Psyllid ID: psy2764

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------42
MWGEVLPHSLGRVLRGQNSGSNRREVDIPILKISNTLPKHVTQTEWAEMLDVSKPVLDFDAKVPIMAHTWPFELDVFQKQAIIKLEEHNHVFVTAHTSAGKTVIAEYAIALSQNHKTRTIYTSPIKALSNQKYRDFRETFQDVGLVTGDFQINTTASCLVMTTEILRSMLYRGSDVLRDLEYVIFDEVHYINDSERGHVWEEVLILLPKEVCIVMLSATVPNTLEFADWVGNTKKTKVYVVSTLKRPVPLKHFLYVGPVLEKNQLFLIREAEGEFLTRGYLAAKEVKCRKQLEKGGSGGGKLNGPFTRGAEKNLFISFLNYLRKSQNLPVVLFTLSRKRCDQNAANLLSMDFSTATEKSKIHRFFQDSIRNLQNEDDRALPQVKRLEQLLKNGIGVHHSGILPILKEIVEMLFQKGLVK
cccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccHHcccccccccccHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHccccEEEccccHHHHcccHHHHHHHccccccccccccccccccEEEccHHHHHHHHHccccccccccEEEEEcEEEccccccccEEEEEEEEcccccEEEEEccccccHHHHHHHHHHcccccEEEEEccccccccEEEEEEcccccccHHHHHHccccccccccHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccc
cccccccccccHHHHcccccccHHcccccccccccccccccccEEEcccccccccccccccccccccccccccccHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHcccEEEEEcHHHHHHHHHHHHHHHHHccccEEcccEEEcccccEEEHHHHHHHHHHHccHHHHHHHHEEEEHHEEEEcccccccEEEEEEEEccccEEEEEEEcccccHHHHHHHHHHHccccEEEEEEcccccccEEEEEcccccccccEEEEEEccccccHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHcccccEEEEEEcHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccHHHcccHHHHHHHHHHHccccEccccHHHHHHHHHHHHHHccccc
mwgevlphslgrvlrgqnsgsnrrevdipilkisntlpkhvtQTEWAEmldvskpvldfdakvpimahtwpFELDVFQKQAIIKLEEHNHVFVTAHTSAGKTVIAEYAIALSqnhktrtiytspikalsnqkyRDFRETFQdvglvtgdfqiNTTASCLVMTTEILRSMLYRgsdvlrdlEYVIFDEVhyindserghVWEEVLILLPKEVCIVMLSatvpntleFADWVGNTKKTKVYVVSTlkrpvplkhflyvgpvlekNQLFLIREAEGEFLTRGYLAAKEVKCRKqlekggsgggklngpftrgaEKNLFISFLNYLRKSQNLPVVLFTLSRKRCDQNAANLLSMDFSTATEKSKIHRFFQDSIRNLqneddralPQVKRLEQLLKNgigvhhsgiLPILKEIVEMLFQKGLVK
mwgevlphslgrvlrgqnsgsnrrevdipilkisntlpkhvTQTEWAEMLDVSKPVLDFDAKVPIMAHTWPFELDVFQKQAIIKLEEHNHVFVTAHTSAGKTVIAEYAIALsqnhktrtiytspikalsnqkyRDFRETFQDVGLVTGDFQINTTASCLVMTTEILRSMLYRGSDVLRDLEYVIFDEVHYINDSERGHVWEEVLILLPKEVCIVMLSATVPNTlefadwvgntkkTKVYVVSTLKRPVPLKHFLYVGPVLEKNQLFLIREAEGEFLTRGYLAAKEVKCRkqlekggsgggklngpftRGAEKNLFISFLNYLRKSQNLPVVLFTLSRKRCDQNAANLLSMDFSTATEKSKIHRFFQDSIRNLQNEDDRALPQVKRLEQLLKNGIGVHHSGILPILKEIVEMLFQKGLVK
MWGEVLPHSLGRVLRGQNSGSNRREVDIPILKISNTLPKHVTQTEWAEMLDVSKPVLDFDAKVPIMAHTWPFELDVFQKQAIIKLEEHNHVFVTAHTSAGKTVIAEYAIALSQNHKTRTIYTSPIKALSNQKYRDFRETFQDVGLVTGDFQINTTASCLVMTTEILRSMLYRGSDVLRDLEYVIFDEVHYINDSERGHVWEEVLILLPKEVCIVMLSATVPNTLEFADWVGNTKKTKVYVVSTLKRPVPLKHFLYVGPVLEKNQLFLIREAEGEFLTRGYLAAKEVKCRKQLEKggsgggKLNGPFTRGAEKNLFISFLNYLRKSQNLPVVLFTLSRKRCDQNAANLLSMDFSTATEKSKIHRFFQDSIRNLQNEDDRALPQVKRLEQLLKNGIGVHHSGILPILKEIVEMLFQKGLVK
*************************VDIPILKISNTLPKHVTQTEWAEMLDVSKPVLDFDAKVPIMAHTWPFELDVFQKQAIIKLEEHNHVFVTAHTSAGKTVIAEYAIALSQNHKTRTIYTSPIKALSNQKYRDFRETFQDVGLVTGDFQINTTASCLVMTTEILRSMLYRGSDVLRDLEYVIFDEVHYINDSERGHVWEEVLILLPKEVCIVMLSATVPNTLEFADWVGNTKKTKVYVVSTLKRPVPLKHFLYVGPVLEKNQLFLIREAEGEFLTRGYLAAKEVKCRKQ************GPFTRGAEKNLFISFLNYLRKSQNLPVVLFTLSRKRCDQNAANLLSMDFSTAT**SKIHRFFQDSI************QVKRLEQLLKNGIGVHHSGILPILKEIVEMLFQK****
**********************************************AEMLDVSKPVLDFDAKVPIMAHTWPFELDVFQKQAIIKLEEHNHVFVTAHTSAGKTVIAEYAIALSQNHKTRTIYTSPIKALSNQKYRDFRETFQDVGLVTGDFQINTTASCLVMTTEILRSMLYRGSDVLRDLEYVIFDEVHYINDSERGHVWEEVLILLPKEVCIVMLSATVPNTLEFADWVGNTKKTKVYVVSTLKRPVPLKHFLYVGPVLEKNQLFLIREAEGEFLTRGYLA**************************GAEKNLFISFLNYLRKSQNLPVVLFTLSRKRCDQNAANLLSMDFSTATEKSKIHRFFQDSIRNLQNEDDRALPQVKRLEQLLKNGIGVHHSGILPILKEIVEMLFQKGLVK
MWGEVLPHSLGRVLRGQNSGSNRREVDIPILKISNTLPKHVTQTEWAEMLDVSKPVLDFDAKVPIMAHTWPFELDVFQKQAIIKLEEHNHVFVTAHTSAGKTVIAEYAIALSQNHKTRTIYTSPIKALSNQKYRDFRETFQDVGLVTGDFQINTTASCLVMTTEILRSMLYRGSDVLRDLEYVIFDEVHYINDSERGHVWEEVLILLPKEVCIVMLSATVPNTLEFADWVGNTKKTKVYVVSTLKRPVPLKHFLYVGPVLEKNQLFLIREAEGEFLTRGYLAAKEVKCRKQLEKGGSGGGKLNGPFTRGAEKNLFISFLNYLRKSQNLPVVLFTLSRKRCDQNAANLLSMDFSTATEKSKIHRFFQDSIRNLQNEDDRALPQVKRLEQLLKNGIGVHHSGILPILKEIVEMLFQKGLVK
************************************L**HVTQTEWAEMLDVSKPVLDFDAKVPIMAHTWPFELDVFQKQAIIKLEEHNHVFVTAHTSAGKTVIAEYAIALSQNHKTRTIYTSPIKALSNQKYRDFRETFQDVGLVTGDFQINTTASCLVMTTEILRSMLYRGSDVLRDLEYVIFDEVHYINDSERGHVWEEVLILLPKEVCIVMLSATVPNTLEFADWVGNTKKTKVYVVSTLKRPVPLKHFLYVGPVLEKNQLFLIREAEGEFLTRGYLAAKEVKCRK*********************KNLFISFLNYLRKSQNLPVVLFTLSRKRCDQNAANLLSMDFSTATEKSKIHRFFQDSIRNLQNEDDRALPQVKRLEQLLKNGIGVHHSGILPILKEIVEMLFQKGLVK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWGEVLPHSLGRVLRGQNSGSNRREVDIPILKISNTLPKHVTQTEWAEMLDVSKPVLDFDAKVPIMAHTWPFELDVFQKQAIIKLEEHNHVFVTAHTSAGKTVIAEYAIALSQNHKTRTIYTSPIKALSNQKYRDFRETFQDVGLVTGDFQINTTASCLVMTTEILRSMLYRGSDVLRDLEYVIFDEVHYINDSERGHVWEEVLILLPKEVCIVMLSATVPNTLEFADWVGNTKKTKVYVVSTLKRPVPLKHFLYVGPVLEKNQLFLIREAEGEFLTRGYLAAKEVKCRKQLEKGGSGGGKLNGPFTRGAEKNLFISFLNYLRKSQNLPVVLFTLSRKRCDQNAANLLSMDFSTATEKSKIHRFFQDSIRNLQNEDDRALPQVKRLEQLLKNGIGVHHSGILPILKEIVEMLFQKGLVK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query419 2.2.26 [Sep-21-2011]
Q15477 1246 Helicase SKI2W OS=Homo sa yes N/A 0.902 0.303 0.586 1e-128
O59801 1213 Putative ATP-dependent RN yes N/A 0.968 0.334 0.480 1e-111
P35207 1287 Antiviral helicase SKI2 O yes N/A 0.914 0.297 0.476 1e-109
P42285 1042 Superkiller viralicidic a no N/A 0.928 0.373 0.438 3e-91
Q9CZU3 1040 Superkiller viralicidic a no N/A 0.928 0.374 0.431 3e-90
P47047 1073 ATP-dependent RNA helicas no N/A 0.832 0.325 0.459 2e-87
Q23223 1026 mRNA transport homolog 4 no N/A 0.821 0.335 0.461 7e-86
O14232 1117 ATP-dependent RNA helicas no N/A 0.856 0.321 0.436 9e-83
O13799 1030 Uncharacterized helicase no N/A 0.811 0.330 0.449 2e-81
Q10701 906 Probable helicase HelY OS yes N/A 0.816 0.377 0.371 1e-53
>sp|Q15477|SKIV2_HUMAN Helicase SKI2W OS=Homo sapiens GN=SKIV2L PE=1 SV=3 Back     alignment and function desciption
 Score =  460 bits (1183), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 227/387 (58%), Positives = 285/387 (73%), Gaps = 9/387 (2%)

Query: 38  PKHVTQTEWAEMLDVSKPVLDFDAKVPIMAHTWPFELDVFQKQAIIKLEEHNHVFVTAHT 97
           P+  +Q +WA  +D + PV DF   +P  A  W FE DVFQKQAI+ LE H+ VFV AHT
Sbjct: 275 PEPPSQEQWAIPVDATSPVGDFYRLIPQPAFQWAFEPDVFQKQAILHLERHDSVFVAAHT 334

Query: 98  SAGKTVIAEYAIALSQNHKTRTIYTSPIKALSNQKYRDFRETFQDVGLVTGDFQINTTAS 157
           SAGKTV+AEYAIAL+Q H TRTIYTSPIKALSNQK+RDFR TF DVGL+TGD Q++  AS
Sbjct: 335 SAGKTVVAEYAIALAQKHMTRTIYTSPIKALSNQKFRDFRNTFGDVGLLTGDVQLHPEAS 394

Query: 158 CLVMTTEILRSMLYRGSDVLRDLEYVIFDEVHYINDSERGHVWEEVLILLPKEVCIVMLS 217
           CL+MTTEILRSMLY GSDV+RDLE+VIFDEVHYIND ERG VWEEVLI+LP  V I++LS
Sbjct: 395 CLIMTTEILRSMLYSGSDVIRDLEWVIFDEVHYINDVERGVVWEEVLIMLPDHVSIILLS 454

Query: 218 ATVPNTLEFADWVGNTKKTKVYVVSTLKRPVPLKHFLYVGPVLE-KNQLFLIREAEGEFL 276
           ATVPN LEFADW+G  K+ ++YV+ST+ RPVPL+H+L+ G   + + +LFL+ ++ G F 
Sbjct: 455 ATVPNALEFADWIGRLKRRQIYVISTVTRPVPLEHYLFTGNSSKTQGELFLLLDSRGAFH 514

Query: 277 TRGYLAAKEVKCRKQLEKGGSGGGK----LNGPFTRGAEKNLFISFLNYLRKSQNLPVVL 332
           T+GY AA E K  +  +   + G K      GP     ++ +++S L  LR    LPVV+
Sbjct: 515 TKGYYAAVEAKKERMSKHAQTFGAKQPTHQGGP---AQDRGVYLSLLASLRTRAQLPVVV 571

Query: 333 FTLSRKRCDQNAANLLSMDFSTATEKSKIHRFFQDSIRNLQNEDDRALPQVKRLEQLLKN 392
           FT SR RCD+ A+ L S+D +T++EKS+IH F Q  +  L+   DR LPQV  + +LL  
Sbjct: 572 FTFSRGRCDEQASGLTSLDLTTSSEKSEIHLFLQRCLARLRG-SDRQLPQVLHMSELLNR 630

Query: 393 GIGVHHSGILPILKEIVEMLFQKGLVK 419
           G+GVHHSGILPILKEIVEMLF +GLVK
Sbjct: 631 GLGVHHSGILPILKEIVEMLFSRGLVK 657
Helicase; has ATPase activity. Component of the SKI complex which is thought to be involved in exosome-mediated RNA decay and associates with transcriptionally active genes in a manner dependent on PAF1 complex (PAF1C).
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: -
>sp|O59801|SKI2_SCHPO Putative ATP-dependent RNA helicase C550.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.03c PE=3 SV=1 Back     alignment and function description
>sp|P35207|SKI2_YEAST Antiviral helicase SKI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKI2 PE=1 SV=2 Back     alignment and function description
>sp|P42285|SK2L2_HUMAN Superkiller viralicidic activity 2-like 2 OS=Homo sapiens GN=SKIV2L2 PE=1 SV=3 Back     alignment and function description
>sp|Q9CZU3|SK2L2_MOUSE Superkiller viralicidic activity 2-like 2 OS=Mus musculus GN=Skiv2l2 PE=2 SV=1 Back     alignment and function description
>sp|P47047|MTR4_YEAST ATP-dependent RNA helicase DOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTR4 PE=1 SV=1 Back     alignment and function description
>sp|Q23223|MTR4_CAEEL mRNA transport homolog 4 OS=Caenorhabditis elegans GN=mtr-4 PE=3 SV=1 Back     alignment and function description
>sp|O14232|MTR4_SCHPO ATP-dependent RNA helicase mtr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtr4 PE=1 SV=1 Back     alignment and function description
>sp|O13799|YE02_SCHPO Uncharacterized helicase C17H9.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.02 PE=1 SV=1 Back     alignment and function description
>sp|Q10701|HELY_MYCTU Probable helicase HelY OS=Mycobacterium tuberculosis GN=helY PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query419
312385895 1749 hypothetical protein AND_00228 [Anophele 0.930 0.222 0.647 1e-146
347969420 1223 AGAP003182-PA [Anopheles gambiae str. PE 0.921 0.315 0.652 1e-145
170034314 1216 antiviral helicase SKI2 [Culex quinquefa 0.980 0.337 0.614 1e-142
357617976 1252 hypothetical protein KGM_14675 [Danaus p 0.923 0.309 0.650 1e-141
242017221 1184 Helicase, putative [Pediculus humanus co 0.926 0.327 0.618 1e-137
270010333 1500 hypothetical protein TcasGA2_TC009717, p 0.933 0.260 0.615 1e-137
91086489 1177 PREDICTED: similar to antiviral helicase 0.933 0.332 0.615 1e-137
321468891 1192 hypothetical protein DAPPUDRAFT_304359 [ 0.935 0.328 0.622 1e-134
157137573 947 helicase [Aedes aegypti] gi|108869679|gb 0.832 0.368 0.659 1e-133
125774775 1197 GA10159 [Drosophila pseudoobscura pseudo 0.926 0.324 0.608 1e-132
>gi|312385895|gb|EFR30287.1| hypothetical protein AND_00228 [Anopheles darlingi] Back     alignment and taxonomy information
 Score =  523 bits (1347), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 257/397 (64%), Positives = 303/397 (76%), Gaps = 7/397 (1%)

Query: 29   PILKISNTLPKHVTQTEWAEMLDVSKPVLDFDAKVPIMAHTWPFELDVFQKQAIIKLEEH 88
            P+L IS     ++   EWAE+LD+SKPV DF  K+P+MAH +PFELD+FQKQAI+KLEEH
Sbjct: 706  PVLNISANSGNNLQSAEWAEILDISKPVDDFYVKIPVMAHRFPFELDIFQKQAILKLEEH 765

Query: 89   NHVFVTAHTSAGKTVIAEYAIALSQNHKTRTIYTSPIKALSNQKYRDFRETFQDVGLVTG 148
            +HVFV AHTSAGKTV+AEYAIALS+ H T++IYTSPIKALSNQKYRDF+ TFQDVGL+TG
Sbjct: 766  SHVFVAAHTSAGKTVVAEYAIALSKKHLTKSIYTSPIKALSNQKYRDFKTTFQDVGLMTG 825

Query: 149  DFQINTTASCLVMTTEILRSMLYRGSDVLRDLEYVIFDEVHYINDSERGHVWEEVLILLP 208
            D QI+ TASCL+MTTEILRSMLY GSD+ RDLEYVIFDEVHYI DSERGHVWEEVLILLP
Sbjct: 826  DIQIDPTASCLIMTTEILRSMLYCGSDITRDLEYVIFDEVHYITDSERGHVWEEVLILLP 885

Query: 209  KEVCIVMLSATVPNTLEFADWVGNTKKTKVYVVSTLKRPVPLKHFLYVG-PVLEKNQLFL 267
              VCIVMLSATVPNTLEFA+WVG TKK +VYVVST KRPVPL+H+LY G     K+  FL
Sbjct: 886  DHVCIVMLSATVPNTLEFANWVGKTKKKRVYVVSTAKRPVPLEHYLYTGFGGKSKSDCFL 945

Query: 268  IREAEGEFLTRGYLAAKEVKCRKQLEKGGSGGG-----KLNGPFTRGAEKNLFISFLNYL 322
            I      F   GY  AKE    KQ +  G GG      K  GP+++  E+ L++  +++L
Sbjct: 946  IVNEHSAFTQEGYRKAKECMEVKQAKASGGGGPVMRNQKRTGPYSQKQEQTLWVGLIHHL 1005

Query: 323  RKSQNLPVVLFTLSRKRCDQNAANLLSMDFSTATEKSKIHRFFQDSIRNLQNEDDRALPQ 382
            +    LPVV FTLSR RCD NA  LLS D +TA EK  I+ FFQ  +  L    DRALPQ
Sbjct: 1006 KSQDKLPVVAFTLSRNRCDSNADALLSCDLTTAREKYVINSFFQQCLHRLI-PPDRALPQ 1064

Query: 383  VKRLEQLLKNGIGVHHSGILPILKEIVEMLFQKGLVK 419
            V++++  L+ GIG+HHSGILPILKEIVEMLF +GLVK
Sbjct: 1065 VRQMQSCLERGIGIHHSGILPILKEIVEMLFARGLVK 1101

Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|347969420|ref|XP_312880.4| AGAP003182-PA [Anopheles gambiae str. PEST] gi|333468516|gb|EAA08476.4| AGAP003182-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|170034314|ref|XP_001845019.1| antiviral helicase SKI2 [Culex quinquefasciatus] gi|167875652|gb|EDS39035.1| antiviral helicase SKI2 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|357617976|gb|EHJ71092.1| hypothetical protein KGM_14675 [Danaus plexippus] Back     alignment and taxonomy information
>gi|242017221|ref|XP_002429090.1| Helicase, putative [Pediculus humanus corporis] gi|212513954|gb|EEB16352.1| Helicase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|270010333|gb|EFA06781.1| hypothetical protein TcasGA2_TC009717, partial [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91086489|ref|XP_970674.1| PREDICTED: similar to antiviral helicase SKI2 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|321468891|gb|EFX79874.1| hypothetical protein DAPPUDRAFT_304359 [Daphnia pulex] Back     alignment and taxonomy information
>gi|157137573|ref|XP_001664014.1| helicase [Aedes aegypti] gi|108869679|gb|EAT33904.1| AAEL013825-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|125774775|ref|XP_001358639.1| GA10159 [Drosophila pseudoobscura pseudoobscura] gi|54638378|gb|EAL27780.1| GA10159 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query419
FB|FBgn0039117 1197 tst "twister" [Drosophila mela 0.921 0.322 0.605 2.5e-120
ZFIN|ZDB-GENE-010430-5 1249 skiv2l "superkiller viralicidi 0.892 0.299 0.595 1.6e-118
UNIPROTKB|F1RQW4 1246 SKIV2L "Uncharacterized protei 0.904 0.304 0.593 3.8e-117
UNIPROTKB|E2RSD6 1246 SKIV2L "Uncharacterized protei 0.904 0.304 0.593 7.9e-117
UNIPROTKB|E1BMS0 1246 LOC100139548 "Uncharacterized 0.904 0.304 0.590 3.4e-116
RGD|1303059 1241 Skiv2l "superkiller viralicidi 0.916 0.309 0.581 4.4e-116
UNIPROTKB|F1LP39 1206 Skiv2l "Protein Skiv2l" [Rattu 0.916 0.318 0.581 4.4e-116
UNIPROTKB|B4DM01 1088 SKIV2L "cDNA FLJ57529, highly 0.904 0.348 0.585 1.9e-115
UNIPROTKB|F5H7B0 1053 SKIV2L "Helicase SKI2W" [Homo 0.904 0.359 0.585 1.9e-115
UNIPROTKB|F8VNU1 1088 SKIV2L "Helicase SKI2W" [Homo 0.904 0.348 0.585 1.9e-115
FB|FBgn0039117 tst "twister" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1184 (421.8 bits), Expect = 2.5e-120, P = 2.5e-120
 Identities = 238/393 (60%), Positives = 295/393 (75%)

Query:    29 PILKISNTLPKHVTQTEWAEMLDVSKPVLDFDAKVPIMAHTWPFELDVFQKQAIIKLEEH 88
             P+L IS T      +++WAEM+D+S+P+ +F  ++P  A  +PFELDVFQKQAI+KLE+ 
Sbjct:   220 PVLNISTTTKNF--KSDWAEMVDISQPINNFKEQIPCPAMDFPFELDVFQKQAILKLEQR 277

Query:    89 NHVFVTAHTSAGKTVIAEYAIALSQNHKTRTIYTSPIKALSNQKYRDFRETFQDVGLVTG 148
              +VFV AHTSAGKTV+AEYAIALS+   TRTIYTSPIKALSNQKYRDFR+TF+DVGL+TG
Sbjct:   278 QYVFVAAHTSAGKTVVAEYAIALSKRDLTRTIYTSPIKALSNQKYRDFRKTFKDVGLITG 337

Query:   149 DFQINTTASCLVMTTEILRSMLYRGSDVLRDLEYVIFDEVHYINDSERGHVWEEVLILLP 208
             D QI  TASCL+MTTEILRSMLY GSDV RDLE+VIFDEVHYIN+ ERGHVWEEV+ILLP
Sbjct:   338 DLQIEPTASCLIMTTEILRSMLYCGSDVTRDLEWVIFDEVHYINNPERGHVWEEVIILLP 397

Query:   209 KEVCIVMLSATVPNTLEFADWVGNTKKTKVYVVSTLKRPVPLKHFLYVGPV-LEKNQLFL 267
             + V I+MLSATVPNTLE ADWVG+TKK KVYV+STLKRPVPL HFLY G     ++ +FL
Sbjct:   398 EHVNIIMLSATVPNTLELADWVGSTKKRKVYVISTLKRPVPLTHFLYTGAGGKSRDDIFL 457

Query:   268 IREAEGEFLTRGYLAAKEVKCRKQLE-KXXXXXXKLNGPFTRGAEKNLFISFLNYLRKSQ 326
             + +A+G++L   Y   K V+ +K+++ K                E+  +I  +++LR+S 
Sbjct:   458 LVDAQGKYLQGNY--EKAVERKKEMQGKAKGGGGGPRNHLNAKQEQYTWIGLIDFLRRSN 515

Query:   327 NLPVVLFTLSRKRCDQNAANLLSMDFSTATEKSKIHRFFQDSIRNLQNEDDRALPQVKRL 386
              +PVV FTLSR RCD N A L S+D +T  EK  + +FF   +  L+   DR +PQV  L
Sbjct:   516 MMPVVAFTLSRNRCDSNLAALQSVDLNTEKEKGAVQKFFLQCLAKLK-PPDRTIPQVLVL 574

Query:   387 EQLLKNGIGVHHSGILPILKEIVEMLFQKGLVK 419
             +  L+ GIGVHHSGILPILKEIVEMLFQ GLVK
Sbjct:   575 KDALERGIGVHHSGILPILKEIVEMLFQNGLVK 607
GO:0004386 "helicase activity" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0000381 "regulation of alternative mRNA splicing, via spliceosome" evidence=IMP
GO:0005634 "nucleus" evidence=IC
ZFIN|ZDB-GENE-010430-5 skiv2l "superkiller viralicidic activity 2 (S. cerevisiae homolog)-like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RQW4 SKIV2L "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RSD6 SKIV2L "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BMS0 LOC100139548 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1303059 Skiv2l "superkiller viralicidic activity 2-like (S. cerevisiae )" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LP39 Skiv2l "Protein Skiv2l" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|B4DM01 SKIV2L "cDNA FLJ57529, highly similar to Helicase SKI2W (EC 3.6.1.-)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F5H7B0 SKIV2L "Helicase SKI2W" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F8VNU1 SKIV2L "Helicase SKI2W" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q15477SKIV2_HUMAN3, ., 6, ., 4, ., -0.58650.90210.3033yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.40.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query419
COG4581 1041 COG4581, COG4581, Superfamily II RNA helicase [DNA 1e-131
COG1204 766 COG1204, COG1204, Superfamily II helicase [General 3e-38
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 1e-32
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 5e-27
PRK01172 674 PRK01172, PRK01172, ski2-like helicase; Provisiona 4e-24
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 1e-20
COG1202 830 COG1202, COG1202, Superfamily II helicase, archaea 4e-18
PRK00254 720 PRK00254, PRK00254, ski2-like helicase; Provisiona 5e-17
PRK02362 737 PRK02362, PRK02362, ski2-like helicase; Provisiona 8e-17
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 1e-12
TIGR04121 803 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA 4e-11
COG1205 851 COG1205, COG1205, Distinct helicase family with a 2e-09
PRK09751 1490 PRK09751, PRK09751, putative ATP-dependent helicas 9e-08
PRK13767 876 PRK13767, PRK13767, ATP-dependent helicase; Provis 3e-05
cd09639353 cd09639, Cas3_I, CRISPR/Cas system-associated prot 4e-05
pfam04851100 pfam04851, ResIII, Type III restriction enzyme, re 8e-05
TIGR01587358 TIGR01587, cas3_core, CRISPR-associated helicase C 1e-04
TIGR03817 742 TIGR03817, DECH_helic, helicase/secretion neighbor 0.003
>gnl|CDD|226947 COG4581, COG4581, Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information 
 Score =  403 bits (1038), Expect = e-131
 Identities = 178/378 (47%), Positives = 225/378 (59%), Gaps = 23/378 (6%)

Query: 59  FDAKVPI----MAHTWPFELDVFQKQAIIKLEEHNHVFVTAHTSAGKTVIAEYAIALSQN 114
            DA+ P      A  +PFELD FQ++AI  LE    V V A TS+GKTV+AEYAIAL+  
Sbjct: 101 PDAESPFDLAPPAREYPFELDPFQQEAIAILERGESVLVCAPTSSGKTVVAEYAIALALR 160

Query: 115 HKTRTIYTSPIKALSNQKYRDFRETFQDV----GLVTGDFQINTTASCLVMTTEILRSML 170
              R IYTSPIKALSNQKYRD    F DV    GL+TGD  IN  A CLVMTTEILR+ML
Sbjct: 161 DGQRVIYTSPIKALSNQKYRDLLAKFGDVADMVGLMTGDVSINPDAPCLVMTTEILRNML 220

Query: 171 YRGSDVLRDLEYVIFDEVHYINDSERGHVWEEVLILLPKEVCIVMLSATVPNTLEFADWV 230
           YRGS+ LRD+E+V+FDEVHYI D ERG VWEEV+ILLP  V  V LSATVPN  EFA+W+
Sbjct: 221 YRGSESLRDIEWVVFDEVHYIGDRERGVVWEEVIILLPDHVRFVFLSATVPNAEEFAEWI 280

Query: 231 GNTKKTKVYVVSTLKRPVPLKHFLYVGPVLEKNQLFLIREAEGEFLTRGYLAAKEV-KCR 289
                  ++VVST  RPVPL+HF+YVG       LF + + + +F    + +A     C 
Sbjct: 281 QRVHSQPIHVVSTEHRPVPLEHFVYVG-----KGLFDLVDEKKKFNAENFPSANRSLSCF 335

Query: 290 KQLEKGGSGGGKLNGPFTRGAEKNLFIS------FLNYLRKSQNLPVVLFTLSRKRCDQN 343
            +  +    G          A +            +N L K   LP ++F+ SR+ C++ 
Sbjct: 336 SEKVRETDDGDVGRYARRTKALRGSAKGPAGRPEIVNKLDKDNLLPAIVFSFSRRGCEEA 395

Query: 344 AANLLSMDFSTATEKS-KIHRFFQDSIRNLQNEDDRALP-QVKRLEQLLKNGIGVHHSGI 401
           A  L ++D     EK   I      +I +L  E DR LP Q+  +  LL  GI VHH+G+
Sbjct: 396 AQILSTLDLVLTEEKERAIREIIDHAIGDLAEE-DRELPLQILEISALLLRGIAVHHAGL 454

Query: 402 LPILKEIVEMLFQKGLVK 419
           LP +KE+VE LFQ+GLVK
Sbjct: 455 LPAIKELVEELFQEGLVK 472

Length = 1041
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|100801 PRK01172, PRK01172, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>gnl|CDD|234702 PRK00254, PRK00254, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|235032 PRK02362, PRK02362, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|137505 PRK09751, PRK09751, putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>gnl|CDD|237497 PRK13767, PRK13767, ATP-dependent helicase; Provisional Back     alignment and domain information
>gnl|CDD|187770 cd09639, Cas3_I, CRISPR/Cas system-associated protein Cas3 Back     alignment and domain information
>gnl|CDD|218292 pfam04851, ResIII, Type III restriction enzyme, res subunit Back     alignment and domain information
>gnl|CDD|233483 TIGR01587, cas3_core, CRISPR-associated helicase Cas3 Back     alignment and domain information
>gnl|CDD|234365 TIGR03817, DECH_helic, helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 419
KOG0330|consensus476 100.0
KOG0331|consensus519 100.0
KOG0947|consensus 1248 100.0
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
PTZ00110545 helicase; Provisional 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0335|consensus482 100.0
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 100.0
KOG0328|consensus400 100.0
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 100.0
KOG0948|consensus 1041 100.0
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0338|consensus 691 100.0
KOG0342|consensus 543 100.0
KOG0333|consensus673 100.0
KOG0345|consensus 567 100.0
KOG0326|consensus459 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0343|consensus 758 100.0
KOG0340|consensus442 100.0
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 100.0
PRK02362 737 ski2-like helicase; Provisional 100.0
KOG0346|consensus 569 100.0
KOG0336|consensus629 100.0
KOG0347|consensus 731 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
PRK00254 720 ski2-like helicase; Provisional 100.0
KOG0339|consensus 731 100.0
KOG0952|consensus 1230 100.0
KOG0341|consensus610 100.0
KOG0332|consensus477 100.0
PRK01172 674 ski2-like helicase; Provisional 100.0
COG1204 766 Superfamily II helicase [General function predicti 100.0
KOG0348|consensus 708 100.0
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
KOG4284|consensus 980 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
KOG0327|consensus397 100.0
KOG0334|consensus 997 100.0
KOG0350|consensus620 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 100.0
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 100.0
COG1202 830 Superfamily II helicase, archaea-specific [General 100.0
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
KOG0337|consensus 529 100.0
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 100.0
PRK09401 1176 reverse gyrase; Reviewed 100.0
KOG0344|consensus 593 100.0
PRK10689 1147 transcription-repair coupling factor; Provisional 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 100.0
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
PRK14701 1638 reverse gyrase; Provisional 100.0
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.98
PHA02558501 uvsW UvsW helicase; Provisional 99.98
KOG0951|consensus 1674 99.97
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.97
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.97
KOG0349|consensus 725 99.97
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.97
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.97
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.97
KOG0329|consensus387 99.97
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.97
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.96
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.96
PHA02653 675 RNA helicase NPH-II; Provisional 99.96
COG1205 851 Distinct helicase family with a unique C-terminal 99.96
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 99.96
KOG0354|consensus 746 99.96
PRK13766 773 Hef nuclease; Provisional 99.95
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.95
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.93
PRK05580 679 primosome assembly protein PriA; Validated 99.93
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 99.93
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 99.92
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.92
PRK09694 878 helicase Cas3; Provisional 99.92
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.92
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.92
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.91
KOG0351|consensus 941 99.91
KOG0950|consensus 1008 99.91
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.91
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.91
KOG0352|consensus 641 99.9
TIGR00595 505 priA primosomal protein N'. All proteins in this f 99.9
KOG0353|consensus 695 99.89
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.89
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.87
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.87
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.85
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.84
KOG0949|consensus 1330 99.84
COG4096 875 HsdR Type I site-specific restriction-modification 99.83
PRK04914 956 ATP-dependent helicase HepA; Validated 99.83
smart00487201 DEXDc DEAD-like helicases superfamily. 99.82
KOG0951|consensus 1674 99.81
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.78
KOG1123|consensus 776 99.78
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 99.78
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.78
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.78
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.76
COG1198 730 PriA Primosomal protein N' (replication factor Y) 99.75
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 99.73
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.73
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.73
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.71
KOG0922|consensus 674 99.69
KOG0952|consensus1230 99.68
KOG0920|consensus 924 99.64
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 99.64
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.64
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.57
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.54
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 99.54
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.53
KOG0923|consensus 902 99.52
PRK12326 764 preprotein translocase subunit SecA; Reviewed 99.5
KOG0924|consensus 1042 99.47
PRK05298 652 excinuclease ABC subunit B; Provisional 99.41
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.39
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 99.38
KOG0926|consensus 1172 99.37
COG4889 1518 Predicted helicase [General function prediction on 99.37
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.28
KOG4150|consensus 1034 99.22
CHL00122 870 secA preprotein translocase subunit SecA; Validate 99.21
KOG0953|consensus 700 99.2
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 99.2
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.19
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.15
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.12
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.11
KOG0925|consensus 699 99.09
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 99.06
KOG0385|consensus 971 98.98
KOG0387|consensus 923 98.97
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 98.93
KOG1000|consensus 689 98.89
PRK14873 665 primosome assembly protein PriA; Provisional 98.87
smart00489289 DEXDc3 DEAD-like helicases superfamily. 98.86
smart00488289 DEXDc2 DEAD-like helicases superfamily. 98.86
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.84
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.81
KOG0384|consensus 1373 98.68
COG0610 962 Type I site-specific restriction-modification syst 98.64
PRK15483 986 type III restriction-modification system StyLTI en 98.64
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 98.63
KOG1803|consensus 649 98.52
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 98.5
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 98.49
KOG0392|consensus 1549 98.48
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 98.46
KOG0390|consensus 776 98.45
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 98.44
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 98.44
PRK10875 615 recD exonuclease V subunit alpha; Provisional 98.41
PRK10536262 hypothetical protein; Provisional 98.39
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 98.33
PF1324576 AAA_19: Part of AAA domain 98.32
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 98.31
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 98.27
KOG1802|consensus 935 98.22
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 98.16
PRK13889 988 conjugal transfer relaxase TraA; Provisional 98.15
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 98.12
KOG1002|consensus 791 98.11
KOG0389|consensus 941 98.1
PRK13826 1102 Dtr system oriT relaxase; Provisional 98.02
KOG1132|consensus 945 98.0
PRK06526254 transposase; Provisional 97.99
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.96
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.93
PRK08181269 transposase; Validated 97.93
KOG4439|consensus 901 97.92
PRK04296190 thymidine kinase; Provisional 97.88
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 97.87
TIGR00376 637 DNA helicase, putative. The gene product may repre 97.87
smart00382148 AAA ATPases associated with a variety of cellular 97.83
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 97.73
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 97.71
PRK07952244 DNA replication protein DnaC; Validated 97.68
KOG0391|consensus 1958 97.61
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.58
KOG1805|consensus1100 97.58
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 97.57
KOG2340|consensus698 97.56
KOG1131|consensus 755 97.55
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 97.55
COG3587 985 Restriction endonuclease [Defense mechanisms] 97.55
PRK09183259 transposase/IS protein; Provisional 97.54
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.5
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 97.49
PHA02533 534 17 large terminase protein; Provisional 97.48
PRK05642234 DNA replication initiation factor; Validated 97.48
PRK08727233 hypothetical protein; Validated 97.47
PRK14974336 cell division protein FtsY; Provisional 97.45
PRK12377248 putative replication protein; Provisional 97.43
PRK06921266 hypothetical protein; Provisional 97.41
KOG0386|consensus 1157 97.41
KOG0921|consensus 1282 97.39
PRK06893229 DNA replication initiation factor; Validated 97.34
PRK08116268 hypothetical protein; Validated 97.34
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.32
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.3
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 97.29
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.28
COG2256436 MGS1 ATPase related to the helicase subunit of the 97.28
PRK12402337 replication factor C small subunit 2; Reviewed 97.26
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.25
PRK08903227 DnaA regulatory inactivator Hda; Validated 97.24
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.24
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 97.22
PRK06835329 DNA replication protein DnaC; Validated 97.21
PRK08084235 DNA replication initiation factor; Provisional 97.2
KOG0989|consensus346 97.18
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.17
KOG1133|consensus 821 97.13
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 97.09
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.09
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.09
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 97.08
PRK11054 684 helD DNA helicase IV; Provisional 97.06
PRK00149450 dnaA chromosomal replication initiation protein; R 97.05
PF00004132 AAA: ATPase family associated with various cellula 97.04
COG1444 758 Predicted P-loop ATPase fused to an acetyltransfer 97.03
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 97.01
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 96.93
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 96.93
KOG0388|consensus 1185 96.93
PRK08939306 primosomal protein DnaI; Reviewed 96.93
PRK00411394 cdc6 cell division control protein 6; Reviewed 96.92
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 96.89
PRK08533230 flagellar accessory protein FlaH; Reviewed 96.87
PRK04195 482 replication factor C large subunit; Provisional 96.83
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 96.82
TIGR00362405 DnaA chromosomal replication initiator protein Dna 96.82
PHA03333 752 putative ATPase subunit of terminase; Provisional 96.81
PTZ001121164 origin recognition complex 1 protein; Provisional 96.8
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 96.8
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 96.79
PRK12422445 chromosomal replication initiation protein; Provis 96.78
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 96.76
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 96.76
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 96.71
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 96.7
smart0049082 HELICc helicase superfamily c-terminal domain. 96.69
KOG2028|consensus554 96.65
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 96.63
PRK00771437 signal recognition particle protein Srp54; Provisi 96.63
CHL00181287 cbbX CbbX; Provisional 96.61
PRK14087450 dnaA chromosomal replication initiation protein; P 96.58
TIGR00064272 ftsY signal recognition particle-docking protein F 96.58
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.57
PF13173128 AAA_14: AAA domain 96.56
PLN03025319 replication factor C subunit; Provisional 96.56
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 96.55
PRK09112351 DNA polymerase III subunit delta'; Validated 96.53
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 96.52
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 96.5
PHA02544316 44 clamp loader, small subunit; Provisional 96.5
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.49
PRK05973237 replicative DNA helicase; Provisional 96.47
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.47
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 96.46
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 96.45
PRK11823446 DNA repair protein RadA; Provisional 96.43
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 96.42
PF03354 477 Terminase_1: Phage Terminase ; InterPro: IPR005021 96.41
KOG2228|consensus408 96.4
KOG0991|consensus333 96.4
PRK14088440 dnaA chromosomal replication initiation protein; P 96.39
PRK05707328 DNA polymerase III subunit delta'; Validated 96.39
COG4626 546 Phage terminase-like protein, large subunit [Gener 96.38
PHA03368 738 DNA packaging terminase subunit 1; Provisional 96.36
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 96.36
TIGR02928365 orc1/cdc6 family replication initiation protein. M 96.35
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 96.35
PRK13833323 conjugal transfer protein TrbB; Provisional 96.35
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 96.34
COG0553 866 HepA Superfamily II DNA/RNA helicases, SNF2 family 96.33
TIGR00767415 rho transcription termination factor Rho. Members 96.3
PRK13342413 recombination factor protein RarA; Reviewed 96.27
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 96.23
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 96.23
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 96.22
PRK13894319 conjugal transfer ATPase TrbB; Provisional 96.19
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 96.18
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 96.16
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 96.12
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 96.11
PRK06067234 flagellar accessory protein FlaH; Validated 96.11
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 96.1
PRK10416318 signal recognition particle-docking protein FtsY; 96.08
PRK14086617 dnaA chromosomal replication initiation protein; P 96.07
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 96.06
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 96.06
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 96.05
KOG0058|consensus716 96.05
COG0470325 HolB ATPase involved in DNA replication [DNA repli 96.05
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 96.05
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 96.04
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 96.03
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 96.0
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 95.97
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 95.96
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 95.94
PRK13341 725 recombination factor protein RarA/unknown domain f 95.93
PRK00440319 rfc replication factor C small subunit; Reviewed 95.93
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 95.93
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 95.92
TIGR02688449 conserved hypothetical protein TIGR02688. Members 95.92
PF02456369 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR 95.88
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 95.88
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 95.87
PRK08769319 DNA polymerase III subunit delta'; Validated 95.86
PRK13851344 type IV secretion system protein VirB11; Provision 95.84
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 95.84
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 95.82
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 95.8
PRK06620214 hypothetical protein; Validated 95.72
PF05729166 NACHT: NACHT domain 95.7
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 95.69
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 95.69
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 95.68
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 95.64
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 95.62
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 95.62
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 95.61
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 95.58
PRK04841 903 transcriptional regulator MalT; Provisional 95.57
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 95.56
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 95.56
KOG0739|consensus439 95.56
COG0593408 DnaA ATPase involved in DNA replication initiation 95.55
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 95.55
KOG0745|consensus564 95.55
PRK09376416 rho transcription termination factor Rho; Provisio 95.53
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 95.52
PRK06871325 DNA polymerase III subunit delta'; Validated 95.51
PHA00729226 NTP-binding motif containing protein 95.49
PRK13531 498 regulatory ATPase RavA; Provisional 95.42
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 95.4
PRK07471365 DNA polymerase III subunit delta'; Validated 95.4
PRK07940394 DNA polymerase III subunit delta'; Validated 95.35
PRK10867433 signal recognition particle protein; Provisional 95.31
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 95.31
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 95.28
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 95.24
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 95.23
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 95.21
PF05876 557 Terminase_GpA: Phage terminase large subunit (GpA) 95.18
PRK11331459 5-methylcytosine-specific restriction enzyme subun 95.17
PTZ00293211 thymidine kinase; Provisional 95.15
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 95.14
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 95.13
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 95.13
KOG0298|consensus 1394 95.12
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 95.07
PRK06964342 DNA polymerase III subunit delta'; Validated 95.06
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 94.98
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 94.95
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 94.93
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 94.92
PRK10436462 hypothetical protein; Provisional 94.92
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 94.9
PRK08699325 DNA polymerase III subunit delta'; Validated 94.88
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 94.87
COG3973 747 Superfamily I DNA and RNA helicases [General funct 94.85
PRK10865 857 protein disaggregation chaperone; Provisional 94.84
TIGR00959428 ffh signal recognition particle protein. This mode 94.83
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 94.77
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 94.74
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 94.73
PRK06090319 DNA polymerase III subunit delta'; Validated 94.71
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 94.7
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 94.69
cd01128249 rho_factor Transcription termination factor rho is 94.66
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 94.64
COG1702348 PhoH Phosphate starvation-inducible protein PhoH, 94.62
PRK04328249 hypothetical protein; Provisional 94.54
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 94.51
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 94.49
PF12846304 AAA_10: AAA-like domain 94.48
PRK08506472 replicative DNA helicase; Provisional 94.42
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 94.41
COG0552340 FtsY Signal recognition particle GTPase [Intracell 94.39
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 94.37
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 94.37
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 94.34
PHA00350399 putative assembly protein 94.31
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 94.29
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 94.28
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 94.27
TIGR00763775 lon ATP-dependent protease La. This protein is ind 94.26
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 94.22
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 94.17
KOG0733|consensus802 94.17
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 94.12
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 94.08
PRK13695174 putative NTPase; Provisional 94.08
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 94.08
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 94.07
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 94.06
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 94.04
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 94.01
PRK09087226 hypothetical protein; Validated 94.01
KOG0741|consensus 744 94.0
PRK05748448 replicative DNA helicase; Provisional 93.99
TIGR02533486 type_II_gspE general secretory pathway protein E. 93.97
KOG1001|consensus674 93.95
PF02534469 T4SS-DNA_transf: Type IV secretory system Conjugat 93.95
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 93.94
PRK07414178 cob(I)yrinic acid a,c-diamide adenosyltransferase; 93.94
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 93.92
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 93.89
PRK12608380 transcription termination factor Rho; Provisional 93.86
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 93.81
KOG1015|consensus 1567 93.8
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 93.78
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 93.75
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 93.74
cd01393226 recA_like RecA is a bacterial enzyme which has rol 93.73
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 93.66
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 93.65
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 93.61
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 93.6
PRK08760476 replicative DNA helicase; Provisional 93.56
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 93.51
CHL00176638 ftsH cell division protein; Validated 93.51
COG1221403 PspF Transcriptional regulators containing an AAA- 93.49
PRK06904472 replicative DNA helicase; Validated 93.48
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 93.47
TIGR03743 634 SXT_TraD conjugative coupling factor TraD, SXT/TOL 93.45
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 93.44
PRK07993334 DNA polymerase III subunit delta'; Validated 93.39
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 93.34
PF10412386 TrwB_AAD_bind: Type IV secretion-system coupling p 93.33
PRK09435332 membrane ATPase/protein kinase; Provisional 93.32
TIGR02974329 phageshock_pspF psp operon transcriptional activat 93.3
PRK03992389 proteasome-activating nucleotidase; Provisional 93.27
TIGR02237209 recomb_radB DNA repair and recombination protein R 93.26
cd01127410 TrwB Bacterial conjugation protein TrwB, ATP bindi 93.21
PF00154322 RecA: recA bacterial DNA recombination protein; In 93.18
PRK07004460 replicative DNA helicase; Provisional 93.17
PF03237384 Terminase_6: Terminase-like family; InterPro: IPR0 93.14
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 93.12
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 93.07
cd01394218 radB RadB. The archaeal protein radB shares simila 93.04
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 93.0
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 92.99
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 92.98
PF1355562 AAA_29: P-loop containing region of AAA domain 92.95
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 92.9
TIGR00665434 DnaB replicative DNA helicase. This model describe 92.88
PF01935229 DUF87: Domain of unknown function DUF87; InterPro: 92.88
KOG2004|consensus 906 92.87
CHL00095 821 clpC Clp protease ATP binding subunit 92.86
COG0210 655 UvrD Superfamily I DNA and RNA helicases [DNA repl 92.85
TIGR02012321 tigrfam_recA protein RecA. This model describes or 92.85
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 92.73
PRK08058329 DNA polymerase III subunit delta'; Validated 92.71
PRK13764602 ATPase; Provisional 92.69
PHA02542473 41 41 helicase; Provisional 92.67
PRK13897 606 type IV secretion system component VirD4; Provisio 92.67
cd03115173 SRP The signal recognition particle (SRP) mediates 92.65
KOG1806|consensus 1320 92.61
PRK07399314 DNA polymerase III subunit delta'; Validated 92.58
cd03239178 ABC_SMC_head The structural maintenance of chromos 92.55
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 92.49
COG2874235 FlaH Predicted ATPases involved in biogenesis of a 92.45
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 92.44
PRK09165497 replicative DNA helicase; Provisional 92.44
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 92.42
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 92.42
TIGR03754 643 conj_TOL_TraD conjugative coupling factor TraD, TO 92.42
PRK05636505 replicative DNA helicase; Provisional 92.41
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 92.35
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 92.34
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 92.32
cd00983325 recA RecA is a bacterial enzyme which has roles in 92.27
PRK13850 670 type IV secretion system protein VirD4; Provisiona 92.26
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 92.16
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 92.15
PRK08006471 replicative DNA helicase; Provisional 92.12
COG11971139 Mfd Transcription-repair coupling factor (superfam 92.1
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 92.03
PRK13822641 conjugal transfer coupling protein TraG; Provision 92.02
KOG0730|consensus693 92.01
PRK06321472 replicative DNA helicase; Provisional 92.01
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 91.99
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 91.96
COG2255332 RuvB Holliday junction resolvasome, helicase subun 91.92
>KOG0330|consensus Back     alignment and domain information 
Probab=100.00  E-value=6.9e-49  Score=348.10  Aligned_cols=314  Identities=17%  Similarity=0.199  Sum_probs=256.0

Q ss_pred             cccccchhccCCCccccccccccccccccCCCCccHHHHHHHHHHhcCCcEEEEcCCCCChhHHHHHHHHHH---hcCCC
Q psy2764          41 VTQTEWAEMLDVSKPVLDFDAKVPIMAHTWPFELDVFQKQAIIKLEEHNHVFVTAHTSAGKTVIAEYAIALS---QNHKT  117 (419)
Q Consensus        41 ~~~~~~~~~~~l~~~~~~~~~~l~~~~~~~~~~~~~~Q~~ai~~~~~~~~~iv~apTGsGKT~~~~~~i~~~---~~~~~  117 (419)
                      ....+|.+ +|+.+.+.   +++++.+++.|   |++|+++||.++.|+|+|..|.||||||.+|+++|...   ..+.+
T Consensus        58 e~~~sf~d-Lgv~~~L~---~ac~~l~~~~P---T~IQ~~aiP~~L~g~dvIglAeTGSGKT~afaLPIl~~LL~~p~~~  130 (476)
T KOG0330|consen   58 ESFKSFAD-LGVHPELL---EACQELGWKKP---TKIQSEAIPVALGGRDVIGLAETGSGKTGAFALPILQRLLQEPKLF  130 (476)
T ss_pred             hhhcchhh-cCcCHHHH---HHHHHhCcCCC---chhhhhhcchhhCCCcEEEEeccCCCchhhhHHHHHHHHHcCCCCc
Confidence            34578888 99999999   99999998877   99999999999999999999999999999988887733   23558


Q ss_pred             eEEEEcccHHHHHHHHHHHHHhccccc----eEeccce-------ecCCCcEEEEcHHHHHHHHhc-CCCCCCCccEEEE
Q psy2764         118 RTIYTSPIKALSNQKYRDFRETFQDVG----LVTGDFQ-------INTTASCLVMTTEILRSMLYR-GSDVLRDLEYVIF  185 (419)
Q Consensus       118 ~~lii~Pt~~L~~q~~~~~~~~~~~~~----~~~g~~~-------~~~~~~Iiv~Tp~~l~~~~~~-~~~~l~~~~~lIi  185 (419)
                      +++|++||||||.|+.+.+..++..+|    ++.|+..       ..++++|+|+||++|.+.+.+ +...++.++++|+
T Consensus       131 ~~lVLtPtRELA~QI~e~fe~Lg~~iglr~~~lvGG~~m~~q~~~L~kkPhilVaTPGrL~dhl~~Tkgf~le~lk~LVl  210 (476)
T KOG0330|consen  131 FALVLTPTRELAQQIAEQFEALGSGIGLRVAVLVGGMDMMLQANQLSKKPHILVATPGRLWDHLENTKGFSLEQLKFLVL  210 (476)
T ss_pred             eEEEecCcHHHHHHHHHHHHHhccccCeEEEEEecCchHHHHHHHhhcCCCEEEeCcHHHHHHHHhccCccHHHhHHHhh
Confidence            999999999999999999999988744    4677653       456799999999999998884 5678999999999


Q ss_pred             eCCcccCCCcchHHHHHHHHhcCCCCcEEEEeeecCChHHHHHHhcCcCCccEEEEecCCCCccceEEEEeCCcccccce
Q psy2764         186 DEVHYINDSERGHVWEEVLILLPKEVCIVMLSATVPNTLEFADWVGNTKKTKVYVVSTLKRPVPLKHFLYVGPVLEKNQL  265 (419)
Q Consensus       186 DE~h~l~~~~~~~~~~~i~~~~~~~~~~l~~SAT~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  265 (419)
                      ||||++++..|...++.|+..++..+|.++||||++....-..  ..          ...+|..+.....+.......+.
T Consensus       211 DEADrlLd~dF~~~ld~ILk~ip~erqt~LfsATMt~kv~kL~--ra----------sl~~p~~v~~s~ky~tv~~lkQ~  278 (476)
T KOG0330|consen  211 DEADRLLDMDFEEELDYILKVIPRERQTFLFSATMTKKVRKLQ--RA----------SLDNPVKVAVSSKYQTVDHLKQT  278 (476)
T ss_pred             chHHhhhhhhhHHHHHHHHHhcCccceEEEEEeecchhhHHHH--hh----------ccCCCeEEeccchhcchHHhhhh
Confidence            9999999999999999999999999999999999997765221  11          22333333222212222222333


Q ss_pred             eeeccccCcccchhhhHHHHHHHHhhhhcCCCCCCCCCCCCCCCcchhHHHHHHHHHHHcCCCCEEEEEcchhhHHHHHH
Q psy2764         266 FLIREAEGEFLTRGYLAAKEVKCRKQLEKGGSGGGKLNGPFTRGAEKNLFISFLNYLRKSQNLPVVLFTLSRKRCDQNAA  345 (419)
Q Consensus       266 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~LIF~~t~~~~~~l~~  345 (419)
                      ++.+..                                        +.+-..|+.++....+..+||||+|...+..++-
T Consensus       279 ylfv~~----------------------------------------k~K~~yLV~ll~e~~g~s~iVF~~t~~tt~~la~  318 (476)
T KOG0330|consen  279 YLFVPG----------------------------------------KDKDTYLVYLLNELAGNSVIVFCNTCNTTRFLAL  318 (476)
T ss_pred             eEeccc----------------------------------------cccchhHHHHHHhhcCCcEEEEEeccchHHHHHH
Confidence            332211                                        1122467777777777889999999999999999


Q ss_pred             HhhcCCCCChhHHHHH-HHHHHHHHHhcCCcCCCCchhhHHHHHHHhhhhhhccCCC------ChhhHHHHHHHHhcCc
Q psy2764         346 NLLSMDFSTATEKSKI-HRFFQDSIRNLQNEDDRALPQVKRLEQLLKNGIGVHHSGI------LPILKEIVEMLFQKGL  417 (419)
Q Consensus       346 ~L~~~~~~~~~~~~~~-~~~r~~~l~~f~~g~~~~~~~vlv~t~~l~~GIDi~~~~l------~~~~r~~ie~~f~~g~  417 (419)
                      .|+..|+.+...++.+ ++.|.-.++.|++|..    .||+|||+++||+|||||++      |..-+.||.+..+-|+
T Consensus       319 ~L~~lg~~a~~LhGqmsq~~Rlg~l~~Fk~~~r----~iLv~TDVaSRGLDip~Vd~VVNyDiP~~skDYIHRvGRtaR  393 (476)
T KOG0330|consen  319 LLRNLGFQAIPLHGQMSQSKRLGALNKFKAGAR----SILVCTDVASRGLDIPHVDVVVNYDIPTHSKDYIHRVGRTAR  393 (476)
T ss_pred             HHHhcCcceecccchhhHHHHHHHHHHHhccCC----cEEEecchhcccCCCCCceEEEecCCCCcHHHHHHHcccccc
Confidence            9999999999977777 8899999999999999    99999999999999999975      8889999998776654

