3108 Porin chaperone SurA, PPIase domains {Escherichia 99.96
d2pv2a1103 Porin chaperone SurA, PPIase domains {Escherichia 99.96
d1jnsa_92 Parvulin 10 (rotamase C) {Escherichia coli [TaxId: 99.96
d1eq3a_96 Parvulin {Human (Homo sapiens), hpar14 [TaxId: 960 99.95
d2jmfa133 Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Dr 98.75
d1jmqa_46 Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606 98.69
d1pina134 Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId 98.57
d1i5hw_50 Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus n 98.52
d1tk7a145 Suppressor of deltex (Cg4244-pb) {Fruit fly (Droso 98.5
d2rm0w137 Formin binding protein FBP28 domain {Domestic mous 96.82
d2ho2a133 Amyloid beta A4 precursor protein-binding family B 96.5
d1o6wa129 Splicing factor prp40 {Baker's yeast (Saccharomyce 96.03
d1ywia128 Huntingtin-interacting protein HYPA/FBP11 {Human ( 95.97
d1o6wa246 Splicing factor prp40 {Baker's yeast (Saccharomyce 95.68
d2dk1a138 WW domain-binding protein 4, WBP4 {Human (Homo sap 94.58
d1eg3a338 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 87.02
>d1pina2 d.26.1.1 (A:45-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: Mitotic rotamase PIN1, domain 2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=3.6e-34  Score=197.50  Aligned_cols=115  Identities=63%  Similarity=1.103  Sum_probs=106.3

Q ss_pred             CCCCCcEEEEEEEeeccCCCCCCCCCccchhhhHHHHHHHHHHHHHHHhcChhhHHHHHHhhCCCchhhcCCCcccccCC
Q psy2677          43 SGGPEQVQCSHLLVKHKESRKPYSWRDDNITRSKEEAIELVKSYREQINTGKASFGELASKFSDCSSAKRSGDLGPFGRG  122 (157)
Q Consensus        43 ~~~~~~~~~~~Ili~~~~~~~~~~~~~~~~~~~~~~A~~~~~~i~~~l~~g~~~F~~lA~~yS~~~~~~~gG~lg~~~~~  122 (157)
                      ...|++|+++||||+.+....+.++....+.+++++|++.+++|+++|++|..+|++||++||+++++.+||+|||+..+
T Consensus         5 ~~~p~~vr~~HILi~~~~~~~~~~~~~~~i~~~k~ea~~~~~~i~~~i~~g~~~F~~lA~~~Sd~~s~~~gG~lg~~~~~   84 (119)
T d1pina2           5 QGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRG   84 (119)
T ss_dssp             CCCCSCEEEEEEEECCTTSSSCCBTTBSSCCCCHHHHHHHHHHHHHHHHHTSSCHHHHHHHHCSSGGGGGTTEEEEECTT
T ss_pred             CCCCcEEEEEEEEEecCCCcCchhhhhhhhhhhHHHHHHHHHHHHHHHHcChhhHHHHHHHcCCCccccccccccccccc
Confidence            45789999999999998887777776666777889999999999999998867999999999999999999999999999


Q ss_pred             CCcHHHHHHHhcCCCCCccccEEeCCeEEEEEEeC
Q psy2677         123 TMQKPFEDAAFSLKVGEMSEPVLTESGVHIILRTA  157 (157)
Q Consensus       123 ~l~~~~~~av~~l~~Geis~pi~t~~G~hIi~v~~  157 (157)
                      .|+++|++++++|++|+||+||+|++|||||+|++
T Consensus        85 ~l~~~f~~~~~~l~~GeiS~pi~t~~G~HIikv~d  119 (119)
T d1pina2          85 QMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE  119 (119)
T ss_dssp             SSCHHHHHHHHHCCTTCBCCCEECSSCEEEEEECC
T ss_pred             hHHHHHHHHHhcCCCCCcCCcEEeCCcEEEEEEeC
Confidence            99999999999999999999999999999999975
>d1j6ya_ d.26.1.1 (A:) Mitotic rotamase PIN1, domain 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1m5ya3 d.26.1.1 (A:279-386) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv2a1 d.26.1.1 (A:172-274) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnsa_ d.26.1.1 (A:) Parvulin 10 (rotamase C) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eq3a_ d.26.1.1 (A:) Parvulin {Human (Homo sapiens), hpar14 [TaxId: 9606]} Back     information, alignment and structure
>d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2rm0w1 b.72.1.1 (W:1-37) Formin binding protein FBP28 domain {Domestic mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ho2a1 b.72.1.1 (A:253-285) Amyloid beta A4 precursor protein-binding family B member 1, APBB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6wa1 b.72.1.1 (A:1-29) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ywia1 b.72.1.1 (A:15-42) Huntingtin-interacting protein HYPA/FBP11 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6wa2 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dk1a1 b.72.1.1 (A:7-44) WW domain-binding protein 4, WBP4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eg3a3 b.72.1.1 (A:47-84) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure