Psyllid ID: psy2783
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 340 | ||||||
| 156350379 | 229 | predicted protein [Nematostella vectensi | 0.629 | 0.934 | 0.913 | 1e-115 | |
| 449436665 | 274 | PREDICTED: uncharacterized protein LOC10 | 0.682 | 0.846 | 0.806 | 1e-110 | |
| 297802114 | 229 | F10A5.19 [Arabidopsis lyrata subsp. lyra | 0.629 | 0.934 | 0.870 | 1e-110 | |
| 432892305 | 250 | PREDICTED: histone H3.3-like [Oryzias la | 0.576 | 0.784 | 0.878 | 1e-109 | |
| 297839447 | 236 | F10A5.19 [Arabidopsis lyrata subsp. lyra | 0.65 | 0.936 | 0.857 | 1e-109 | |
| 392333971 | 325 | PREDICTED: uncharacterized protein LOC68 | 0.679 | 0.710 | 0.773 | 1e-108 | |
| 9369379 | 236 | F10A5.19 [Arabidopsis thaliana] | 0.65 | 0.936 | 0.849 | 1e-108 | |
| 395859211 | 389 | PREDICTED: uncharacterized protein LOC10 | 0.917 | 0.802 | 0.623 | 1e-102 | |
| 391344534 | 277 | PREDICTED: uncharacterized protein LOC10 | 0.605 | 0.743 | 0.758 | 2e-98 | |
| 357476499 | 391 | Histone H3 [Medicago truncatula] gi|3555 | 0.852 | 0.741 | 0.613 | 3e-96 |
| >gi|156350379|ref|XP_001622258.1| predicted protein [Nematostella vectensis] gi|156208747|gb|EDO30158.1| predicted protein [Nematostella vectensis] | Back alignment and taxonomy information |
|---|
Score = 421 bits (1082), Expect = e-115, Method: Compositional matrix adjust.
Identities = 212/232 (91%), Positives = 212/232 (91%), Gaps = 18/232 (7%)
Query: 1 TARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKL 60
TARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKL
Sbjct: 7 TARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKL 66
Query: 61 PFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRTARKSTGGK 120
PFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR
Sbjct: 67 PFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR--------- 117
Query: 121 APRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREI 180
AARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREI
Sbjct: 118 ---------AARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREI 168
Query: 181 AQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIHW 232
AQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDI
Sbjct: 169 AQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL 220
|
Source: Nematostella vectensis Species: Nematostella vectensis Genus: Nematostella Family: Edwardsiidae Order: Actiniaria Class: Anthozoa Phylum: Cnidaria Superkingdom: Eukaryota |
| >gi|449436665|ref|XP_004136113.1| PREDICTED: uncharacterized protein LOC101209420 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297802114|ref|XP_002868941.1| F10A5.19 [Arabidopsis lyrata subsp. lyrata] gi|297314777|gb|EFH45200.1| F10A5.19 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|432892305|ref|XP_004075755.1| PREDICTED: histone H3.3-like [Oryzias latipes] | Back alignment and taxonomy information |
|---|
| >gi|297839447|ref|XP_002887605.1| F10A5.19 [Arabidopsis lyrata subsp. lyrata] gi|297333446|gb|EFH63864.1| F10A5.19 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|392333971|ref|XP_002725328.2| PREDICTED: uncharacterized protein LOC680498 [Rattus norvegicus] gi|392354401|ref|XP_001057443.2| PREDICTED: uncharacterized protein LOC680498 [Rattus norvegicus] | Back alignment and taxonomy information |
|---|
| >gi|9369379|gb|AAF87128.1|AC006434_24 F10A5.19 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|395859211|ref|XP_003801936.1| PREDICTED: uncharacterized protein LOC100956128 [Otolemur garnettii] | Back alignment and taxonomy information |
|---|
| >gi|391344534|ref|XP_003746551.1| PREDICTED: uncharacterized protein LOC100906955 [Metaseiulus occidentalis] | Back alignment and taxonomy information |
|---|
| >gi|357476499|ref|XP_003608535.1| Histone H3 [Medicago truncatula] gi|355509590|gb|AES90732.1| Histone H3 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 340 | ||||||
| UNIPROTKB|G1K329 | 142 | LOC768333 "Histone H3" [Gallus | 0.370 | 0.887 | 0.960 | 5.7e-59 | |
| UNIPROTKB|G1K331 | 143 | LOC768333 "Histone H3" [Gallus | 0.355 | 0.846 | 0.991 | 1.9e-58 | |
| FB|FBgn0051613 | 136 | His3:CG31613 "His3:CG31613" [D | 0.355 | 0.889 | 0.991 | 1.9e-58 | |
| FB|FBgn0053803 | 136 | His3:CG33803 "His3:CG33803" [D | 0.355 | 0.889 | 0.991 | 1.9e-58 | |
| FB|FBgn0053806 | 136 | His3:CG33806 "His3:CG33806" [D | 0.355 | 0.889 | 0.991 | 1.9e-58 | |
| FB|FBgn0053809 | 136 | His3:CG33809 "His3:CG33809" [D | 0.355 | 0.889 | 0.991 | 1.9e-58 | |
| FB|FBgn0053812 | 136 | His3:CG33812 "His3:CG33812" [D | 0.355 | 0.889 | 0.991 | 1.9e-58 | |
| FB|FBgn0053815 | 136 | His3:CG33815 "His3:CG33815" [D | 0.355 | 0.889 | 0.991 | 1.9e-58 | |
| FB|FBgn0053818 | 136 | His3:CG33818 "His3:CG33818" [D | 0.355 | 0.889 | 0.991 | 1.9e-58 | |
| FB|FBgn0053821 | 136 | His3:CG33821 "His3:CG33821" [D | 0.355 | 0.889 | 0.991 | 1.9e-58 |
| UNIPROTKB|G1K329 LOC768333 "Histone H3" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 605 (218.0 bits), Expect = 5.7e-59, P = 5.7e-59
Identities = 122/127 (96%), Positives = 124/127 (97%)
Query: 105 CAI-HAKRTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS 163
CA+ K+TARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS
Sbjct: 5 CAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS 64
Query: 164 TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRV 223
TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRV
Sbjct: 65 TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRV 124
Query: 224 TIMPKDI 230
TIMPKDI
Sbjct: 125 TIMPKDI 131
|
|
| UNIPROTKB|G1K331 LOC768333 "Histone H3" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0051613 His3:CG31613 "His3:CG31613" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053803 His3:CG33803 "His3:CG33803" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053806 His3:CG33806 "His3:CG33806" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053809 His3:CG33809 "His3:CG33809" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053812 His3:CG33812 "His3:CG33812" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053815 His3:CG33815 "His3:CG33815" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053818 His3:CG33818 "His3:CG33818" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053821 His3:CG33821 "His3:CG33821" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 340 | |||
| PTZ00018 | 136 | PTZ00018, PTZ00018, histone H3; Provisional | 2e-73 | |
| PTZ00018 | 136 | PTZ00018, PTZ00018, histone H3; Provisional | 5e-66 | |
| PLN00121 | 136 | PLN00121, PLN00121, histone H3; Provisional | 3e-64 | |
| PLN00121 | 136 | PLN00121, PLN00121, histone H3; Provisional | 4e-58 | |
| PTZ00018 | 136 | PTZ00018, PTZ00018, histone H3; Provisional | 2e-50 | |
| smart00428 | 105 | smart00428, H3, Histone H3 | 3e-49 | |
| PLN00121 | 136 | PLN00121, PLN00121, histone H3; Provisional | 2e-44 | |
| smart00428 | 105 | smart00428, H3, Histone H3 | 5e-43 | |
| PLN00161 | 135 | PLN00161, PLN00161, histone H3; Provisional | 4e-35 | |
| PLN00160 | 97 | PLN00160, PLN00160, histone H3; Provisional | 3e-30 | |
| PLN00161 | 135 | PLN00161, PLN00161, histone H3; Provisional | 1e-29 | |
| COG2036 | 91 | COG2036, HHT1, Histones H3 and H4 [Chromatin struc | 2e-25 | |
| pfam00125 | 75 | pfam00125, Histone, Core histone H2A/H2B/H3/H4 | 2e-25 | |
| PLN00160 | 97 | PLN00160, PLN00160, histone H3; Provisional | 6e-25 | |
| smart00428 | 105 | smart00428, H3, Histone H3 | 5e-23 | |
| COG2036 | 91 | COG2036, HHT1, Histones H3 and H4 [Chromatin struc | 9e-21 | |
| pfam00125 | 75 | pfam00125, Histone, Core histone H2A/H2B/H3/H4 | 2e-19 | |
| PLN00161 | 135 | PLN00161, PLN00161, histone H3; Provisional | 1e-17 | |
| PLN00160 | 97 | PLN00160, PLN00160, histone H3; Provisional | 6e-09 | |
| COG2036 | 91 | COG2036, HHT1, Histones H3 and H4 [Chromatin struc | 8e-08 | |
| pfam00125 | 75 | pfam00125, Histone, Core histone H2A/H2B/H3/H4 | 8e-06 |
| >gnl|CDD|185400 PTZ00018, PTZ00018, histone H3; Provisional | Back alignment and domain information |
|---|
Score = 222 bits (568), Expect = 2e-73
Identities = 115/122 (94%), Positives = 120/122 (98%)
Query: 110 KRTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIR 169
K+TARKSTGGKAPRKQLA+KAARKSAP TGG+KKPHRYRPGTVALREIRRYQKSTELLIR
Sbjct: 5 KQTARKSTGGKAPRKQLASKAARKSAPVTGGIKKPHRYRPGTVALREIRRYQKSTELLIR 64
Query: 170 KLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKD 229
KLPFQRLVREIAQDFKTDLRFQSSAV+ALQEA+EAYLVGLFEDTNLCAIHAKRVTIMPKD
Sbjct: 65 KLPFQRLVREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKD 124
Query: 230 IH 231
I
Sbjct: 125 IQ 126
|
Length = 136 |
| >gnl|CDD|185400 PTZ00018, PTZ00018, histone H3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177733 PLN00121, PLN00121, histone H3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177733 PLN00121, PLN00121, histone H3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185400 PTZ00018, PTZ00018, histone H3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|128705 smart00428, H3, Histone H3 | Back alignment and domain information |
|---|
| >gnl|CDD|177733 PLN00121, PLN00121, histone H3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|128705 smart00428, H3, Histone H3 | Back alignment and domain information |
|---|
| >gnl|CDD|215082 PLN00161, PLN00161, histone H3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165727 PLN00160, PLN00160, histone H3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215082 PLN00161, PLN00161, histone H3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224947 COG2036, HHT1, Histones H3 and H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 | Back alignment and domain information |
|---|
| >gnl|CDD|165727 PLN00160, PLN00160, histone H3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|128705 smart00428, H3, Histone H3 | Back alignment and domain information |
|---|
| >gnl|CDD|224947 COG2036, HHT1, Histones H3 and H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 | Back alignment and domain information |
|---|
| >gnl|CDD|215082 PLN00161, PLN00161, histone H3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165727 PLN00160, PLN00160, histone H3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224947 COG2036, HHT1, Histones H3 and H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 340 | |||
| PTZ00018 | 136 | histone H3; Provisional | 100.0 | |
| PLN00121 | 136 | histone H3; Provisional | 100.0 | |
| PLN00161 | 135 | histone H3; Provisional | 100.0 | |
| KOG1745|consensus | 137 | 100.0 | ||
| PLN00160 | 97 | histone H3; Provisional | 100.0 | |
| smart00428 | 105 | H3 Histone H3. | 100.0 | |
| PTZ00018 | 136 | histone H3; Provisional | 100.0 | |
| PLN00121 | 136 | histone H3; Provisional | 100.0 | |
| PLN00161 | 135 | histone H3; Provisional | 100.0 | |
| KOG1745|consensus | 137 | 100.0 | ||
| PLN00160 | 97 | histone H3; Provisional | 100.0 | |
| smart00428 | 105 | H3 Histone H3. | 100.0 | |
| COG2036 | 91 | HHT1 Histones H3 and H4 [Chromatin structure and d | 99.85 | |
| PF00125 | 75 | Histone: Core histone H2A/H2B/H3/H4 histone h2a si | 99.72 | |
| COG2036 | 91 | HHT1 Histones H3 and H4 [Chromatin structure and d | 99.66 | |
| PF00125 | 75 | Histone: Core histone H2A/H2B/H3/H4 histone h2a si | 99.25 | |
| cd07981 | 72 | TAF12 TATA Binding Protein (TBP) Associated Factor | 98.88 | |
| cd00076 | 85 | H4 Histone H4, one of the four histones, along wit | 97.66 | |
| cd07981 | 72 | TAF12 TATA Binding Protein (TBP) Associated Factor | 97.63 | |
| PF00808 | 65 | CBFD_NFYB_HMF: Histone-like transcription factor ( | 97.5 | |
| smart00803 | 65 | TAF TATA box binding protein associated factor. TA | 97.49 | |
| PLN00035 | 103 | histone H4; Provisional | 97.47 | |
| PTZ00015 | 102 | histone H4; Provisional | 97.37 | |
| smart00417 | 74 | H4 Histone H4. | 97.32 | |
| cd07979 | 117 | TAF9 TATA Binding Protein (TBP) Associated Factor | 97.01 | |
| KOG0870|consensus | 172 | 96.95 | ||
| PF15630 | 76 | CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C | 96.66 | |
| PF03847 | 68 | TFIID_20kDa: Transcription initiation factor TFIID | 96.38 | |
| smart00576 | 77 | BTP Bromodomain transcription factors and PHD doma | 95.67 | |
| KOG1142|consensus | 258 | 95.6 | ||
| PF02969 | 66 | TAF: TATA box binding protein associated factor (T | 95.41 | |
| PF15511 | 414 | CENP-T: Centromere kinetochore component CENP-T; P | 94.75 | |
| cd08050 | 343 | TAF6 TATA Binding Protein (TBP) Associated Factor | 94.01 | |
| PF02291 | 129 | TFIID-31kDa: Transcription initiation factor IID, | 93.95 | |
| cd00074 | 115 | H2A Histone 2A; H2A is a subunit of the nucleosome | 93.31 | |
| smart00417 | 74 | H4 Histone H4. | 92.73 | |
| cd00076 | 85 | H4 Histone H4, one of the four histones, along wit | 92.52 | |
| smart00803 | 65 | TAF TATA box binding protein associated factor. TA | 92.28 | |
| PLN00035 | 103 | histone H4; Provisional | 92.25 | |
| PF00808 | 65 | CBFD_NFYB_HMF: Histone-like transcription factor ( | 91.99 | |
| KOG0870|consensus | 172 | 91.78 | ||
| PTZ00015 | 102 | histone H4; Provisional | 89.64 | |
| cd07979 | 117 | TAF9 TATA Binding Protein (TBP) Associated Factor | 82.94 | |
| PF07524 | 77 | Bromo_TP: Bromodomain associated; InterPro: IPR006 | 81.09 | |
| smart00576 | 77 | BTP Bromodomain transcription factors and PHD doma | 80.69 |
| >PTZ00018 histone H3; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=8.7e-48 Score=332.94 Aligned_cols=130 Identities=88% Similarity=1.245 Sum_probs=120.5
Q ss_pred cccccccCCCCCCcchhhhhhhcCCCCCCCCCCCCCcCCCCchhhHHHHhhhhhhhhhccCCchhHHHHHHHHhcccccc
Q psy2783 110 KRTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLR 189 (340)
Q Consensus 110 kRvtrKs~~~kAPRKqlAsk~~~ks~~~~~~~~~~~r~rpg~~alrEIr~yQkst~lLIpk~pF~RLVrEI~~~~~~~~r 189 (340)
|..+.++.++++|+++.+.+...++.+.+++.++++||+||++||+|||+||+||+|||||+||+||||||++++.+++|
T Consensus 5 k~~~~k~~~~~~prk~~~~~~~~~~~~~~~~~~~~~r~rpGt~aLrEIr~yQkst~lLI~k~pF~RLVREI~~~~~~~~r 84 (136)
T PTZ00018 5 KQTARKSTGGKAPRKQLASKAARKSAPVTGGIKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLR 84 (136)
T ss_pred CcCccCCCCCCCCcccccccccccCCCCCCCCCCCcccCCchhHHHHHHHHcccchhccccccHHHHHHHHHHHcCCcce
Confidence 34456777888889888887777777777888999999999999999999999999999999999999999999999999
Q ss_pred ccHHHHHHHHHHHHHHHHHhhhchhhhhccCCceecCCCCcchhhhhhcc
Q psy2783 190 FQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIHWPSQWCDN 239 (340)
Q Consensus 190 fq~~Al~ALQeAaEa~Lv~lFeda~lca~HakRVTl~~kDm~L~~~i~~~ 239 (340)
||++||+|||||+|+|||+||||+|+||+||||||||++||+|+.+|.++
T Consensus 85 f~~~al~aLQeaaE~yLv~lfed~~lca~HakRVTl~~kD~~L~~rirg~ 134 (136)
T PTZ00018 85 FQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE 134 (136)
T ss_pred eeHHHHHHHHHHHHHHHHHHhhhhHHHHHhhcceecchhhHHHHHHhccc
Confidence 99999999999999999999999999999999999999999999999764
|
|
| >PLN00121 histone H3; Provisional | Back alignment and domain information |
|---|
| >PLN00161 histone H3; Provisional | Back alignment and domain information |
|---|
| >KOG1745|consensus | Back alignment and domain information |
|---|
| >PLN00160 histone H3; Provisional | Back alignment and domain information |
|---|
| >smart00428 H3 Histone H3 | Back alignment and domain information |
|---|
| >PTZ00018 histone H3; Provisional | Back alignment and domain information |
|---|
| >PLN00121 histone H3; Provisional | Back alignment and domain information |
|---|
| >PLN00161 histone H3; Provisional | Back alignment and domain information |
|---|
| >KOG1745|consensus | Back alignment and domain information |
|---|
| >PLN00160 histone H3; Provisional | Back alignment and domain information |
|---|
| >smart00428 H3 Histone H3 | Back alignment and domain information |
|---|
| >COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] | Back alignment and domain information |
|---|
| >COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] | Back alignment and domain information |
|---|
| >cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution | Back alignment and domain information |
|---|
| >cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin | Back alignment and domain information |
|---|
| >smart00803 TAF TATA box binding protein associated factor | Back alignment and domain information |
|---|
| >PLN00035 histone H4; Provisional | Back alignment and domain information |
|---|
| >PTZ00015 histone H4; Provisional | Back alignment and domain information |
|---|
| >smart00417 H4 Histone H4 | Back alignment and domain information |
|---|
| >cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >KOG0870|consensus | Back alignment and domain information |
|---|
| >PF15630 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 4DRB_H 3V9R_C | Back alignment and domain information |
|---|
| >PF03847 TFIID_20kDa: Transcription initiation factor TFIID subunit A; InterPro: IPR003228 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] | Back alignment and domain information |
|---|
| >smart00576 BTP Bromodomain transcription factors and PHD domain containing proteins | Back alignment and domain information |
|---|
| >KOG1142|consensus | Back alignment and domain information |
|---|
| >PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex | Back alignment and domain information |
|---|
| >PF15511 CENP-T: Centromere kinetochore component CENP-T; PDB: 3B0D_T 3B0C_T 3VH5_T 3VH6_T | Back alignment and domain information |
|---|
| >cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >PF02291 TFIID-31kDa: Transcription initiation factor IID, 31kD subunit; InterPro: IPR003162 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] | Back alignment and domain information |
|---|
| >cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome | Back alignment and domain information |
|---|
| >smart00417 H4 Histone H4 | Back alignment and domain information |
|---|
| >cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution | Back alignment and domain information |
|---|
| >smart00803 TAF TATA box binding protein associated factor | Back alignment and domain information |
|---|
| >PLN00035 histone H4; Provisional | Back alignment and domain information |
|---|
| >PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin | Back alignment and domain information |
|---|
| >KOG0870|consensus | Back alignment and domain information |
|---|
| >PTZ00015 histone H4; Provisional | Back alignment and domain information |
|---|
| >cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >PF07524 Bromo_TP: Bromodomain associated; InterPro: IPR006565 This bromodomain is found in eukaryotic transcription factors and PHD domain containing proteins (IPR001965 from INTERPRO) | Back alignment and domain information |
|---|
| >smart00576 BTP Bromodomain transcription factors and PHD domain containing proteins | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 340 | ||||
| 2hio_C | 136 | Histone Octamer (Chicken), Chromosomal Protein Leng | 2e-65 | ||
| 2hio_C | 136 | Histone Octamer (Chicken), Chromosomal Protein Leng | 5e-45 | ||
| 3av1_A | 139 | The Human Nucleosome Structure Containing The Histo | 3e-65 | ||
| 3av1_A | 139 | The Human Nucleosome Structure Containing The Histo | 3e-45 | ||
| 2io5_B | 135 | Crystal Structure Of The Cia- Histone H3-H4 Complex | 3e-65 | ||
| 2io5_B | 135 | Crystal Structure Of The Cia- Histone H3-H4 Complex | 4e-44 | ||
| 3lel_A | 136 | Structural Insight Into The Sequence-Dependence Of | 1e-64 | ||
| 3lel_A | 136 | Structural Insight Into The Sequence-Dependence Of | 4e-45 | ||
| 1kx3_A | 135 | X-Ray Structure Of The Nucleosome Core Particle, Nc | 1e-64 | ||
| 1kx3_A | 135 | X-Ray Structure Of The Nucleosome Core Particle, Nc | 3e-44 | ||
| 2cv5_A | 136 | Crystal Structure Of Human Nucleosome Core Particle | 1e-64 | ||
| 2cv5_A | 136 | Crystal Structure Of Human Nucleosome Core Particle | 7e-45 | ||
| 3afa_A | 139 | The Human Nucleosome Structure Length = 139 | 1e-64 | ||
| 3afa_A | 139 | The Human Nucleosome Structure Length = 139 | 3e-45 | ||
| 3kxb_A | 135 | Structural Characterization Of H3k56q Nucleosomes A | 3e-64 | ||
| 3kxb_A | 135 | Structural Characterization Of H3k56q Nucleosomes A | 6e-44 | ||
| 3azh_A | 139 | Crystal Structure Of Human Nucleosome Core Particle | 4e-64 | ||
| 3azh_A | 139 | Crystal Structure Of Human Nucleosome Core Particle | 3e-45 | ||
| 3azg_A | 139 | Crystal Structure Of Human Nucleosome Core Particle | 4e-64 | ||
| 3azg_A | 139 | Crystal Structure Of Human Nucleosome Core Particle | 3e-45 | ||
| 3azf_A | 139 | Crystal Structure Of Human Nucleosome Core Particle | 4e-64 | ||
| 3azf_A | 139 | Crystal Structure Of Human Nucleosome Core Particle | 8e-45 | ||
| 3aze_A | 139 | Crystal Structure Of Human Nucleosome Core Particle | 4e-64 | ||
| 3aze_A | 139 | Crystal Structure Of Human Nucleosome Core Particle | 8e-45 | ||
| 3ayw_A | 139 | Crystal Structure Of Human Nucleosome Core Particle | 4e-64 | ||
| 3ayw_A | 139 | Crystal Structure Of Human Nucleosome Core Particle | 8e-45 | ||
| 1f66_A | 136 | 2.6 A Crystal Structure Of A Nucleosome Core Partic | 8e-64 | ||
| 1f66_A | 136 | 2.6 A Crystal Structure Of A Nucleosome Core Partic | 3e-44 | ||
| 1zla_A | 135 | X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus L | 1e-63 | ||
| 1zla_A | 135 | X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus L | 3e-44 | ||
| 4hga_B | 136 | Structure Of The Variant Histone H3.3-H4 Heterodime | 2e-63 | ||
| 4hga_B | 136 | Structure Of The Variant Histone H3.3-H4 Heterodime | 3e-44 | ||
| 3av2_A | 139 | The Human Nucleosome Structure Containing The Histo | 3e-63 | ||
| 3av2_A | 139 | The Human Nucleosome Structure Containing The Histo | 1e-44 | ||
| 1m18_A | 135 | Ligand Binding Alters The Structure And Dynamics Of | 4e-63 | ||
| 1m18_A | 135 | Ligand Binding Alters The Structure And Dynamics Of | 7e-43 | ||
| 1p3b_A | 135 | Crystallographic Studies Of Nucleosome Core Particl | 5e-63 | ||
| 1p3b_A | 135 | Crystallographic Studies Of Nucleosome Core Particl | 1e-42 | ||
| 3c1c_A | 135 | The Effect Of H3 K79 Dimethylation And H4 K20 Trime | 5e-63 | ||
| 3c1c_A | 135 | The Effect Of H3 K79 Dimethylation And H4 K20 Trime | 7e-44 | ||
| 3a6n_A | 139 | The Nucleosome Containing A Testis-Specific Histone | 5e-63 | ||
| 3a6n_A | 139 | The Nucleosome Containing A Testis-Specific Histone | 2e-44 | ||
| 1p3k_A | 135 | Crystallographic Studies Of Nucleosome Core Particl | 2e-62 | ||
| 1p3k_A | 135 | Crystallographic Studies Of Nucleosome Core Particl | 1e-42 | ||
| 1p3m_A | 135 | Crystallographic Studies Of Nucleosome Core Particl | 2e-62 | ||
| 1p3m_A | 135 | Crystallographic Studies Of Nucleosome Core Particl | 1e-42 | ||
| 1p3a_A | 135 | Crystallographic Studies Of Nucleosome Core Particl | 2e-62 | ||
| 1p3a_A | 135 | Crystallographic Studies Of Nucleosome Core Particl | 1e-42 | ||
| 1p34_A | 135 | Crystallographic Studies Of Nucleosome Core Particl | 3e-62 | ||
| 1p34_A | 135 | Crystallographic Studies Of Nucleosome Core Particl | 1e-42 | ||
| 1p3l_A | 135 | Crystallographic Studies Of Nucleosome Core Particl | 4e-62 | ||
| 1p3l_A | 135 | Crystallographic Studies Of Nucleosome Core Particl | 2e-42 | ||
| 4h9o_A | 135 | Complex Structure 2 Of DaxxH3.3(SUB5,G90M)H4 Length | 1e-61 | ||
| 4h9o_A | 135 | Complex Structure 2 Of DaxxH3.3(SUB5,G90M)H4 Length | 2e-43 | ||
| 4h9n_A | 135 | Complex Structure 1 Of DaxxH3.3(SUB5)H4 Length = 13 | 2e-60 | ||
| 4h9n_A | 135 | Complex Structure 1 Of DaxxH3.3(SUB5)H4 Length = 13 | 3e-43 | ||
| 4h9s_A | 135 | Complex Structure 6 Of DaxxH3.3(SUB7)H4 Length = 13 | 6e-59 | ||
| 4h9s_A | 135 | Complex Structure 6 Of DaxxH3.3(SUB7)H4 Length = 13 | 6e-42 | ||
| 1id3_A | 135 | Crystal Structure Of The Yeast Nucleosome Core Part | 2e-57 | ||
| 1id3_A | 135 | Crystal Structure Of The Yeast Nucleosome Core Part | 6e-43 | ||
| 1aoi_A | 116 | Complex Between Nucleosome Core Particle (H3,H4,H2a | 5e-56 | ||
| 1aoi_A | 116 | Complex Between Nucleosome Core Particle (H3,H4,H2a | 8e-34 | ||
| 4h9p_A | 135 | Complex Structure 3 Of DaxxH3.3(SUB5,G90A)H4 Length | 1e-54 | ||
| 4h9p_A | 135 | Complex Structure 3 Of DaxxH3.3(SUB5,G90A)H4 Length | 1e-42 | ||
| 3kwq_A | 98 | Structural Characterization Of H3k56q Nucleosomes A | 2e-45 | ||
| 3kwq_A | 98 | Structural Characterization Of H3k56q Nucleosomes A | 2e-23 | ||
| 1hio_C | 93 | Histone Octamer (Chicken), Chromosomal Protein, Alp | 7e-43 | ||
| 1hio_C | 93 | Histone Octamer (Chicken), Chromosomal Protein, Alp | 4e-20 | ||
| 2hue_B | 77 | Structure Of The H3-h4 Chaperone Asf1 Bound To Hist | 1e-31 | ||
| 2hue_B | 77 | Structure Of The H3-h4 Chaperone Asf1 Bound To Hist | 2e-09 | ||
| 4eo5_B | 76 | Yeast Asf1 Bound To H3H4G94P MUTANT Length = 76 | 1e-31 | ||
| 4eo5_B | 76 | Yeast Asf1 Bound To H3H4G94P MUTANT Length = 76 | 2e-09 | ||
| 2yfv_A | 100 | The Heterotrimeric Complex Of Kluyveromyces Lactis | 9e-27 | ||
| 2yfv_A | 100 | The Heterotrimeric Complex Of Kluyveromyces Lactis | 5e-09 | ||
| 2yfw_A | 92 | Heterotetramer Structure Of Kluyveromyces Lactis Cs | 3e-24 | ||
| 2yfw_A | 92 | Heterotetramer Structure Of Kluyveromyces Lactis Cs | 2e-06 | ||
| 2l5a_A | 235 | Structural Basis For Recognition Of Centromere Spec | 1e-20 | ||
| 3an2_A | 143 | The Structure Of The Centromeric Nucleosome Contain | 1e-20 | ||
| 3an2_A | 143 | The Structure Of The Centromeric Nucleosome Contain | 7e-06 | ||
| 3r45_A | 156 | Structure Of A Cenp-A-Histone H4 Heterodimer In Com | 1e-20 | ||
| 3r45_A | 156 | Structure Of A Cenp-A-Histone H4 Heterodimer In Com | 6e-06 | ||
| 3nqu_A | 140 | Crystal Structure Of Partially Trypsinized (Cenp-AH | 1e-20 | ||
| 3nqu_A | 140 | Crystal Structure Of Partially Trypsinized (Cenp-AH | 7e-06 | ||
| 3nqj_A | 82 | Crystal Structure Of (Cenp-AH4)2 HETEROTETRAMER Len | 3e-15 | ||
| 2ly8_A | 121 | The Budding Yeast Chaperone Scm3 Recognizes The Par | 9e-15 | ||
| 2ly8_A | 121 | The Budding Yeast Chaperone Scm3 Recognizes The Par | 9e-15 | ||
| 4ft4_P | 32 | Crystal Structure Of Zea Mays Zmet2 In Complex H3(1 | 1e-08 | ||
| 3n9p_B | 32 | Cekdm7a From C.Elegans, Complex With H3k4me3k27me2 | 9e-08 | ||
| 3n9n_B | 32 | Cekdm7a From C.Elegans, Complex With H3k4me3k9me2 P | 9e-08 | ||
| 4hsu_C | 30 | Crystal Structure Of Lsd2-npac With H3(1-26)in Spac | 1e-07 | ||
| 4gu0_E | 26 | Crystal Structure Of Lsd2 With H3 Length = 26 | 1e-05 | ||
| 3u5p_I | 28 | Crystal Structure Of The Complex Of Trim33 Phd-Brom | 6e-05 | ||
| 2p5b_I | 22 | The Complex Structure Of Jmjd2a And Trimethylated H | 8e-05 | ||
| 2p5b_I | 22 | The Complex Structure Of Jmjd2a And Trimethylated H | 8e-05 | ||
| 2p5b_I | 22 | The Complex Structure Of Jmjd2a And Trimethylated H | 8e-05 | ||
| 2x4w_B | 21 | Molecular Basis Of Histone H3k36me3 Recognition By | 3e-04 | ||
| 2x4w_B | 21 | Molecular Basis Of Histone H3k36me3 Recognition By | 3e-04 | ||
| 2x4w_B | 21 | Molecular Basis Of Histone H3k36me3 Recognition By | 3e-04 | ||
| 3kv4_B | 24 | Structure Of Phf8 In Complex With Histone H3 Length | 3e-04 | ||
| 3a1b_A | 159 | Crystal Structure Of The Dnmt3a Add Domain In Compl | 4e-04 | ||
| 3avr_B | 22 | Catalytic Fragment Of UtxKDM6A BOUND WITH HISTONE H | 6e-04 | ||
| 3avr_B | 22 | Catalytic Fragment Of UtxKDM6A BOUND WITH HISTONE H | 6e-04 | ||
| 3avr_B | 22 | Catalytic Fragment Of UtxKDM6A BOUND WITH HISTONE H | 6e-04 |
| >pdb|2HIO|C Chain C, Histone Octamer (Chicken), Chromosomal Protein Length = 136 | Back alignment and structure |
|
| >pdb|2HIO|C Chain C, Histone Octamer (Chicken), Chromosomal Protein Length = 136 | Back alignment and structure |
| >pdb|3AV1|A Chain A, The Human Nucleosome Structure Containing The Histone Variant H3.2 Length = 139 | Back alignment and structure |
| >pdb|3AV1|A Chain A, The Human Nucleosome Structure Containing The Histone Variant H3.2 Length = 139 | Back alignment and structure |
| >pdb|2IO5|B Chain B, Crystal Structure Of The Cia- Histone H3-H4 Complex Length = 135 | Back alignment and structure |
| >pdb|2IO5|B Chain B, Crystal Structure Of The Cia- Histone H3-H4 Complex Length = 135 | Back alignment and structure |
| >pdb|3LEL|A Chain A, Structural Insight Into The Sequence-Dependence Of Nucleosom Positioning Length = 136 | Back alignment and structure |
| >pdb|3LEL|A Chain A, Structural Insight Into The Sequence-Dependence Of Nucleosom Positioning Length = 136 | Back alignment and structure |
| >pdb|1KX3|A Chain A, X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution Length = 135 | Back alignment and structure |
| >pdb|1KX3|A Chain A, X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution Length = 135 | Back alignment and structure |
| >pdb|2CV5|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Length = 136 | Back alignment and structure |
| >pdb|2CV5|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Length = 136 | Back alignment and structure |
| >pdb|3AFA|A Chain A, The Human Nucleosome Structure Length = 139 | Back alignment and structure |
| >pdb|3AFA|A Chain A, The Human Nucleosome Structure Length = 139 | Back alignment and structure |
| >pdb|3KXB|A Chain A, Structural Characterization Of H3k56q Nucleosomes And Nucleosomal Arrays Length = 135 | Back alignment and structure |
| >pdb|3KXB|A Chain A, Structural Characterization Of H3k56q Nucleosomes And Nucleosomal Arrays Length = 135 | Back alignment and structure |
| >pdb|3AZH|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k122q Mutation Length = 139 | Back alignment and structure |
| >pdb|3AZH|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k122q Mutation Length = 139 | Back alignment and structure |
| >pdb|3AZG|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k115q Mutation Length = 139 | Back alignment and structure |
| >pdb|3AZG|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k115q Mutation Length = 139 | Back alignment and structure |
| >pdb|3AZF|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k79q Mutation Length = 139 | Back alignment and structure |
| >pdb|3AZF|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k79q Mutation Length = 139 | Back alignment and structure |
| >pdb|3AZE|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k64q Mutation Length = 139 | Back alignment and structure |
| >pdb|3AZE|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k64q Mutation Length = 139 | Back alignment and structure |
| >pdb|3AYW|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k56q Mutation Length = 139 | Back alignment and structure |
| >pdb|3AYW|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k56q Mutation Length = 139 | Back alignment and structure |
| >pdb|1F66|A Chain A, 2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2a.Z Length = 136 | Back alignment and structure |
| >pdb|1F66|A Chain A, 2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2a.Z Length = 136 | Back alignment and structure |
| >pdb|1ZLA|A Chain A, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana Peptide Bound To The Nucleosomal Core Length = 135 | Back alignment and structure |
| >pdb|1ZLA|A Chain A, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana Peptide Bound To The Nucleosomal Core Length = 135 | Back alignment and structure |
| >pdb|4HGA|B Chain B, Structure Of The Variant Histone H3.3-H4 Heterodimer In Complex With Its Chaperone Daxx Length = 136 | Back alignment and structure |
| >pdb|4HGA|B Chain B, Structure Of The Variant Histone H3.3-H4 Heterodimer In Complex With Its Chaperone Daxx Length = 136 | Back alignment and structure |
| >pdb|3AV2|A Chain A, The Human Nucleosome Structure Containing The Histone Variant H3.3 Length = 139 | Back alignment and structure |
| >pdb|3AV2|A Chain A, The Human Nucleosome Structure Containing The Histone Variant H3.3 Length = 139 | Back alignment and structure |
| >pdb|1M18|A Chain A, Ligand Binding Alters The Structure And Dynamics Of Nucleosomal Dna Length = 135 | Back alignment and structure |
| >pdb|1M18|A Chain A, Ligand Binding Alters The Structure And Dynamics Of Nucleosomal Dna Length = 135 | Back alignment and structure |
| >pdb|1P3B|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 | Back alignment and structure |
| >pdb|1P3B|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 | Back alignment and structure |
| >pdb|3C1C|A Chain A, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation On Nucleosome And Chromatin Structure Length = 135 | Back alignment and structure |
| >pdb|3C1C|A Chain A, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation On Nucleosome And Chromatin Structure Length = 135 | Back alignment and structure |
| >pdb|3A6N|A Chain A, The Nucleosome Containing A Testis-Specific Histone Variant, Human H3t Length = 139 | Back alignment and structure |
| >pdb|3A6N|A Chain A, The Nucleosome Containing A Testis-Specific Histone Variant, Human H3t Length = 139 | Back alignment and structure |
| >pdb|1P3K|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 | Back alignment and structure |
| >pdb|1P3K|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 | Back alignment and structure |
| >pdb|1P3M|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 | Back alignment and structure |
| >pdb|1P3M|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 | Back alignment and structure |
| >pdb|1P3A|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 | Back alignment and structure |
| >pdb|1P3A|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 | Back alignment and structure |
| >pdb|1P34|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 | Back alignment and structure |
| >pdb|1P34|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 | Back alignment and structure |
| >pdb|1P3L|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 | Back alignment and structure |
| >pdb|1P3L|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 | Back alignment and structure |
| >pdb|4H9O|A Chain A, Complex Structure 2 Of DaxxH3.3(SUB5,G90M)H4 Length = 135 | Back alignment and structure |
| >pdb|4H9O|A Chain A, Complex Structure 2 Of DaxxH3.3(SUB5,G90M)H4 Length = 135 | Back alignment and structure |
| >pdb|4H9N|A Chain A, Complex Structure 1 Of DaxxH3.3(SUB5)H4 Length = 135 | Back alignment and structure |
| >pdb|4H9N|A Chain A, Complex Structure 1 Of DaxxH3.3(SUB5)H4 Length = 135 | Back alignment and structure |
| >pdb|4H9S|A Chain A, Complex Structure 6 Of DaxxH3.3(SUB7)H4 Length = 135 | Back alignment and structure |
| >pdb|4H9S|A Chain A, Complex Structure 6 Of DaxxH3.3(SUB7)H4 Length = 135 | Back alignment and structure |
| >pdb|1ID3|A Chain A, Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental Differences In Inter-Nucleosome Interactions Length = 135 | Back alignment and structure |
| >pdb|1ID3|A Chain A, Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental Differences In Inter-Nucleosome Interactions Length = 135 | Back alignment and structure |
| >pdb|1AOI|A Chain A, Complex Between Nucleosome Core Particle (H3,H4,H2a,H2b) And 146 Bp Long Dna Fragment Length = 116 | Back alignment and structure |
| >pdb|1AOI|A Chain A, Complex Between Nucleosome Core Particle (H3,H4,H2a,H2b) And 146 Bp Long Dna Fragment Length = 116 | Back alignment and structure |
| >pdb|4H9P|A Chain A, Complex Structure 3 Of DaxxH3.3(SUB5,G90A)H4 Length = 135 | Back alignment and structure |
| >pdb|4H9P|A Chain A, Complex Structure 3 Of DaxxH3.3(SUB5,G90A)H4 Length = 135 | Back alignment and structure |
| >pdb|3KWQ|A Chain A, Structural Characterization Of H3k56q Nucleosomes And Nucleo Arrays Length = 98 | Back alignment and structure |
| >pdb|3KWQ|A Chain A, Structural Characterization Of H3k56q Nucleosomes And Nucleo Arrays Length = 98 | Back alignment and structure |
| >pdb|1HIO|C Chain C, Histone Octamer (Chicken), Chromosomal Protein, Alpha Carbons Only Length = 93 | Back alignment and structure |
| >pdb|1HIO|C Chain C, Histone Octamer (Chicken), Chromosomal Protein, Alpha Carbons Only Length = 93 | Back alignment and structure |
| >pdb|2HUE|B Chain B, Structure Of The H3-h4 Chaperone Asf1 Bound To Histones H3 And H4 Length = 77 | Back alignment and structure |
| >pdb|2HUE|B Chain B, Structure Of The H3-h4 Chaperone Asf1 Bound To Histones H3 And H4 Length = 77 | Back alignment and structure |
| >pdb|4EO5|B Chain B, Yeast Asf1 Bound To H3H4G94P MUTANT Length = 76 | Back alignment and structure |
| >pdb|4EO5|B Chain B, Yeast Asf1 Bound To H3H4G94P MUTANT Length = 76 | Back alignment and structure |
| >pdb|2YFV|A Chain A, The Heterotrimeric Complex Of Kluyveromyces Lactis Scm3, Cse4 And H4 Length = 100 | Back alignment and structure |
| >pdb|2YFV|A Chain A, The Heterotrimeric Complex Of Kluyveromyces Lactis Scm3, Cse4 And H4 Length = 100 | Back alignment and structure |
| >pdb|2YFW|A Chain A, Heterotetramer Structure Of Kluyveromyces Lactis Cse4,H4 Length = 92 | Back alignment and structure |
| >pdb|2YFW|A Chain A, Heterotetramer Structure Of Kluyveromyces Lactis Cse4,H4 Length = 92 | Back alignment and structure |
| >pdb|2L5A|A Chain A, Structural Basis For Recognition Of Centromere Specific Histone H3 Variant By Nonhistone Scm3 Length = 235 | Back alignment and structure |
| >pdb|3AN2|A Chain A, The Structure Of The Centromeric Nucleosome Containing Cenp-A Length = 143 | Back alignment and structure |
| >pdb|3AN2|A Chain A, The Structure Of The Centromeric Nucleosome Containing Cenp-A Length = 143 | Back alignment and structure |
| >pdb|3R45|A Chain A, Structure Of A Cenp-A-Histone H4 Heterodimer In Complex With Chaperone Hjurp Length = 156 | Back alignment and structure |
| >pdb|3R45|A Chain A, Structure Of A Cenp-A-Histone H4 Heterodimer In Complex With Chaperone Hjurp Length = 156 | Back alignment and structure |
| >pdb|3NQU|A Chain A, Crystal Structure Of Partially Trypsinized (Cenp-AH4)2 HETEROTETRAMER Length = 140 | Back alignment and structure |
| >pdb|3NQU|A Chain A, Crystal Structure Of Partially Trypsinized (Cenp-AH4)2 HETEROTETRAMER Length = 140 | Back alignment and structure |
| >pdb|3NQJ|A Chain A, Crystal Structure Of (Cenp-AH4)2 HETEROTETRAMER Length = 82 | Back alignment and structure |
| >pdb|2LY8|A Chain A, The Budding Yeast Chaperone Scm3 Recognizes The Partially Unfolded Dimer Of The Centromere-specific Cse4/h4 Histone Variant Length = 121 | Back alignment and structure |
| >pdb|2LY8|A Chain A, The Budding Yeast Chaperone Scm3 Recognizes The Partially Unfolded Dimer Of The Centromere-specific Cse4/h4 Histone Variant Length = 121 | Back alignment and structure |
| >pdb|4FT4|P Chain P, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-32)k9me2 Peptide And Sah Length = 32 | Back alignment and structure |
| >pdb|3N9P|B Chain B, Cekdm7a From C.Elegans, Complex With H3k4me3k27me2 Peptide And Nog Length = 32 | Back alignment and structure |
| >pdb|3N9N|B Chain B, Cekdm7a From C.Elegans, Complex With H3k4me3k9me2 Peptide And Nog Length = 32 | Back alignment and structure |
| >pdb|4HSU|C Chain C, Crystal Structure Of Lsd2-npac With H3(1-26)in Space Group P21 Length = 30 | Back alignment and structure |
| >pdb|4GU0|E Chain E, Crystal Structure Of Lsd2 With H3 Length = 26 | Back alignment and structure |
| >pdb|3U5P|I Chain I, Crystal Structure Of The Complex Of Trim33 Phd-Bromo And H3(1-28) K9me3k14ack18ack23ac Histone Peptide Length = 28 | Back alignment and structure |
| >pdb|2P5B|I Chain I, The Complex Structure Of Jmjd2a And Trimethylated H3k36 Peptide Length = 22 | Back alignment and structure |
| >pdb|2P5B|I Chain I, The Complex Structure Of Jmjd2a And Trimethylated H3k36 Peptide Length = 22 | Back alignment and structure |
| >pdb|2P5B|I Chain I, The Complex Structure Of Jmjd2a And Trimethylated H3k36 Peptide Length = 22 | Back alignment and structure |
| >pdb|2X4W|B Chain B, Molecular Basis Of Histone H3k36me3 Recognition By The Pwwp Domain Of Brpf1. Length = 21 | Back alignment and structure |
| >pdb|2X4W|B Chain B, Molecular Basis Of Histone H3k36me3 Recognition By The Pwwp Domain Of Brpf1. Length = 21 | Back alignment and structure |
| >pdb|2X4W|B Chain B, Molecular Basis Of Histone H3k36me3 Recognition By The Pwwp Domain Of Brpf1. Length = 21 | Back alignment and structure |
| >pdb|3KV4|B Chain B, Structure Of Phf8 In Complex With Histone H3 Length = 24 | Back alignment and structure |
| >pdb|3A1B|A Chain A, Crystal Structure Of The Dnmt3a Add Domain In Complex With Histone H3 Length = 159 | Back alignment and structure |
| >pdb|3AVR|B Chain B, Catalytic Fragment Of UtxKDM6A BOUND WITH HISTONE H3K27ME3 PEPTIDE, N-Oxyalylglycine, And Ni(Ii) Length = 22 | Back alignment and structure |
| >pdb|3AVR|B Chain B, Catalytic Fragment Of UtxKDM6A BOUND WITH HISTONE H3K27ME3 PEPTIDE, N-Oxyalylglycine, And Ni(Ii) Length = 22 | Back alignment and structure |
| >pdb|3AVR|B Chain B, Catalytic Fragment Of UtxKDM6A BOUND WITH HISTONE H3K27ME3 PEPTIDE, N-Oxyalylglycine, And Ni(Ii) Length = 22 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 340 | |||
| 1tzy_C | 136 | Histone H3; histone-fold, tetramer-dimer-dimer, DN | 2e-34 | |
| 1tzy_C | 136 | Histone H3; histone-fold, tetramer-dimer-dimer, DN | 3e-28 | |
| 1tzy_C | 136 | Histone H3; histone-fold, tetramer-dimer-dimer, DN | 8e-22 | |
| 2yfv_A | 100 | Histone H3-like centromeric protein CSE4; cell cyc | 5e-32 | |
| 2yfv_A | 100 | Histone H3-like centromeric protein CSE4; cell cyc | 2e-26 | |
| 2yfv_A | 100 | Histone H3-like centromeric protein CSE4; cell cyc | 4e-15 | |
| 2hue_B | 77 | Histone H3; mini beta sheet, elongated beta sandwh | 2e-30 | |
| 2hue_B | 77 | Histone H3; mini beta sheet, elongated beta sandwh | 4e-24 | |
| 2hue_B | 77 | Histone H3; mini beta sheet, elongated beta sandwh | 3e-10 | |
| 3nqu_A | 140 | Histone H3-like centromeric protein A; alpha helix | 9e-30 | |
| 3nqu_A | 140 | Histone H3-like centromeric protein A; alpha helix | 1e-24 | |
| 3nqu_A | 140 | Histone H3-like centromeric protein A; alpha helix | 6e-16 | |
| 3r45_A | 156 | Histone H3-like centromeric protein A; histone fol | 4e-26 | |
| 3r45_A | 156 | Histone H3-like centromeric protein A; histone fol | 6e-21 | |
| 3r45_A | 156 | Histone H3-like centromeric protein A; histone fol | 9e-16 | |
| 2l5a_A | 235 | Histone H3-like centromeric protein CSE4, protein | 5e-25 | |
| 2l5a_A | 235 | Histone H3-like centromeric protein CSE4, protein | 5e-24 | |
| 3nqj_A | 82 | Histone H3-like centromeric protein A; alpha helix | 8e-25 | |
| 3nqj_A | 82 | Histone H3-like centromeric protein A; alpha helix | 1e-18 | |
| 3nqj_A | 82 | Histone H3-like centromeric protein A; alpha helix | 2e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-06 | |
| 2x4w_B | 26 | Histone H3.2; transcription, metal-binding, zinc-f | 2e-05 | |
| 2x4w_B | 26 | Histone H3.2; transcription, metal-binding, zinc-f | 2e-05 | |
| 2x4w_B | 26 | Histone H3.2; transcription, metal-binding, zinc-f | 2e-05 | |
| 3avr_B | 26 | Histone H3; cupin superfamily, TRI/dimethyllysine | 5e-04 | |
| 3avr_B | 26 | Histone H3; cupin superfamily, TRI/dimethyllysine | 5e-04 | |
| 3avr_B | 26 | Histone H3; cupin superfamily, TRI/dimethyllysine | 5e-04 |
| >1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... Length = 136 | Back alignment and structure |
|---|
Score = 122 bits (305), Expect = 2e-34
Identities = 120/122 (98%), Positives = 121/122 (99%)
Query: 110 KRTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIR 169
K+TARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIR
Sbjct: 5 KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIR 64
Query: 170 KLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKD 229
KLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKD
Sbjct: 65 KLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKD 124
Query: 230 IH 231
I
Sbjct: 125 IQ 126
|
| >1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... Length = 136 | Back alignment and structure |
|---|
| >1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... Length = 136 | Back alignment and structure |
|---|
| >2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A Length = 100 | Back alignment and structure |
|---|
| >2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A Length = 100 | Back alignment and structure |
|---|
| >2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A Length = 100 | Back alignment and structure |
|---|
| >2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} Length = 77 | Back alignment and structure |
|---|
| >2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} Length = 77 | Back alignment and structure |
|---|
| >2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} Length = 77 | Back alignment and structure |
|---|
| >3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A Length = 140 | Back alignment and structure |
|---|
| >3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A Length = 140 | Back alignment and structure |
|---|
| >3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A Length = 140 | Back alignment and structure |
|---|
| >3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} Length = 156 | Back alignment and structure |
|---|
| >3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} Length = 156 | Back alignment and structure |
|---|
| >3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} Length = 156 | Back alignment and structure |
|---|
| >2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Length = 235 | Back alignment and structure |
|---|
| >2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Length = 235 | Back alignment and structure |
|---|
| >3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2x4w_B Histone H3.2; transcription, metal-binding, zinc-finger, chromatin regulator, transcription regulation; HET: M3L; 1.50A {Homo sapiens} PDB: 2x4x_B* 2x4y_B* Length = 26 | Back alignment and structure |
|---|
| >2x4w_B Histone H3.2; transcription, metal-binding, zinc-finger, chromatin regulator, transcription regulation; HET: M3L; 1.50A {Homo sapiens} PDB: 2x4x_B* 2x4y_B* Length = 26 | Back alignment and structure |
|---|
| >2x4w_B Histone H3.2; transcription, metal-binding, zinc-finger, chromatin regulator, transcription regulation; HET: M3L; 1.50A {Homo sapiens} PDB: 2x4x_B* 2x4y_B* Length = 26 | Back alignment and structure |
|---|
| >3avr_B Histone H3; cupin superfamily, TRI/dimethyllysine demethylase, oxidoredu structural protein complex; HET: M3L OGA EDO; 1.80A {Homo sapiens} Length = 26 | Back alignment and structure |
|---|
| >3avr_B Histone H3; cupin superfamily, TRI/dimethyllysine demethylase, oxidoredu structural protein complex; HET: M3L OGA EDO; 1.80A {Homo sapiens} Length = 26 | Back alignment and structure |
|---|
| >3avr_B Histone H3; cupin superfamily, TRI/dimethyllysine demethylase, oxidoredu structural protein complex; HET: M3L OGA EDO; 1.80A {Homo sapiens} Length = 26 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 340 | |||
| 1tzy_C | 136 | Histone H3; histone-fold, tetramer-dimer-dimer, DN | 100.0 | |
| 2yfv_A | 100 | Histone H3-like centromeric protein CSE4; cell cyc | 100.0 | |
| 3r45_A | 156 | Histone H3-like centromeric protein A; histone fol | 100.0 | |
| 3nqu_A | 140 | Histone H3-like centromeric protein A; alpha helix | 100.0 | |
| 1tzy_C | 136 | Histone H3; histone-fold, tetramer-dimer-dimer, DN | 100.0 | |
| 2yfv_A | 100 | Histone H3-like centromeric protein CSE4; cell cyc | 100.0 | |
| 3r45_A | 156 | Histone H3-like centromeric protein A; histone fol | 100.0 | |
| 3nqu_A | 140 | Histone H3-like centromeric protein A; alpha helix | 100.0 | |
| 2hue_B | 77 | Histone H3; mini beta sheet, elongated beta sandwh | 100.0 | |
| 3nqj_A | 82 | Histone H3-like centromeric protein A; alpha helix | 99.97 | |
| 2l5a_A | 235 | Histone H3-like centromeric protein CSE4, protein | 99.97 | |
| 2ly8_A | 121 | Budding yeast chaperone SCM3; centromere protein, | 99.95 | |
| 2l5a_A | 235 | Histone H3-like centromeric protein CSE4, protein | 99.95 | |
| 2hue_B | 77 | Histone H3; mini beta sheet, elongated beta sandwh | 99.92 | |
| 3nqj_A | 82 | Histone H3-like centromeric protein A; alpha helix | 99.92 | |
| 2ly8_A | 121 | Budding yeast chaperone SCM3; centromere protein, | 99.89 | |
| 1b67_A | 68 | Protein (histone HMFA); DNA binding protein; 1.48A | 99.7 | |
| 1ku5_A | 70 | HPHA, archaeal histon; histone fold, DNA binding p | 99.48 | |
| 1n1j_A | 93 | NF-YB; histone-like PAIR, DNA binding protein; 1.6 | 99.34 | |
| 1b67_A | 68 | Protein (histone HMFA); DNA binding protein; 1.48A | 99.33 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 99.12 | |
| 1f1e_A | 154 | Histone fold protein; archaeal histone protein, DN | 98.99 | |
| 1ku5_A | 70 | HPHA, archaeal histon; histone fold, DNA binding p | 98.92 | |
| 1n1j_A | 93 | NF-YB; histone-like PAIR, DNA binding protein; 1.6 | 98.76 | |