>KOG0331|consensus Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>KOG1131|consensus Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG1133|consensus Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>KOG2228|consensus Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0745|consensus Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PHA00350 putative assembly protein Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown Back     alignment and domain information
>KOG2004|consensus Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>PHA02542 41 41 helicase; Provisional Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>KOG1806|consensus Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03754 conj_TOL_TraD conjugative coupling factor TraD, TOL family Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK13850 type IV secretion system protein VirD4; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK13822 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query419
4a4z_A 997 Crystal Structure Of The S. Cerevisiae Dexh Helicas 1e-107
3l9o_A 1108 Crystal Structure Of Mtr4, A Co-Factor Of The Nucle 4e-87
2xgj_A 1010 Structure Of Mtr4, A Dexh Helicase Involved In Nucl 4e-87
2va8_A 715 Dna Repair Helicase Hel308 Length = 715 8e-21
4f92_B 1724 Brr2 Helicase Region S1087l Length = 1724 6e-18
4f91_B 1724 Brr2 Helicase Region Length = 1724 6e-18
2p6r_A 702 Crystal Structure Of Superfamily 2 Helicase Hel308 1e-17
2zj2_A 720 Archaeal Dna Helicase Hjm Apo State In Form 1 Lengt 3e-15
>pdb|4A4Z|A Chain A, Crystal Structure Of The S. Cerevisiae Dexh Helicase Ski2 Bound To Amppnp Length = 997 Back     alignment and structure 
Iteration: 1

 Score =  385 bits (988), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 199/420 (47%), Positives = 268/420 (63%), Gaps = 44/420 (10%)
Query: 43  QTEWAEMLDVSKPVLDFDAKVPIMAHTWPFELDVFQKQAIIKLEEHNHVFVTAHTSAGKT 102
           + EWA ++D++  + +FD  +P  A +WPFELD FQK+A+  LE+ + VFV AHTSAGKT
Sbjct: 9   KKEWAHVVDLNHKIENFDELIPNPARSWPFELDTFQKEAVYHLEQGDSVFVAAHTSAGKT 68
Query: 103 VIAEYAIALSQNHKTRTIYTSPIKALSNQKYRDFRETFQDV--GLVTGDFQINTTASCLV 160
           V+AEYAIA++  + T+TIYTSPIKALSNQK+RDF+ETF DV  GL+TGD QIN  A+CL+
Sbjct: 69  VVAEYAIAMAHRNMTKTIYTSPIKALSNQKFRDFKETFDDVNIGLITGDVQINPDANCLI 128
Query: 161 MTTEILRSMLYRGSDVLRDLEYVIFDEVHYINDSERGHVWEEVLILLPKEVCIVMLSATV 220
           MTTEILRSMLYRG+D++RD+E+VIFDEVHY+ND +RG VWEEV+I+LP+ V  ++LSATV
Sbjct: 129 MTTEILRSMLYRGADLIRDVEFVIFDEVHYVNDQDRGVVWEEVIIMLPQHVKFILLSATV 188
Query: 221 PNTLEFADWVGNTKKTKVYVVSTLKRPVPLKHFLYVG----PVLEKNQLFL--------- 267
           PNT EFA+W+G TK+  +YV+ST KRPVPL+  ++      PV+ +N  FL         
Sbjct: 189 PNTYEFANWIGRTKQKNIYVISTPKRPVPLEINIWAKKELIPVINQNSEFLEANFRKHKE 248
Query: 268 ----------------------IREAEGEFLTRGYLAAKEVKCRKQLEKXXXXXXKLNGP 305
                                  R   G   TR     +    R    +         G 
Sbjct: 249 ILNGESAKGAPSKTDNGRGGSTARGGRGGSNTRDGRGGRGNSTRGGANRGGSRGAGAIGS 308
Query: 306 FTR------GAEKNLFISFLNYLRKSQNLPVVLFTLSRKRCDQNAANLLSMDFSTATEKS 359
             R      G  K  +   +NYLRK + LP+V+F  S+KRC++ A  L  ++F    EKS
Sbjct: 309 NKRKFFTQDGPSKKTWPEIVNYLRKRELLPMVVFVFSKKRCEEYADWLEGINFCNNKEKS 368
Query: 360 KIHRFFQDSIRNLQNEDDRALPQVKRLEQLLKNGIGVHHSGILPILKEIVEMLFQKGLVK 419
           +IH F + SI  L+ E DR LPQ+ +   LL+ GI VHH G+LPI+KE++E+LF KG +K
Sbjct: 369 QIHMFIEKSITRLKKE-DRDLPQILKTRSLLERGIAVHHGGLLPIVKELIEILFSKGFIK 427
>pdb|3L9O|A Chain A, Crystal Structure Of Mtr4, A Co-Factor Of The Nuclear Exosome Length = 1108 Back     alignment and structure
>pdb|2XGJ|A Chain A, Structure Of Mtr4, A Dexh Helicase Involved In Nuclear Rna Processing And Surveillance Length = 1010 Back     alignment and structure
>pdb|2VA8|A Chain A, Dna Repair Helicase Hel308 Length = 715 Back     alignment and structure
>pdb|4F92|B Chain B, Brr2 Helicase Region S1087l Length = 1724 Back     alignment and structure
>pdb|4F91|B Chain B, Brr2 Helicase Region Length = 1724 Back     alignment and structure
>pdb|2P6R|A Chain A, Crystal Structure Of Superfamily 2 Helicase Hel308 In Complex With Unwound Dna Length = 702 Back     alignment and structure
>pdb|2ZJ2|A Chain A, Archaeal Dna Helicase Hjm Apo State In Form 1 Length = 720 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query419
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 1e-135
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 1e-133
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 1e-132
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 3e-80
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 1e-59
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 4e-59
3b6e_A216 Interferon-induced helicase C domain-containing P; 2e-21
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 1e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-12
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 3e-09
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 6e-09
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 1e-08
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 2e-08
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 8e-08
1yks_A 440 Genome polyprotein [contains: flavivirin protease 2e-07
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 5e-07
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 6e-07
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 2e-06
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 3e-06
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 4e-05
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 5e-04
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Length = 1010 Back     alignment and structure
 Score =  411 bits (1056), Expect = e-135
 Identities = 168/388 (43%), Positives = 235/388 (60%), Gaps = 11/388 (2%)

Query: 38  PKHVTQTEWAEMLDVSKPVLDFDAKVPIMAHTWPFELDVFQKQAIIKLEEHNHVFVTAHT 97
             H  + + A   +        + K    A T+PF LD FQ  AI  ++    V V+AHT
Sbjct: 52  LSHQVRHQVALPPNY-DYTPIAEHKRVNEARTYPFTLDPFQDTAISCIDRGESVLVSAHT 110

Query: 98  SAGKTVIAEYAIALSQNHKTRTIYTSPIKALSNQKYRDFRETFQDVGLVTGDFQINTTAS 157
           SAGKTV+AEYAIA S  +K R IYTSPIKALSNQKYR+    F DVGL+TGD  IN  A 
Sbjct: 111 SAGKTVVAEYAIAQSLKNKQRVIYTSPIKALSNQKYRELLAEFGDVGLMTGDITINPDAG 170

Query: 158 CLVMTTEILRSMLYRGSDVLRDLEYVIFDEVHYINDSERGHVWEEVLILLPKEVCIVMLS 217
           CLVMTTEILRSMLYRGS+V+R++ +VIFDEVHY+ D ERG VWEE +ILLP +V  V LS
Sbjct: 171 CLVMTTEILRSMLYRGSEVMREVAWVIFDEVHYMRDKERGVVWEETIILLPDKVRYVFLS 230

Query: 218 ATVPNTLEFADWVGNTKKTKVYVVSTLKRPVPLKHFLYVGPVLEKNQLFLIREAEGEFLT 277
           AT+PN +EFA+W+        ++V T  RP PL+H+L+       + ++L+ + +  F  
Sbjct: 231 ATIPNAMEFAEWICKIHSQPCHIVYTNFRPTPLQHYLFPAH---GDGIYLVVDEKSTFRE 287

Query: 278 RGYLAAKEVKCRKQ------LEKGGSGGGKLNGPFTRGAEKNLFISFLNYLRKSQNLPVV 331
             +  A      +        +  G  G    G   +G  K      +  + K +  PV+
Sbjct: 288 ENFQKAMASISNQIGDDPNSTDSRGKKGQTYKGGSAKGDAKGDIYKIVKMIWKKKYNPVI 347

Query: 332 LFTLSRKRCDQNAANLLSMDFSTATEKSKIHRFFQDSIRNLQNEDDRALPQVKRLEQLLK 391
           +F+ S++ C++ A  +  +DF++  EK  + + F ++I  L  E DR LPQ+K +  LL+
Sbjct: 348 VFSFSKRDCEELALKMSKLDFNSDDEKEALTKIFNNAIALL-PETDRELPQIKHILPLLR 406