| 2x4w_B | 26 | Histone H3.2; transcription, metal-binding, zinc-f | 98.53 | |
| 2yfw_B | 103 | Histone H4, H4; cell cycle, kinetochore, centromer | 98.01 | |
| 1tzy_D | 103 | Histone H4-VI; histone-fold, tetramer-dimer-dimer, | 98.0 | |
| 1id3_B | 102 | Histone H4; nucleosome core particle, chromatin, p | 97.96 | |
| 3b0c_T | 111 | CENP-T, centromere protein T; histone fold, DNA bi | 97.96 | |
| 2hue_C | 84 | Histone H4; mini beta sheet, elongated beta sandwh | 97.86 | |
| 3b0c_W | 76 | CENP-W, centromere protein W; histone fold, DNA bi | 97.75 | |
| 2byk_B | 128 | Chrac-14; nucleosome sliding, histone fold, DNA-bi | 97.63 | |
| 4dra_A | 113 | Centromere protein S; DNA binding complex, DNA dam | 97.61 | |
| 3v9r_A | 90 | MHF1, uncharacterized protein YOL086W-A; histone f | 97.58 | |
| 1f1e_A | 154 | Histone fold protein; archaeal histone protein, DN | 97.53 | |
| 1jfi_B | 179 | DR1 protein, transcription regulator NC2 beta chai | 97.51 | |
| 3vh5_A | 140 | CENP-S; histone fold, chromosome segregation, DNA | 97.45 | |
| 1taf_A | 68 | TFIID TBP associated factor 42; transcription init | 97.43 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 97.36 | |
| 3avr_B | 26 | Histone H3; cupin superfamily, TRI/dimethyllysine | 97.35 | |
| 3b0b_B | 107 | CENP-S, centromere protein S; histone fold, DNA bi | 97.34 | |
| 1n1j_B | 97 | NF-YC; histone-like PAIR, DNA binding protein; 1.6 | 97.29 | |
| 1taf_B | 70 | TFIID TBP associated factor 62; transcription init | 97.2 | |
| 4g92_C | 119 | HAPE; transcription factor, nucleosome, minor groo | 97.17 | |
| 2jss_A | 192 | Chimera of histone H2B.1 and histone H2A.Z; histon | 96.7 | |
| 1h3o_B | 76 | Transcription initiation factor TFIID 20/15 kDa su | 96.45 | |
| 2x4w_B | 26 | Histone H3.2; transcription, metal-binding, zinc-f | 96.42 | |
| 1jfi_A | 98 | Transcription regulator NC2 alpha chain; histone, | 96.34 | |
| 2byk_A | 140 | Chrac-16; nucleosome sliding, histone fold, DNA-bi | 96.06 | |
| 2k3y_A | 136 | Chromatin modification-related protein EAF3; dimet | 95.97 | |
| 1id3_B | 102 | Histone H4; nucleosome core particle, chromatin, p | 95.61 | |
| 2hue_C | 84 | Histone H4; mini beta sheet, elongated beta sandwh | 95.27 | |
| 3b0c_T | 111 | CENP-T, centromere protein T; histone fold, DNA bi | 95.08 | |
| 1tzy_D | 103 | Histone H4-VI; histone-fold, tetramer-dimer-dimer, | 95.03 | |
| 2nqb_D | 123 | Histone H2B; nucleosome, NCP, chromatin, structura | 94.88 | |
| 2yfw_B | 103 | Histone H4, H4; cell cycle, kinetochore, centromer | 94.84 | |
| 1tzy_B | 126 | Histone H2B; histone-fold, tetramer-dimer-dimer, D | 94.79 | |
| 3a1b_A | 159 | DNA (cytosine-5)-methyltransferase 3A, histone H3; | 94.74 | |
| 2nqb_C | 123 | Histone H2A; nucleosome, NCP, chromatin, structura | 94.42 | |
| 1tzy_A | 129 | Histone H2A-IV; histone-fold, tetramer-dimer-dimer | 94.19 | |
| 2f8n_G | 120 | Core histone macro-H2A.1; nucleosome, NCP, macroh2 | 94.18 | |
| 2byk_B | 128 | Chrac-14; nucleosome sliding, histone fold, DNA-bi | 94.09 | |
| 3b0c_W | 76 | CENP-W, centromere protein W; histone fold, DNA bi | 94.03 | |
| 1jfi_B | 179 | DR1 protein, transcription regulator NC2 beta chai | 93.87 | |
| 2f8n_K | 149 | Histone H2A type 1; nucleosome, NCP, macroh2A, his | 93.76 | |
| 1id3_C | 131 | Histone H2A.1; nucleosome core particle, chromatin | 93.64 | |
| 1f66_C | 128 | Histone H2A.Z; nucleosome, chromatin, histone vari | 93.19 | |
| 2jss_A | 192 | Chimera of histone H2B.1 and histone H2A.Z; histon | 91.65 | |
| 1taf_A | 68 | TFIID TBP associated factor 42; transcription init | 91.58 | |
| 3v9r_A | 90 | MHF1, uncharacterized protein YOL086W-A; histone f | 91.08 | |
| 4dra_A | 113 | Centromere protein S; DNA binding complex, DNA dam | 90.86 | |
| 3b0b_B | 107 | CENP-S, centromere protein S; histone fold, DNA bi | 89.62 | |
| 3vh5_A | 140 | CENP-S; histone fold, chromosome segregation, DNA | 87.86 | |
| 1taf_B | 70 | TFIID TBP associated factor 62; transcription init | 87.65 | |
| 4g92_C | 119 | HAPE; transcription factor, nucleosome, minor groo | 86.63 | |
| 1n1j_B | 97 | NF-YC; histone-like PAIR, DNA binding protein; 1.6 | 84.76 |
| >1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... | Back alignment and structure |
|---|
Probab=100.00 E-value=1.9e-50 Score=348.75 Aligned_cols=132 Identities=91% Similarity=1.245 Sum_probs=91.8
Q ss_pred cccccccccCCCCCCcchhhhhhhcCCCCCCCCCCCCCcCCCCchhhHHHHhhhhhhhhhccCCchhHHHHHHHHhcccc
Q psy2783 108 HAKRTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTD 187 (340)
Q Consensus 108 HakRvtrKs~~~kAPRKqlAsk~~~ks~~~~~~~~~~~r~rpg~~alrEIr~yQkst~lLIpk~pF~RLVrEI~~~~~~~ 187 (340)
+.|..+++++|+++|+++++.+.++++.|.+++.++++||+||+++|+|||+||+||+|||||+||+||||||+++|.++
T Consensus 3 Rtk~tarkstggkaprk~l~~k~a~k~~p~~~~~kk~~r~rpgt~alrEIr~yQkst~lLIpk~PF~RLVREI~~~~~~~ 82 (136)
T 1tzy_C 3 RTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTD 82 (136)
T ss_dssp ---------------------------------------CCHHHHHHHHHHHHHHCCSCCSCHHHHHHHHHHHHHHHCTT
T ss_pred CCccccccCCCCCCCCccccccccccCCCCCCCCCCCCCCCCchhHHHHHHHhhcchhhhhccchHHHHHHHHHHHhhhh
Confidence 57888999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccccHHHHHHHHHHHHHHHHHhhhchhhhhccCCceecCCCCcchhhhhhcc
Q psy2783 188 LRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIHWPSQWCDN 239 (340)
Q Consensus 188 ~rfq~~Al~ALQeAaEa~Lv~lFeda~lca~HakRVTl~~kDm~L~~~i~~~ 239 (340)
+|||++||+|||||+|+|||+||||+|+||+||+|||||++||||+.+|+++
T Consensus 83 ~R~q~~Al~aLQeaaEayLv~Lfeda~l~A~HAkRvTi~~kDiqLa~rirg~ 134 (136)
T 1tzy_C 83 LRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE 134 (136)
T ss_dssp CEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEECHHHHHHHHHHHTC
T ss_pred hcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCccCcHHhHHHHHHHhCc
Confidence 9999999999999999999999999999999999999999999999999875
|
| >2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A | Back alignment and structure |
|---|
| >3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A | Back alignment and structure |
|---|
| >1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... | Back alignment and structure |
|---|
| >2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A | Back alignment and structure |
|---|
| >3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A | Back alignment and structure |
|---|
| >2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} | Back alignment and structure |
|---|
| >3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} | Back alignment and structure |
|---|
| >3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A | Back alignment and structure |
|---|
| >1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* | Back alignment and structure |
|---|
| >1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} | Back alignment and structure |
|---|
| >1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... | Back alignment and structure |
|---|
| >1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T | Back alignment and structure |
|---|
| >2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B | Back alignment and structure |
|---|
| >3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W | Back alignment and structure |
|---|
| >2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B | Back alignment and structure |
|---|
| >4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A | Back alignment and structure |
|---|
| >3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A | Back alignment and structure |
|---|
| >1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* | Back alignment and structure |
|---|
| >3b0b_B CENP-S, centromere protein S; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} | Back alignment and structure |
|---|
| >1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* | Back alignment and structure |
|---|
| >2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 | Back alignment and structure |
|---|
| >1h3o_B Transcription initiation factor TFIID 20/15 kDa subunits; transcription/TBP-associated factors, TBP-associated factors; 2.3A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A | Back alignment and structure |
|---|
| >2k3y_A Chromatin modification-related protein EAF3; dimethylated histone H3K36, EAF3-H3K36ME2 fusion, chromo barrel domain, histone deacetylase; HET: M2L; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B | Back alignment and structure |
|---|
| >3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T | Back alignment and structure |
|---|
| >1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... | Back alignment and structure |
|---|
| >2nqb_D Histone H2B; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_D* | Back alignment and structure |
|---|
| >2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} | Back alignment and structure |
|---|
| >1tzy_B Histone H2B; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_B 1hq3_B 2aro_B 2hio_B 3c9k_B 3azg_D 3a6n_D 3an2_D 3av1_D 3av2_D 3ayw_D 3aze_D 3azf_D 3afa_D 3azh_D 3azi_D 3azj_D 3azk_D 3azl_D 3azm_D ... | Back alignment and structure |
|---|
| >3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* | Back alignment and structure |
|---|
| >2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* | Back alignment and structure |
|---|
| >1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... | Back alignment and structure |
|---|
| >2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C | Back alignment and structure |
|---|
| >2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B | Back alignment and structure |
|---|
| >3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W | Back alignment and structure |
|---|
| >1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 | Back alignment and structure |
|---|
| >1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A | Back alignment and structure |
|---|
| >3b0b_B CENP-S, centromere protein S; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} | Back alignment and structure |
|---|
| >3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A | Back alignment and structure |
|---|
| >1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* | Back alignment and structure |
|---|
| >1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 340 | ||||
| d1tzyc_ | 95 | a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), | 3e-47 | |
| d1tzyc_ | 95 | a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), | 1e-40 | |
| d1tzyc_ | 95 | a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), | 8e-23 | |
| d1f1ea_ | 151 | a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy | 2e-08 | |
| d1ku5a_ | 66 | a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococc | 1e-04 | |
| d1htaa_ | 68 | a.22.1.2 (A:) Archaeal histone {Archaeon Methanoth | 0.001 | |
| d1n1ja_ | 87 | a.22.1.3 (A:) Nuclear transcription factor Y subun | 0.002 |
| >d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Length = 95 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Histone-fold superfamily: Histone-fold family: Nucleosome core histones domain: Histone H3 species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]
Score = 152 bits (386), Expect = 3e-47
Identities = 84/85 (98%), Positives = 84/85 (98%)
Query: 147 YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYL 206
YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYL
Sbjct: 1 YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYL 60
Query: 207 VGLFEDTNLCAIHAKRVTIMPKDIH 231
VGLFEDTNLCAIHAKRVTIMPKDI
Sbjct: 61 VGLFEDTNLCAIHAKRVTIMPKDIQ 85
|
| >d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Length = 95 | Back information, alignment and structure |
|---|
| >d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Length = 95 | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 | Back information, alignment and structure |
|---|
| >d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Length = 66 | Back information, alignment and structure |
|---|
| >d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Length = 68 | Back information, alignment and structure |
|---|
| >d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 340 | |||
| d1tzyc_ | 95 | Histone H3 {Chicken (Gallus gallus), erythrocytes | 100.0 | |
| d1tzyc_ | 95 | Histone H3 {Chicken (Gallus gallus), erythrocytes | 100.0 | |
| d1f1ea_ | 151 | Archaeal histone {Archaeon Methanopyrus kandleri [ | 99.34 | |
| d1htaa_ | 68 | Archaeal histone {Archaeon Methanothermus fervidus | 98.51 | |
| d1ku5a_ | 66 | Archaeal histone {Archaeon (Pyrococcus horikoshii) | 98.39 | |
| d1n1ja_ | 87 | Nuclear transcription factor Y subunit beta (Nf-Yb | 97.84 | |
| d1f1ea_ | 151 | Archaeal histone {Archaeon Methanopyrus kandleri [ | 97.77 | |
| d1jfib_ | 135 | Negative cofactor 2, NC2, beta chain {Human (Homo | 97.32 | |
| d1n1jb_ | 78 | Nuclear transcription factor Y subunit gamma (Nf-Y | 97.24 | |
| d2huec1 | 82 | Histone H4 {African clawed frog (Xenopus laevis) [ | 97.21 | |
| d1jfia_ | 66 | Negative cofactor 2, NC2, alpha chain {Human (Homo | 97.11 | |
| d1htaa_ | 68 | Archaeal histone {Archaeon Methanothermus fervidus | 97.11 | |
| d2bykb1 | 89 | Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax | 97.01 | |
| d1ku5a_ | 66 | Archaeal histone {Archaeon (Pyrococcus horikoshii) | 96.87 | |
| d1q9ca_ | 172 | Histone domain of Son of sevenless protein {Human | 96.39 | |
| d1h3ob_ | 74 | TAF(II)-20, (TAF(II)-15, hTAF12), histone fold dom | 95.76 | |
| d1n1ja_ | 87 | Nuclear transcription factor Y subunit beta (Nf-Yb | 95.59 | |
| d1tafa_ | 68 | TAF(II)42 {Fruit fly (Drosophila melanogaster) [Ta | 94.38 | |
| d1tafb_ | 70 | TAF(II)62 {Fruit fly (Drosophila melanogaster) [Ta | 94.24 | |
| d1jfib_ | 135 | Negative cofactor 2, NC2, beta chain {Human (Homo | 92.82 | |
| d1n1jb_ | 78 | Nuclear transcription factor Y subunit gamma (Nf-Y | 90.84 | |
| d1tzyb_ | 92 | Histone H2B {Chicken (Gallus gallus), erythrocytes | 89.48 | |
| d2huec1 | 82 | Histone H4 {African clawed frog (Xenopus laevis) [ | 87.96 | |
| d2bykb1 | 89 | Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax | 86.87 | |
| d1jfia_ | 66 | Negative cofactor 2, NC2, alpha chain {Human (Homo | 85.17 | |
| d2byka1 | 72 | Chrac-16 {Fruit fly (Drosophila melanogaster) [Tax | 83.8 |
| >d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Histone-fold superfamily: Histone-fold family: Nucleosome core histones domain: Histone H3 species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]
Probab=100.00 E-value=2.9e-44 Score=291.66 Aligned_cols=93 Identities=90% Similarity=1.253 Sum_probs=91.7
Q ss_pred CCCCchhhHHHHhhhhhhhhhccCCchhHHHHHHHHhccccccccHHHHHHHHHHHHHHHHHhhhchhhhhccCCceecC
Q psy2783 147 YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIM 226 (340)
Q Consensus 147 ~rpg~~alrEIr~yQkst~lLIpk~pF~RLVrEI~~~~~~~~rfq~~Al~ALQeAaEa~Lv~lFeda~lca~HakRVTl~ 226 (340)
||||++||+|||+||+||++||||+||+||||||++++++++|||++||+|||||+|+|||+||||||+||+|+||||||
T Consensus 1 ~rpGt~ALrEIRk~Qkst~lLIpk~pF~RLVRei~~~~~~~~r~~~~Al~aLQea~E~yLv~lfeda~~~a~HakRvTl~ 80 (95)
T d1tzyc_ 1 YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIM 80 (95)
T ss_dssp CCHHHHHHHHHHHHHHCCSCCSCHHHHHHHHHHHHHHHCTTCEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEEC
T ss_pred CCCchHHHHHHHHHhCCcccccccccHHHHHHHHHHhcCCCCEeeHHHHHHHHHHHHHHHHHHHHHhHHHHHhcCCCcCC
Confidence 79999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCcchhhhhhcc
Q psy2783 227 PKDIHWPSQWCDN 239 (340)
Q Consensus 227 ~kDm~L~~~i~~~ 239 (340)
++||+|+.+|+++
T Consensus 81 ~kD~~LarrirG~ 93 (95)
T d1tzyc_ 81 PKDIQLARRIRGE 93 (95)
T ss_dssp HHHHHHHHHHHTC
T ss_pred HHHHHHHHHHhcc
Confidence 9999999999975
|
| >d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} | Back information, alignment and structure |
|---|
| >d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} | Back information, alignment and structure |
|---|
| >d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h3ob_ a.22.1.3 (B:) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tafa_ a.22.1.3 (A:) TAF(II)42 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1tafb_ a.22.1.3 (B:) TAF(II)62 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|