Query: 392 NGIGVHHSGILPILKEIVEMLFQKGLVK 419
            GIG+HHSG+LPILKE++E+LFQ+G +K
Sbjct: 407 RGIGIHHSGLLPILKEVIEILFQEGFLK 434
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108 Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Length = 997 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Length = 677 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Length = 237 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query419
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 100.0
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
4gl2_A 699 Interferon-induced helicase C domain-containing P; 100.0
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 100.0
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 100.0
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.98
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.98
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.98
3bor_A237 Human initiation factor 4A-II; translation initiat 99.97
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.97
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.97
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.97
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.97
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.97
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.97
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.97
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.97
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.97
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.97
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.97
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.97
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.97
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.97
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.97
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.97
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.97
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.97
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.97
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 99.96
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.96
3h1t_A590 Type I site-specific restriction-modification syst 99.96
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.96
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.96
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 99.96
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.96
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.95
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.94
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.92
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.92
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.91
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.9
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.89
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.89
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.88
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.86
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.83
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.82
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 99.82
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.78
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.71
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.64
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.59
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.2
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.19
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.13
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 98.7
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 99.09
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.08
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.08
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.07
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.06
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 99.02
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 98.84
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 98.75
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 98.62
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 98.58
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 98.55
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 98.5
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 98.47
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 98.06
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 98.02
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 97.88
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 97.78
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.78
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 97.54
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 97.49
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.48
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.42
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 97.41
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.38
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 97.26
2v1u_A387 Cell division control protein 6 homolog; DNA repli 97.17
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 97.09
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 97.09
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 97.02
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 97.0
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.0
3bos_A242 Putative DNA replication factor; P-loop containing 96.98
3co5_A143 Putative two-component system transcriptional RES 96.93
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 96.93
2chg_A226 Replication factor C small subunit; DNA-binding pr 96.92
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.87
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 96.87
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 96.85
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 96.84
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 96.84
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 96.83
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 96.83
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 96.77
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.74
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 96.66
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 96.66
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 96.62
2qgz_A308 Helicase loader, putative primosome component; str 96.62
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 96.62
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 96.62
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 96.53
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 96.5
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 96.45
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 96.4
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 96.35
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 96.35
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 96.33
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 96.27
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 96.24
2gno_A305 DNA polymerase III, gamma subunit-related protein; 96.03
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 96.0
3pvs_A447 Replication-associated recombination protein A; ma 95.97
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 95.96
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 95.95
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 95.93
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 95.8
1ojl_A304 Transcriptional regulatory protein ZRAR; response 95.78
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 95.77
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 95.76
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 95.72
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 95.7
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 95.61
2cvh_A220 DNA repair and recombination protein RADB; filamen 95.57
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 95.56
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 95.55
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 95.53
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 95.52
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 95.46
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 95.39
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 95.39
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 95.35
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 95.34
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 95.31
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 95.21
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 95.17
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 95.16
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 95.15
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 95.13
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 95.11
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 94.99
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 94.96
2r6a_A454 DNAB helicase, replicative helicase; replication, 94.92
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 94.92
2z43_A324 DNA repair and recombination protein RADA; archaea 94.82
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 94.79
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 94.74
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 94.41
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 94.38
1xp8_A366 RECA protein, recombinase A; recombination, radior 94.37
2chq_A319 Replication factor C small subunit; DNA-binding pr 94.31
2fna_A357 Conserved hypothetical protein; structural genomic 93.99
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 93.89
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 93.78
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 93.74
1p9r_A418 General secretion pathway protein E; bacterial typ 93.25
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 93.13
2l8b_A189 Protein TRAI, DNA helicase I; RECD, hydrolase; NMR 93.11
1e9r_A437 Conjugal transfer protein TRWB; coupling protein, 93.02
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 92.77
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 92.58
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 92.46
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 92.38
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 92.25
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 92.23
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 92.03
2oap_1511 GSPE-2, type II secretion system protein; hexameri 92.03
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 91.95
2eyu_A261 Twitching motility protein PILT; pilus retraction 91.89
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 91.59
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 91.4
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 91.13
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 90.99
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 90.91
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 90.83
3cmw_A1706 Protein RECA, recombinase A; homologous recombinat 90.73
2ewv_A372 Twitching motility protein PILT; pilus retraction 90.69
1xjc_A169 MOBB protein homolog; structural genomics, midwest 90.48
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 90.46
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 90.31
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 90.26
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 90.21
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 90.2
1vma_A306 Cell division protein FTSY; TM0570, structural gen 90.13
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 90.0
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 89.99
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 89.89
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 89.89
1u94_A356 RECA protein, recombinase A; homologous recombinat 89.77
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 89.55
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 89.27
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 89.25
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 89.19
3vaa_A199 Shikimate kinase, SK; structural genomics, center 89.14
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 88.91
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 88.76
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 88.75
3hjh_A 483 Transcription-repair-coupling factor; MFD, mutatio 88.7
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 88.69
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 88.52
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 88.51
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 88.49
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 88.1
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 88.07
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 88.04
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 87.93
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 87.87
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 87.81
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 87.76
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 87.64
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 87.32
2og2_A359 Putative signal recognition particle receptor; nuc 87.27
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 87.03
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 86.74
3io5_A333 Recombination and repair protein; storage dimer, i 86.67
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 86.56
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 86.55
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 86.51
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 86.37
1kag_A173 SKI, shikimate kinase I; transferase, structural g 86.35
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 86.27
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 86.23
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 86.2
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 86.16
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 86.06
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 85.96
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 85.83
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 85.8
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 85.68
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 85.65
2xxa_A433 Signal recognition particle protein; protein trans 85.64
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 85.62
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 85.59
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 85.59
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 85.58
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 85.55
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 85.52
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 85.43
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 85.41
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 85.37
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 85.35
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 85.28
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 85.26
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 85.23
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 85.22
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 85.2
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 85.1
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 84.98
2r44_A331 Uncharacterized protein; putative ATPase, structur 84.97
4a74_A231 DNA repair and recombination protein RADA; hydrola 84.89
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 84.72
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 84.7
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 84.68
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 84.49
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 84.41
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 84.38
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 84.34
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 84.23
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 84.22
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 84.16
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 84.12
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 83.94
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 83.86
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 83.85
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 83.84
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 83.8
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 83.77
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 83.34
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 83.29
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 83.22
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 82.99
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 82.98
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 82.83
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 82.55
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 82.4
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 82.27
1tue_A212 Replication protein E1; helicase, replication, E1E 82.16
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 82.1
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 82.0
3u4q_B 1166 ATP-dependent helicase/deoxyribonuclease subunit; 81.96
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 81.63
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 81.61
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 81.4
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 81.3
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 81.3
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 81.12
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 81.04
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 80.96
1via_A175 Shikimate kinase; structural genomics, transferase 80.88
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 80.85
2woo_A329 ATPase GET3; tail-anchored, membrane protein, targ 80.83
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 80.75
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 80.74
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 80.65
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 80.64
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 80.4
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 80.38
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 80.32
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 80.23
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 80.21
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 80.06
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 80.05
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=1e-46  Score=366.99  Aligned_cols=339  Identities=17%  Similarity=0.252  Sum_probs=267.7

Q ss_pred             hhhhh-cccCCCCCCccc-ccceecccCCCCcccccccchhccCCCccccccccccccccccCCCCccHHHHHHHHHHhc
Q psy2764          10 LGRVL-RGQNSGSNRREV-DIPILKISNTLPKHVTQTEWAEMLDVSKPVLDFDAKVPIMAHTWPFELDVFQKQAIIKLEE   87 (419)
Q Consensus        10 ~~~~~-~~~~~~~~~~~~-~~p~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~l~~~~~~~~~~~~~~Q~~ai~~~~~   87 (419)
                      ..++| +..++|++|..+ ++++...+.+.|.  +...|.+ +++++.+.   +.|.+++|..|   ||+|+++++.+++
T Consensus        22 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~--~~~~f~~-~~l~~~l~---~~l~~~g~~~p---t~iQ~~ai~~i~~   92 (434)
T 2db3_A           22 AIEIFSSGIASGIHFSKYNNIPVKVTGSDVPQ--PIQHFTS-ADLRDIII---DNVNKSGYKIP---TPIQKCSIPVISS   92 (434)
T ss_dssp             HHHHTSCCCCCCTTGGGGGGSCEEEESSSCCC--CCCCGGG-SCCCHHHH---HHHHHTTCCSC---CHHHHHHHHHHHT
T ss_pred             HHHHhhcCcccccChhhhcCceeEecCCCCCC--CcCChhh-cCCCHHHH---HHHHHcCCCCC---CHHHHHHHHHHhc
Confidence            44567 677899999999 7899988888877  4567888 99999998   88888888876   9999999999999


Q ss_pred             CCcEEEEcCCCCChhHHHHHHHHHHh--------cCCCeEEEEcccHHHHHHHHHHHHHhccc----cceEecccee---
Q psy2764          88 HNHVFVTAHTSAGKTVIAEYAIALSQ--------NHKTRTIYTSPIKALSNQKYRDFRETFQD----VGLVTGDFQI---  152 (419)
Q Consensus        88 ~~~~iv~apTGsGKT~~~~~~i~~~~--------~~~~~~lii~Pt~~L~~q~~~~~~~~~~~----~~~~~g~~~~---  152 (419)
                      |++++++||||||||++|++++....        ..++++||++||++|+.|+++.+.++...    ++.++|+...   
T Consensus        93 g~d~i~~a~TGsGKT~a~~lpil~~l~~~~~~~~~~~~~~lil~PtreLa~Q~~~~~~~~~~~~~~~~~~~~gg~~~~~~  172 (434)
T 2db3_A           93 GRDLMACAQTGSGKTAAFLLPILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQ  172 (434)
T ss_dssp             TCCEEEECCTTSSHHHHHHHHHHHHHHHSCCCCCTTCCSEEEECSSHHHHHHHHHHHHHHTTTSSCCCCEECTTSCHHHH
T ss_pred             CCCEEEECCCCCCchHHHHHHHHHHHHhcccccccCCccEEEEecCHHHHHHHHHHHHHHhccCCcEEEEEECCCCHHHH
Confidence            99999999999999999888766332        13679999999999999999999998754    5667777643   


Q ss_pred             ----cCCCcEEEEcHHHHHHHHhcCCCCCCCccEEEEeCCcccCCCcchHHHHHHHHhc--CCCCcEEEEeeecCChHH-
Q psy2764         153 ----NTTASCLVMTTEILRSMLYRGSDVLRDLEYVIFDEVHYINDSERGHVWEEVLILL--PKEVCIVMLSATVPNTLE-  225 (419)
Q Consensus       153 ----~~~~~Iiv~Tp~~l~~~~~~~~~~l~~~~~lIiDE~h~l~~~~~~~~~~~i~~~~--~~~~~~l~~SAT~~~~~~-  225 (419)
                          ..+++|+|+||++|.+++.++...+.+++++|+||||++++.++...+..++..+  +.+.|+++||||+++... 
T Consensus       173 ~~~l~~~~~Ivv~Tp~~l~~~l~~~~~~l~~~~~lVlDEah~~~~~gf~~~~~~i~~~~~~~~~~q~l~~SAT~~~~~~~  252 (434)
T 2db3_A          173 NECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQR  252 (434)
T ss_dssp             HHHHTTCCSEEEECHHHHHHHHHTTSCCCTTCCEEEEETHHHHTSTTTHHHHHHHHHCTTSCSSCEEEEEESCCCHHHHH
T ss_pred             HHHhhcCCCEEEEChHHHHHHHHhCCcccccCCeEEEccHhhhhccCcHHHHHHHHHhcCCCCCceEEEEeccCCHHHHH
Confidence                3468999999999999998888889999999999999999999999999998875  568999999999987654 


Q ss_pred             HHH-HhcCcCCccEEEEecCC--CCccceEEEEeCCcccccceeeeccccCcccchhhhHHHHHHHHhhhhcCCCCCCCC
Q psy2764         226 FAD-WVGNTKKTKVYVVSTLK--RPVPLKHFLYVGPVLEKNQLFLIREAEGEFLTRGYLAAKEVKCRKQLEKGGSGGGKL  302 (419)
Q Consensus       226 ~~~-~l~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  302 (419)
                      ++. ++..    ...+.....  ....+.+.            +..+                                 
T Consensus       253 ~~~~~l~~----~~~i~~~~~~~~~~~i~~~------------~~~~---------------------------------  283 (434)
T 2db3_A          253 MAGEFLKN----YVFVAIGIVGGACSDVKQT------------IYEV---------------------------------  283 (434)
T ss_dssp             HHHTTCSS----CEEEEESSTTCCCTTEEEE------------EEEC---------------------------------
T ss_pred             HHHHhccC----CEEEEeccccccccccceE------------EEEe---------------------------------
Confidence            333 2221    111111111  01111111            1111                                 


Q ss_pred             CCCCCCCcchhHHHHHHHHHHHcCCCCEEEEEcchhhHHHHHHHhhcCCCCChhHHHHH-HHHHHHHHHhcCCcCCCCch
Q psy2764         303 NGPFTRGAEKNLFISFLNYLRKSQNLPVVLFTLSRKRCDQNAANLLSMDFSTATEKSKI-HRFFQDSIRNLQNEDDRALP  381 (419)
Q Consensus       303 ~~~~~~~~~~~~~~~l~~~l~~~~~~~~LIF~~t~~~~~~l~~~L~~~~~~~~~~~~~~-~~~r~~~l~~f~~g~~~~~~  381 (419)
                             ........+.+.+..... ++||||++++.|+.+++.|...|+.+...|+.+ ..+|.+++++|++|+.    
T Consensus       284 -------~~~~k~~~l~~~l~~~~~-~~lVF~~t~~~a~~l~~~L~~~~~~~~~lhg~~~~~~R~~~l~~F~~g~~----  351 (434)
T 2db3_A          284 -------NKYAKRSKLIEILSEQAD-GTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSM----  351 (434)
T ss_dssp             -------CGGGHHHHHHHHHHHCCT-TEEEECSSHHHHHHHHHHHHHTTCCEEEESTTSCHHHHHHHHHHHHTSSC----
T ss_pred             -------CcHHHHHHHHHHHHhCCC-CEEEEEeCcHHHHHHHHHHHhCCCCEEEEeCCCCHHHHHHHHHHHHcCCC----
Confidence                   011223566666666544 499999999999999999999999888766666 7899999999999998    


Q ss_pred             hhHHHHHHHhhhhhhccCC------CChhhHHHHHHHHhcCcC
Q psy2764         382 QVKRLEQLLKNGIGVHHSG------ILPILKEIVEMLFQKGLV  418 (419)
Q Consensus       382 ~vlv~t~~l~~GIDi~~~~------l~~~~r~~ie~~f~~g~i  418 (419)
                      +|||||+++++|||+|+++      +|.....+++...|.|+.
T Consensus       352 ~vLvaT~v~~rGlDi~~v~~VI~~d~p~~~~~y~qriGR~gR~  394 (434)
T 2db3_A          352 KVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRV  394 (434)
T ss_dssp             SEEEECGGGTSSCCCTTCCEEEESSCCSSHHHHHHHHTTSSCT
T ss_pred             cEEEEchhhhCCCCcccCCEEEEECCCCCHHHHHHHhcccccC
Confidence            9999999999999999755      567778889888887763
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli} Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 419
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 9e-21
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 2e-15
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 4e-13
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 1e-12
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 7e-12
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 9e-11
d2fz4a1206 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Arc 4e-10
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 5e-10
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 8e-10
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 9e-10
d2eyqa3233 c.37.1.19 (A:546-778) Transcription-repair couplin 4e-09
d1rifa_282 c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 4e-09
d1gm5a3264 c.37.1.19 (A:286-549) RecG helicase domain {Thermo 5e-07
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 1e-06
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 1e-06
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 2e-06
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 3e-06
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 6e-05
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 7e-05
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 0.002
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Hel308 helicase
species: Archaeoglobus fulgidus [TaxId: 2234]

 Score = 87.7 bits (216), Expect = 9e-21
 Identities = 41/169 (24%), Positives = 82/169 (48%), Gaps = 10/169 (5%)

Query: 73  ELDVFQKQAIIKLEEHNHVFVTAHTSAGKTVIAEYAIALSQNHKTRTIYTSPIKALSNQK 132
           EL   Q +A+ K+    ++ +   T+AGKT++AE A+        +++Y  P++AL+ +K
Sbjct: 25  ELFPPQAEAVEKVFSGKNLLLAMPTAAGKTLLAEMAMVREAIKGGKSLYVVPLRALAGEK 84

Query: 133 YRDFRE-------TFQDVGLVTGDFQINTTASCLVMTTEILRSMLYRGSDVLRDLEYVIF 185
           Y  F++            G      +       +V T+E   S++   +  ++ +  ++ 
Sbjct: 85  YESFKKWEKIGLRIGISTGDYESRDEHLGDCDIIVTTSEKADSLIRNRASWIKAVSCLVV 144

Query: 186 DEVHYINDSERGHVWE---EVLILLPKEVCIVMLSATVPNTLEFADWVG 231
           DE+H ++  +RG   E     +  + K + ++ LSAT PN  E A+W+ 
Sbjct: 145 DEIHLLDSEKRGATLEILVTKMRRMNKALRVIGLSATAPNVTEIAEWLD 193
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 206 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Length = 233 Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Length = 282 Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Length = 264 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query419
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 100.0
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 100.0
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 100.0
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 100.0
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 100.0
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 100.0
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.98
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.97
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.96
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.95
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.93
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.92
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.92
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.86
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.85
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.83
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.82
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.8
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.8
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.41
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.36
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.35
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.34
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.32
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.31
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.29
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.28
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.26
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.24
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.2
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 98.9
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 98.82
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 98.61
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 98.59
d1gkub2 248 Helicase-like "domain" of reverse gyrase {Archaeon 98.55
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 98.5
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 98.35
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 98.27
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 98.19
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 98.08
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 97.99
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 97.97
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 97.72
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 97.45
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 97.36
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 97.23
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 97.2
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 97.1
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 97.09
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.02
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 96.98
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.57
d1z3ix1 346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 96.52
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 96.51
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 96.42
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 96.33
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 96.28
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 96.27
d1okkd2207 GTPase domain of the signal recognition particle r 96.24
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 96.22
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 96.09
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.02
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 95.93
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 95.84
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.81
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 95.8
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.72
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 95.7
d2qy9a2211 GTPase domain of the signal recognition particle r 95.69
d1vmaa2213 GTPase domain of the signal recognition particle r 95.62
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 95.61
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.55
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 95.43
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 95.17
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.08
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.07
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.06
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 94.85
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 94.4
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 94.39
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 93.99
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 93.97
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 93.95
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 93.88
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 93.44
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 93.38
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 93.15
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 92.91
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 92.88
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 92.76
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 92.49
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 92.09
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 92.06
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 91.98
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 91.76
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 91.53
d2hyda1255 Putative multidrug export ATP-binding/permease pro 91.46
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 91.45
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 91.32
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 91.09
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 90.81
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 90.63
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 90.56
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 90.45
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 90.44
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 90.41
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 90.39
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 90.25
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 90.14
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 90.07
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 89.76
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 89.46
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 89.37
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 89.3
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 89.06
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 88.87
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 88.76
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 88.2
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 88.15
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 88.08
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 87.92
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 87.79
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 87.63
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 87.6
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 87.39
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 87.28
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 87.15
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 86.98
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 86.95
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 86.82
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 86.8
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 86.74
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 86.72
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 86.44
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 86.4
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 86.23
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 86.08
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 85.85
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 85.8
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 85.72
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 85.65
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 85.64
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 85.61
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 85.32
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 85.14
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 85.01
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 84.74
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 84.68
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 84.68
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 84.66
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 84.5
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 84.44
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 84.15
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 83.66
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 83.5
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 83.2
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 83.17
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 83.16
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 82.82
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 82.79
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 82.67
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 82.61
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 82.13
d1g2912240 Maltose transport protein MalK, N-terminal domain 82.05
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 81.95
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 81.85
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 81.74
d2awna2232 Maltose transport protein MalK, N-terminal domain 80.94
d1svma_362 Papillomavirus large T antigen helicase domain {Si 80.76
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 80.2
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1e-35  Score=258.57  Aligned_cols=179  Identities=16%  Similarity=0.230  Sum_probs=157.7

Q ss_pred             cccchhccCCCccccccccccccccccCCCCccHHHHHHHHHHhcCCcEEEEcCCCCChhHHHHHHHHHHh---cCCCeE
Q psy2764          43 QTEWAEMLDVSKPVLDFDAKVPIMAHTWPFELDVFQKQAIIKLEEHNHVFVTAHTSAGKTVIAEYAIALSQ---NHKTRT  119 (419)
Q Consensus        43 ~~~~~~~~~l~~~~~~~~~~l~~~~~~~~~~~~~~Q~~ai~~~~~~~~~iv~apTGsGKT~~~~~~i~~~~---~~~~~~  119 (419)
                      ..+|.+ +||++.+.   ++|.++||..|   ||+|++|||.++.|+|++++||||||||++|++++....   ...+++
T Consensus        16 ~~sF~~-l~L~~~l~---~~L~~~g~~~p---t~IQ~~aIp~il~g~dvi~~a~TGSGKTlayllPil~~l~~~~~~~~~   88 (222)
T d2j0sa1          16 TPTFDT-MGLREDLL---RGIYAYGFEKP---SAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQA   88 (222)
T ss_dssp             CCSGGG-GCCCHHHH---HHHHHHTCCSC---CHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCTTSCSCCE
T ss_pred             CCCHHH-CCCCHHHH---HHHHHCCCCCC---CHHHHHHHHHHHCCCCeEEEcCcchhhhhhhcccccccccccccCcee
Confidence            446888 99999999   99999999987   999999999999999999999999999999888877543   356889


Q ss_pred             EEEcccHHHHHHHHHHHHHhccc----cceEecccee-------cCCCcEEEEcHHHHHHHHhcCCCCCCCccEEEEeCC
Q psy2764         120 IYTSPIKALSNQKYRDFRETFQD----VGLVTGDFQI-------NTTASCLVMTTEILRSMLYRGSDVLRDLEYVIFDEV  188 (419)
Q Consensus       120 lii~Pt~~L~~q~~~~~~~~~~~----~~~~~g~~~~-------~~~~~Iiv~Tp~~l~~~~~~~~~~l~~~~~lIiDE~  188 (419)
                      +|++||++|+.|+++.+.++...    +..+.|+...       ..+++|+|+||+++.+++......+++++++|+|||
T Consensus        89 lil~PtreLa~Qi~~~~~~l~~~~~i~~~~~~g~~~~~~~~~~l~~~~~Ilv~TPgrl~~~~~~~~~~~~~l~~lVlDEa  168 (222)
T d2j0sa1          89 LILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEA  168 (222)
T ss_dssp             EEECSSHHHHHHHHHHHHHHTTTTTCCEEEECTTSCHHHHHHHHHHCCSEEEECHHHHHHHHHTTSSCCTTCCEEEEETH
T ss_pred             EEecchHHHHHHHHHHHHHHhCccceeEEEEeecccchhhHHHhccCCeEEeCCCCcHHhcccccccccccceeeeecch
Confidence            99999999999999999998765    4456666542       346899999999999999998889999999999999


Q ss_pred             cccCCCcchHHHHHHHHhcCCCCcEEEEeeecCChHH-HHH
Q psy2764         189 HYINDSERGHVWEEVLILLPKEVCIVMLSATVPNTLE-FAD  228 (419)
Q Consensus       189 h~l~~~~~~~~~~~i~~~~~~~~~~l~~SAT~~~~~~-~~~  228 (419)
                      |.+++.++...+..+++.++++.|++++|||+++..+ +++
T Consensus       169 D~ll~~~f~~~i~~I~~~l~~~~Q~ilfSAT~~~~v~~l~~  209 (222)
T d2j0sa1         169 DEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTN  209 (222)
T ss_dssp             HHHTSTTTHHHHHHHHTTSCTTCEEEEEESCCCHHHHTTGG
T ss_pred             hHhhhcCcHHHHHHHHHhCCCCCEEEEEEEeCCHHHHHHHH
Confidence            9999999999999999999999999999999987643 443
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure