Psyllid ID: psy2827
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 373 | ||||||
| 242016230 | 509 | Sorting nexin-27, putative [Pediculus hu | 0.927 | 0.679 | 0.655 | 1e-135 | |
| 193603550 | 495 | PREDICTED: sorting nexin-27-like isoform | 0.935 | 0.705 | 0.628 | 1e-134 | |
| 91078172 | 506 | PREDICTED: similar to sorting nexin [Tri | 0.914 | 0.673 | 0.650 | 1e-133 | |
| 156537462 | 532 | PREDICTED: sorting nexin-27-like [Nasoni | 0.908 | 0.637 | 0.644 | 1e-130 | |
| 383855970 | 530 | PREDICTED: sorting nexin-27-like [Megach | 0.908 | 0.639 | 0.644 | 1e-129 | |
| 332029282 | 537 | Sorting nexin-27 [Acromyrmex echinatior] | 0.908 | 0.631 | 0.644 | 1e-129 | |
| 307173214 | 537 | Sorting nexin-27 [Camponotus floridanus] | 0.908 | 0.631 | 0.641 | 1e-128 | |
| 347965326 | 526 | AGAP001110-PA [Anopheles gambiae str. PE | 0.919 | 0.652 | 0.634 | 1e-128 | |
| 157110114 | 506 | sorting nexin [Aedes aegypti] gi|1088788 | 0.919 | 0.677 | 0.634 | 1e-128 | |
| 195131923 | 503 | GI14707 [Drosophila mojavensis] gi|19390 | 0.927 | 0.687 | 0.619 | 1e-127 |
| >gi|242016230|ref|XP_002428732.1| Sorting nexin-27, putative [Pediculus humanus corporis] gi|212513417|gb|EEB15994.1| Sorting nexin-27, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 488 bits (1255), Expect = e-135, Method: Compositional matrix adjust.
Identities = 251/383 (65%), Positives = 297/383 (77%), Gaps = 37/383 (9%)
Query: 4 TQQT--GPREVQIAKSDTGFGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLAGGAAEKA 61
T+QT GPR V I K++TGFGFNVRGQVSEGGQLRSINGELYAPLQHVSAVL GGAAEKA
Sbjct: 17 TKQTPLGPRAVTIYKTETGFGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLGGGAAEKA 76
Query: 62 GIRKGDRILAVNNVNVEGATHKQVVELIKSGGDVLSLTVISVSPEEAERLEPPDDHSGYQ 121
GIRKGDRIL VN +VEGATHKQVVELIKSGGDVL+LTVISV+P+EAERLEP DD Y
Sbjct: 77 GIRKGDRILEVNGASVEGATHKQVVELIKSGGDVLTLTVISVTPQEAERLEPSDDAPTYA 136
Query: 122 QIDYTEKRSLPISIPDYSYVNTEDESFVVFNIYMAGRHLCSRR----------------- 164
IDY+EKRSLPISIPDY Y+ + +VVFNIYMAGRHLCSRR
Sbjct: 137 CIDYSEKRSLPISIPDYHYLERGGDRYVVFNIYMAGRHLCSRRYREFSNLHTQLKRDFQG 196
Query: 165 -------------LTEQQLDSRRRGLEIYLEKVCAVRVIAESELMQEFLTDALDENGTNI 211
L+EQQLDSRRRGLE YLEKVCAVRVIAES+ +QEFLTD+ ++
Sbjct: 197 FSFPKLPGKWPFVLSEQQLDSRRRGLEQYLEKVCAVRVIAESDAVQEFLTDSDVQDNV-- 254
Query: 212 SSPVDIKILLPDREVITVSVRKSATADEVYASAVPKLYLQSPSSAAYFYLFEIVEYSFER 271
SPVD+K+LLPD+E++TV++ KSA A+EVY + + K+ + S +S+ YFYLFEIVEY+FER
Sbjct: 255 -SPVDLKVLLPDQEIVTVTIYKSANAEEVYKAVIGKIGM-SVNSSKYFYLFEIVEYNFER 312
Query: 272 KLEAKEFPHHLYIQNYSTASATCLCIRKWLFSAPLERSLVANDDRVATFMFWMAIDAVDR 331
KL E+PH+LYIQNYSTAS+TCL IRKW+F+ E SL +DD V +++FW ID V+R
Sbjct: 313 KLLPNEYPHNLYIQNYSTASSTCLAIRKWIFTLSKELSL-KHDDLVTSYIFWQTIDEVNR 371
Query: 332 GQIRAEDRLYELKALQDASRKHE 354
G I A+DRLY+LKALQD+SRK+E
Sbjct: 372 GHIIAKDRLYQLKALQDSSRKNE 394
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|193603550|ref|XP_001949290.1| PREDICTED: sorting nexin-27-like isoform 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|91078172|ref|XP_967060.1| PREDICTED: similar to sorting nexin [Tribolium castaneum] gi|270001364|gb|EEZ97811.1| hypothetical protein TcasGA2_TC000177 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|156537462|ref|XP_001607126.1| PREDICTED: sorting nexin-27-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|383855970|ref|XP_003703483.1| PREDICTED: sorting nexin-27-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|332029282|gb|EGI69265.1| Sorting nexin-27 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307173214|gb|EFN64276.1| Sorting nexin-27 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|347965326|ref|XP_551739.3| AGAP001110-PA [Anopheles gambiae str. PEST] gi|347965328|ref|XP_003435749.1| AGAP001110-PB [Anopheles gambiae str. PEST] gi|333470562|gb|EAL38656.3| AGAP001110-PA [Anopheles gambiae str. PEST] gi|333470563|gb|EGK97664.1| AGAP001110-PB [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|157110114|ref|XP_001650959.1| sorting nexin [Aedes aegypti] gi|108878813|gb|EAT43038.1| AAEL005484-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|195131923|ref|XP_002010393.1| GI14707 [Drosophila mojavensis] gi|193908843|gb|EDW07710.1| GI14707 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 373 | ||||||
| FB|FBgn0052758 | 531 | CG32758 [Drosophila melanogast | 0.439 | 0.308 | 0.756 | 1.8e-118 | |
| UNIPROTKB|H9KYY4 | 494 | SNX27 "Uncharacterized protein | 0.428 | 0.323 | 0.693 | 1.2e-102 | |
| UNIPROTKB|H9L3I2 | 560 | SNX27 "Uncharacterized protein | 0.428 | 0.285 | 0.693 | 1.2e-102 | |
| UNIPROTKB|Q96L92 | 541 | SNX27 "Sorting nexin-27" [Homo | 0.428 | 0.295 | 0.687 | 2e-102 | |
| UNIPROTKB|A5PKA5 | 541 | SNX27 "Sorting nexin-27" [Bos | 0.428 | 0.295 | 0.687 | 2.5e-102 | |
| MGI|MGI:1923992 | 539 | Snx27 "sorting nexin family me | 0.428 | 0.296 | 0.687 | 2.5e-102 | |
| UNIPROTKB|F1ST14 | 541 | SNX27 "Uncharacterized protein | 0.428 | 0.295 | 0.687 | 3.2e-102 | |
| RGD|628705 | 539 | Snx27 "sorting nexin family me | 0.428 | 0.296 | 0.687 | 3.2e-102 | |
| UNIPROTKB|Q8K4V4 | 539 | Snx27 "Sorting nexin-27" [Ratt | 0.428 | 0.296 | 0.687 | 3.2e-102 | |
| UNIPROTKB|E2RM53 | 542 | SNX27 "Uncharacterized protein | 0.428 | 0.295 | 0.687 | 5.2e-102 |
| FB|FBgn0052758 CG32758 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 632 (227.5 bits), Expect = 1.8e-118, Sum P(2) = 1.8e-118
Identities = 124/164 (75%), Positives = 139/164 (84%)
Query: 4 TQQTGPREVQIAKSDTGFGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLAGGAAEKAGI 63
T GPR V I K++TGFGFNVRGQVSEGGQLRSINGELYAPLQHVSAVL GAAEKAGI
Sbjct: 41 TTANGPRVVTIYKTETGFGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLENGAAEKAGI 100
Query: 64 RKGDRILAVNNVNVEGATHKQVVELIKSGGDVLSLTVISVSPEEAERLEPPDDHSGYQQI 123
+KGDRIL VN V+VEGATHKQVV+LIKSGGD L+LTVISV+ +EA+RLEP +D SGY I
Sbjct: 101 KKGDRILEVNGVSVEGATHKQVVDLIKSGGDCLTLTVISVTQQEADRLEPQEDQSGYSYI 160
Query: 124 DYTEKRSLPISIPDYSYVNTEDESFVVFNIYMAGRHLCSRRLTE 167
DY++KRSLPISIPDY VN E ++VFNI+MAGR LCSRR E
Sbjct: 161 DYSDKRSLPISIPDYGIVNRNGERYIVFNIHMAGRQLCSRRYRE 204
|
|
| UNIPROTKB|H9KYY4 SNX27 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H9L3I2 SNX27 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96L92 SNX27 "Sorting nexin-27" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A5PKA5 SNX27 "Sorting nexin-27" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1923992 Snx27 "sorting nexin family member 27" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1ST14 SNX27 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|628705 Snx27 "sorting nexin family member 27" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8K4V4 Snx27 "Sorting nexin-27" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RM53 SNX27 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 373 | |||
| cd01777 | 87 | cd01777, SNX27_RA, Ubiquitin domain of SNX27 (sort | 1e-34 | |
| cd06886 | 106 | cd06886, PX_SNX27, The phosphoinositide binding Ph | 2e-34 | |
| cd00992 | 82 | cd00992, PDZ_signaling, PDZ domain found in a vari | 2e-23 | |
| smart00228 | 85 | smart00228, PDZ, Domain present in PSD-95, Dlg, an | 7e-22 | |
| pfam00595 | 80 | pfam00595, PDZ, PDZ domain (Also known as DHR or G | 4e-15 | |
| cd00136 | 70 | cd00136, PDZ, PDZ domain, also called DHR (Dlg hom | 1e-12 | |
| cd00988 | 85 | cd00988, PDZ_CTP_protease, PDZ domain of C-termina | 1e-09 | |
| cd01768 | 87 | cd01768, RA, RA (Ras-associating) ubiquitin domain | 1e-09 | |
| cd00987 | 90 | cd00987, PDZ_serine_protease, PDZ domain of tryspi | 5e-09 | |
| cd00989 | 79 | cd00989, PDZ_metalloprotease, PDZ domain of bacter | 1e-08 | |
| pfam00788 | 87 | pfam00788, RA, Ras association (RalGDS/AF-6) domai | 1e-07 | |
| TIGR00225 | 334 | TIGR00225, prc, C-terminal peptidase (prc) | 2e-07 | |
| cd06093 | 106 | cd06093, PX_domain, The Phox Homology domain, a ph | 1e-05 | |
| COG0793 | 406 | COG0793, Prc, Periplasmic protease [Cell envelope | 1e-05 | |
| cd06885 | 104 | cd06885, PX_SNX17_31, The phosphoinositide binding | 2e-05 | |
| pfam00787 | 109 | pfam00787, PX, PX domain | 3e-05 | |
| TIGR02037 | 428 | TIGR02037, degP_htrA_DO, periplasmic serine protea | 2e-04 | |
| pfam13180 | 81 | pfam13180, PDZ_2, PDZ domain | 3e-04 | |
| COG0265 | 347 | COG0265, DegQ, Trypsin-like serine proteases, typi | 8e-04 | |
| TIGR02037 | 428 | TIGR02037, degP_htrA_DO, periplasmic serine protea | 9e-04 | |
| TIGR02860 | 402 | TIGR02860, spore_IV_B, stage IV sporulation protei | 0.001 | |
| cd00990 | 80 | cd00990, PDZ_glycyl_aminopeptidase, PDZ domain ass | 0.002 | |
| PLN00049 | 389 | PLN00049, PLN00049, carboxyl-terminal processing p | 0.003 | |
| cd06880 | 110 | cd06880, PX_SNX22, The phosphoinositide binding Ph | 0.004 | |
| PRK10898 | 353 | PRK10898, PRK10898, serine endoprotease; Provision | 0.004 |
| >gnl|CDD|176372 cd01777, SNX27_RA, Ubiquitin domain of SNX27 (sorting nexin protein 27) | Back alignment and domain information |
|---|
Score = 122 bits (307), Expect = 1e-34
Identities = 44/88 (50%), Positives = 60/88 (68%), Gaps = 2/88 (2%)
Query: 214 PVDIKILLPDREVITVSVRKSATADEVYASAVPKLYLQSPSSAAYFYLFEIVEYSFERKL 273
V+++I LPD+ +TV VRK+AT D+VY + V K + S + YF LFE++ +SF RKL
Sbjct: 1 DVELRIALPDKATVTVRVRKNATTDQVYQALVAKAGMDS-YTQNYFALFEVINHSFVRKL 59
Query: 274 EAKEFPHHLYIQNYSTA-SATCLCIRKW 300
EFPH LY+QNY++A TCL RKW
Sbjct: 60 APNEFPHKLYVQNYTSAVPGTCLTARKW 87
|
SNX27_RA SNX27 (sorting nexin protein 27) belongs to a large family of endosome-localized proteins related to sorting nexin1 which is implicated in regulating membrane traffic. The domain architecture of SNX27 includes an amino-terminal PDZ domain, a PX (PhoX homologous) domain, and a carboxy-terminal RA (RAS-associated) domain. Length = 87 |
| >gnl|CDD|132796 cd06886, PX_SNX27, The phosphoinositide binding Phox Homology domain of Sorting Nexin 27 | Back alignment and domain information |
|---|
| >gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements | Back alignment and domain information |
|---|
| >gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 | Back alignment and domain information |
|---|
| >gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) | Back alignment and domain information |
|---|
| >gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) | Back alignment and domain information |
|---|
| >gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts | Back alignment and domain information |
|---|
| >gnl|CDD|176363 cd01768, RA, RA (Ras-associating) ubiquitin domain | Back alignment and domain information |
|---|
| >gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis | Back alignment and domain information |
|---|
| >gnl|CDD|238489 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
| >gnl|CDD|201444 pfam00788, RA, Ras association (RalGDS/AF-6) domain | Back alignment and domain information |
|---|
| >gnl|CDD|232883 TIGR00225, prc, C-terminal peptidase (prc) | Back alignment and domain information |
|---|
| >gnl|CDD|132768 cd06093, PX_domain, The Phox Homology domain, a phosphoinositide binding module | Back alignment and domain information |
|---|
| >gnl|CDD|223864 COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|132795 cd06885, PX_SNX17_31, The phosphoinositide binding Phox Homology domain of Sorting Nexins 17 and 31 | Back alignment and domain information |
|---|
| >gnl|CDD|216119 pfam00787, PX, PX domain | Back alignment and domain information |
|---|
| >gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >gnl|CDD|221961 pfam13180, PDZ_2, PDZ domain | Back alignment and domain information |
|---|
| >gnl|CDD|223343 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >gnl|CDD|234035 TIGR02860, spore_IV_B, stage IV sporulation protein B | Back alignment and domain information |
|---|
| >gnl|CDD|238490 cd00990, PDZ_glycyl_aminopeptidase, PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases | Back alignment and domain information |
|---|
| >gnl|CDD|177681 PLN00049, PLN00049, carboxyl-terminal processing protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132790 cd06880, PX_SNX22, The phosphoinositide binding Phox Homology domain of Sorting Nexin 22 | Back alignment and domain information |
|---|
| >gnl|CDD|182820 PRK10898, PRK10898, serine endoprotease; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 373 | |||
| KOG3784|consensus | 407 | 100.0 | ||
| KOG3552|consensus | 1298 | 99.93 | ||
| cd01777 | 87 | SNX27_RA Ubiquitin domain of SNX27 (sorting nexin | 99.92 | |
| PRK10779 | 449 | zinc metallopeptidase RseP; Provisional | 99.89 | |
| TIGR00054 | 420 | RIP metalloprotease RseP. A model that detects fra | 99.87 | |
| PF00595 | 81 | PDZ: PDZ domain (Also known as DHR or GLGF) Coordi | 99.36 | |
| smart00295 | 207 | B41 Band 4.1 homologues. Also known as ezrin/radix | 99.2 | |
| cd00992 | 82 | PDZ_signaling PDZ domain found in a variety of Eum | 99.08 | |
| KOG3550|consensus | 207 | 99.02 | ||
| COG0750 | 375 | Predicted membrane-associated Zn-dependent proteas | 99.0 | |
| cd00136 | 70 | PDZ PDZ domain, also called DHR (Dlg homologous re | 98.98 | |
| PF13180 | 82 | PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ | 98.96 | |
| KOG3209|consensus | 984 | 98.92 | ||
| smart00228 | 85 | PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als | 98.92 | |
| KOG3209|consensus | 984 | 98.9 | ||
| KOG3549|consensus | 505 | 98.9 | ||
| cd00988 | 85 | PDZ_CTP_protease PDZ domain of C-terminal processi | 98.71 | |
| cd00991 | 79 | PDZ_archaeal_metalloprotease PDZ domain of archaea | 98.66 | |
| cd00989 | 79 | PDZ_metalloprotease PDZ domain of bacterial and pl | 98.66 | |
| cd06886 | 106 | PX_SNX27 The phosphoinositide binding Phox Homolog | 98.44 | |
| KOG3651|consensus | 429 | 98.44 | ||
| cd00990 | 80 | PDZ_glycyl_aminopeptidase PDZ domain associated wi | 98.44 | |
| KOG3551|consensus | 506 | 98.39 | ||
| cd00986 | 79 | PDZ_LON_protease PDZ domain of ATP-dependent LON s | 98.38 | |
| cd00987 | 90 | PDZ_serine_protease PDZ domain of tryspin-like ser | 98.38 | |
| PRK10139 | 455 | serine endoprotease; Provisional | 98.37 | |
| KOG3553|consensus | 124 | 98.34 | ||
| PLN00049 | 389 | carboxyl-terminal processing protease; Provisional | 98.17 | |
| KOG3580|consensus | 1027 | 98.16 | ||
| TIGR00225 | 334 | prc C-terminal peptidase (prc). A C-terminal pepti | 98.14 | |
| PRK10779 | 449 | zinc metallopeptidase RseP; Provisional | 98.07 | |
| PF04495 | 138 | GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: | 98.05 | |
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 98.04 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 98.04 | |
| KOG1892|consensus | 1629 | 98.04 | ||
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 98.03 | |
| TIGR01713 | 259 | typeII_sec_gspC general secretion pathway protein | 97.98 | |
| COG0793 | 406 | Prc Periplasmic protease [Cell envelope biogenesis | 97.97 | |
| PRK10139 | 455 | serine endoprotease; Provisional | 97.96 | |
| KOG3605|consensus | 829 | 97.92 | ||
| TIGR02038 | 351 | protease_degS periplasmic serine pepetdase DegS. T | 97.88 | |
| PRK10898 | 353 | serine endoprotease; Provisional | 97.87 | |
| TIGR02860 | 402 | spore_IV_B stage IV sporulation protein B. SpoIVB, | 97.86 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 97.84 | |
| TIGR03279 | 433 | cyano_FeS_chp putative FeS-containing Cyanobacteri | 97.82 | |
| KOG3606|consensus | 358 | 97.82 | ||
| PRK11186 | 667 | carboxy-terminal protease; Provisional | 97.77 | |
| cd06885 | 104 | PX_SNX17_31 The phosphoinositide binding Phox Homo | 97.76 | |
| KOG3580|consensus | 1027 | 97.68 | ||
| KOG3129|consensus | 231 | 97.68 | ||
| KOG0606|consensus | 1205 | 97.56 | ||
| TIGR00054 | 420 | RIP metalloprotease RseP. A model that detects fra | 97.53 | |
| KOG3571|consensus | 626 | 97.52 | ||
| KOG3542|consensus | 1283 | 97.49 | ||
| cd01768 | 87 | RA RA (Ras-associating) ubiquitin domain. The RA ( | 97.28 | |
| KOG0609|consensus | 542 | 96.91 | ||
| PF00373 | 126 | FERM_M: FERM central domain; InterPro: IPR019748 T | 96.91 | |
| smart00314 | 90 | RA Ras association (RalGDS/AF-6) domain. RasGTP ef | 96.89 | |
| KOG3938|consensus | 334 | 96.89 | ||
| KOG3605|consensus | 829 | 96.88 | ||
| PF00788 | 93 | RA: Ras association (RalGDS/AF-6) domain; InterPro | 96.84 | |
| COG0265 | 347 | DegQ Trypsin-like serine proteases, typically peri | 96.77 | |
| PF14685 | 88 | Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 | 96.73 | |
| cd06862 | 125 | PX_SNX9_18_like The phosphoinositide binding Phox | 96.64 | |
| COG3480 | 342 | SdrC Predicted secreted protein containing a PDZ d | 96.49 | |
| cd07301 | 112 | PX_SNX21 The phosphoinositide binding Phox Homolog | 96.42 | |
| cd07279 | 112 | PX_SNX20_21_like The phosphoinositide binding Phox | 96.38 | |
| KOG3530|consensus | 616 | 96.31 | ||
| cd07300 | 114 | PX_SNX20 The phosphoinositide binding Phox Homolog | 96.31 | |
| cd06867 | 112 | PX_SNX41_42 The phosphoinositide binding Phox Homo | 96.29 | |
| cd06870 | 109 | PX_CISK The phosphoinositide binding Phox Homology | 95.89 | |
| cd06877 | 119 | PX_SNX14 The phosphoinositide binding Phox Homolog | 95.75 | |
| PRK09681 | 276 | putative type II secretion protein GspC; Provision | 95.71 | |
| COG3975 | 558 | Predicted protease with the C-terminal PDZ domain | 95.53 | |
| PF09379 | 80 | FERM_N: FERM N-terminal domain ; InterPro: IPR0189 | 95.46 | |
| cd06872 | 107 | PX_SNX19_like_plant The phosphoinositide binding P | 95.42 | |
| cd07280 | 120 | PX_YPT35 The phosphoinositide binding Phox Homolog | 95.41 | |
| cd06861 | 112 | PX_Vps5p The phosphoinositide binding Phox Homolog | 95.36 | |
| COG3031 | 275 | PulC Type II secretory pathway, component PulC [In | 95.17 | |
| KOG3532|consensus | 1051 | 95.0 | ||
| cd06866 | 105 | PX_SNX8_Mvp1p_like The phosphoinositide binding Ph | 94.99 | |
| cd01787 | 85 | GRB7_RA RA (RAS-associated like) domain of Grb7. G | 94.77 | |
| cd06893 | 132 | PX_SNX19 The phosphoinositide binding Phox Homolog | 94.72 | |
| cd01784 | 87 | rasfadin_RA Ubiquitin-like domain of Rasfadin. ras | 94.52 | |
| KOG1421|consensus | 955 | 94.43 | ||
| KOG1320|consensus | 473 | 94.41 | ||
| cd07281 | 124 | PX_SNX1 The phosphoinositide binding Phox Homology | 94.38 | |
| cd06873 | 120 | PX_SNX13 The phosphoinositide binding Phox Homolog | 94.34 | |
| cd06898 | 113 | PX_SNX10 The phosphoinositide binding Phox Homolog | 94.22 | |
| cd06879 | 138 | PX_UP1_plant The phosphoinositide binding Phox Hom | 94.17 | |
| cd07295 | 116 | PX_Grd19 The phosphoinositide binding Phox Homolog | 94.05 | |
| cd06864 | 129 | PX_SNX4 The phosphoinositide binding Phox Homology | 93.92 | |
| cd06868 | 120 | PX_HS1BP3 The phosphoinositide binding Phox Homolo | 93.84 | |
| cd07286 | 127 | PX_SNX18 The phosphoinositide binding Phox Homolog | 93.77 | |
| cd06163 | 182 | S2P-M50_PDZ_RseP-like RseP-like Site-2 proteases ( | 93.75 | |
| cd06878 | 127 | PX_SNX25 The phosphoinositide binding Phox Homolog | 93.72 | |
| cd06881 | 117 | PX_SNX15_like The phosphoinositide binding Phox Ho | 93.68 | |
| cd07282 | 124 | PX_SNX2 The phosphoinositide binding Phox Homology | 93.31 | |
| PF12812 | 78 | PDZ_1: PDZ-like domain | 93.19 | |
| cd06897 | 108 | PX_SNARE The phosphoinositide binding Phox Homolog | 93.14 | |
| cd01782 | 112 | AF6_RA_repeat1 Ubiquitin domain of AT-6, first rep | 93.0 | |
| cd07293 | 123 | PX_SNX3 The phosphoinositide binding Phox Homology | 92.67 | |
| cd01778 | 96 | RASSF1_RA Ubiquitin-like domain of RASSF1 tumour s | 92.55 | |
| cd06865 | 120 | PX_SNX_like The phosphoinositide binding Phox Homo | 92.33 | |
| cd06860 | 116 | PX_SNX7_30_like The phosphoinositide binding Phox | 92.24 | |
| KOG2527|consensus | 144 | 92.21 | ||
| cd07288 | 118 | PX_SNX15 The phosphoinositide binding Phox Homolog | 92.16 | |
| KOG4407|consensus | 1973 | 92.0 | ||
| cd07285 | 126 | PX_SNX9 The phosphoinositide binding Phox Homology | 91.99 | |
| cd06863 | 118 | PX_Atg24p The phosphoinositide binding Phox Homolo | 91.68 | |
| cd07287 | 118 | PX_RPK118_like The phosphoinositide binding Phox H | 91.56 | |
| cd07276 | 110 | PX_SNX16 The phosphoinositide binding Phox Homolog | 91.5 | |
| cd07283 | 116 | PX_SNX30 The phosphoinositide binding Phox Homolog | 91.39 | |
| cd07294 | 132 | PX_SNX12 The phosphoinositide binding Phox Homolog | 91.37 | |
| cd06869 | 119 | PX_UP2_fungi The phosphoinositide binding Phox Hom | 91.26 | |
| cd06894 | 123 | PX_SNX3_like The phosphoinositide binding Phox Hom | 90.91 | |
| cd06871 | 120 | PX_MONaKA The phosphoinositide binding Phox Homolo | 90.9 | |
| smart00455 | 70 | RBD Raf-like Ras-binding domain. | 90.74 | |
| cd07284 | 116 | PX_SNX7 The phosphoinositide binding Phox Homology | 90.68 | |
| cd06859 | 114 | PX_SNX1_2_like The phosphoinositide binding Phox H | 90.62 | |
| KOG1738|consensus | 638 | 90.57 | ||
| cd06876 | 133 | PX_MDM1p The phosphoinositide binding Phox Homolog | 90.31 | |
| cd06880 | 110 | PX_SNX22 The phosphoinositide binding Phox Homolog | 90.14 | |
| smart00312 | 105 | PX PhoX homologous domain, present in p47phox and | 90.12 | |
| PF02196 | 71 | RBD: Raf-like Ras-binding domain; InterPro: IPR003 | 89.88 | |
| cd06875 | 116 | PX_IRAS The phosphoinositide binding Phox Homology | 89.73 | |
| KOG3834|consensus | 462 | 89.23 | ||
| cd01760 | 72 | RBD Ubiquitin-like domain of RBD-like S/T kinases. | 88.96 | |
| KOG3834|consensus | 462 | 88.74 | ||
| KOG4257|consensus | 974 | 88.47 | ||
| PF00787 | 113 | PX: PX domain; InterPro: IPR001683 The PX (phox) d | 85.8 | |
| cd06891 | 140 | PX_Vps17p The phosphoinositide binding Phox Homolo | 85.75 | |
| cd01781 | 100 | AF6_RA_repeat2 Ubiquitin domain of AT-6, second re | 84.72 | |
| cd06883 | 109 | PX_PI3K_C2 The phosphoinositide binding Phox Homol | 84.71 | |
| cd01817 | 73 | RGS12_RBD Ubiquitin domain of RGS12 and RGS14. RGS | 84.2 | |
| cd06882 | 123 | PX_p40phox The phosphoinositide binding Phox Homol | 83.65 | |
| cd07277 | 118 | PX_RUN The phosphoinositide binding Phox Homology | 80.43 |
| >KOG3784|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.3e-44 Score=340.19 Aligned_cols=208 Identities=37% Similarity=0.537 Sum_probs=194.4
Q ss_pred cccceeeeeeehhhhcccccc------------------------------cchhHHHHHhhcHHHHHHHHhchhhhhhh
Q psy2827 144 EDESFVVFNIYMAGRHLCSRR------------------------------LTEQQLDSRRRGLEIYLEKVCAVRVIAES 193 (373)
Q Consensus 144 ~~~~~~~~~i~~~g~l~~~~r------------------------------l~i~q~~~rr~gl~~yl~~v~~~~~i~~s 193 (373)
....|++||||++|.+||+.| ++..++++||+++++|++++|+++.+++|
T Consensus 13 ~~~~ytaynih~nG~~~~~~r~s~~~~l~~~lr~~~~~~~~p~~p~k~~f~L~~~~~~~rr~~leqylqa~~q~~~l~~s 92 (407)
T KOG3784|consen 13 SLERYTAYNIHINGRQHGSVRYSQLVELHEQLKKHFYDYCLPQFPPKKLFKLTPQQLDSRRRGLEQYLQAVCQDPVLARS 92 (407)
T ss_pred CcccccceeeeecceeEEEEehHHHHhHHHHHHHHhhcccCCCCCcccccCCChhhhHHHHHHHHHHHHHHhcCccccch
Confidence 567899999999999999998 89999999999999999999999999999
Q ss_pred HHHHHHHHHhcccCCCCCccceEEEEEcCCCceEEEEEEecCCHHHHHHHhccccCCCchhhhchhheeeeecc-----c
Q psy2827 194 ELMQEFLTDALDENGTNISSPVDIKILLPDREVITVSVRKSATADEVYASAVPKLYLQSPSSAAYFYLFEIVEY-----S 268 (373)
Q Consensus 194 ~~~~~FL~~~~s~~~~~~~~~l~l~nlLPDGg~i~ie~~~~~~~~~~~~~~~~~igl~~~~~l~~f~lf~~~~~-----~ 268 (373)
+.++.||... +. ...+.+.++||||..++|+++++++++.+++.++.++|| +.+++.||+||+.+.. .
T Consensus 93 ~~~~~fL~~~-q~-----~~~v~l~v~lpng~~i~i~~~~s~tt~~vl~~v~~kl~l-~~e~i~~f~lFlvr~~~~~~ls 165 (407)
T KOG3784|consen 93 ELVQKFLMRA-QP-----MEEVELDVFLPNGEKITINCLVSDTASLVLKSVCRKLGL-PDELIGYFGLFLVRDNDPGNLS 165 (407)
T ss_pred hhhhHHHHhc-cc-----cceeEEEEEccCCceEEEEEEecccHHHHHHHHHhhcCC-chHhhhheeeeEEeccCCCcce
Confidence 9999999988 44 345899999999999999999999999999999999999 8999999999999986 9
Q ss_pred eeeccCcCCCCceeeeccccCCCCceEEEEeeccCChhhhhcccCChHHHHHHHHHHHHHHhcCCccch-hhHHHHHHHH
Q psy2827 269 FERKLEAKEFPHHLYIQNYSTASATCLCIRKWLFSAPLERSLVANDDRVATFMFWMAIDAVDRGQIRAE-DRLYELKALQ 347 (373)
Q Consensus 269 ~~r~l~~~e~p~~~~~~~~~~~~~~~~~lrk~~~~~~~~~~l~~~d~~a~~~ly~Q~~~dv~~~~~~~~-~~~~~L~~lq 347 (373)
++|||++||+||.+|.++++++.. ++|||||||+..|..|++ +.+|++|||+||++|+++||+.++ +...||++||
T Consensus 166 ~vRkl~~fE~p~vs~t~~~~~~~~--l~LRk~~~ds~~e~~L~d-~~~~v~llY~Qav~D~~~g~~~~~~e~~~QL~slq 242 (407)
T KOG3784|consen 166 FVRKLADFESPYVSLTSNYVSACE--LLLRKWYWDSSRERALMD-NRVAVNLLYVQAVQDIERGWVVPTKEQYDQLKSLQ 242 (407)
T ss_pred eeeeeccccccccccccccccccc--ceeeeeeecchhhhHHhc-CchHHHHHHHHHHHHHhcCceeechhhHHHHHHHH
Confidence 999999999999988888876522 999999999999999999 999999999999999999999997 4444999999
Q ss_pred hccchHHhhhhccC
Q psy2827 348 DASRKHEITTGSCN 361 (373)
Q Consensus 348 ~~~~~~~~l~l~~~ 361 (373)
++++++|||+||++
T Consensus 243 ~q~~~~~fL~m~R~ 256 (407)
T KOG3784|consen 243 EEESMKEFLELART 256 (407)
T ss_pred HhhhHHHHHHHHHh
Confidence 99999999999984
|
|
| >KOG3552|consensus | Back alignment and domain information |
|---|
| >cd01777 SNX27_RA Ubiquitin domain of SNX27 (sorting nexin protein 27) | Back alignment and domain information |
|---|
| >PRK10779 zinc metallopeptidase RseP; Provisional | Back alignment and domain information |
|---|
| >TIGR00054 RIP metalloprotease RseP | Back alignment and domain information |
|---|
| >PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] | Back alignment and domain information |
|---|
| >smart00295 B41 Band 4 | Back alignment and domain information |
|---|
| >cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements | Back alignment and domain information |
|---|
| >KOG3550|consensus | Back alignment and domain information |
|---|
| >COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) | Back alignment and domain information |
|---|
| >PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C | Back alignment and domain information |
|---|
| >KOG3209|consensus | Back alignment and domain information |
|---|
| >smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 | Back alignment and domain information |
|---|
| >KOG3209|consensus | Back alignment and domain information |
|---|
| >KOG3549|consensus | Back alignment and domain information |
|---|
| >cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts | Back alignment and domain information |
|---|
| >cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
| >cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
| >cd06886 PX_SNX27 The phosphoinositide binding Phox Homology domain of Sorting Nexin 27 | Back alignment and domain information |
|---|
| >KOG3651|consensus | Back alignment and domain information |
|---|
| >cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases | Back alignment and domain information |
|---|
| >KOG3551|consensus | Back alignment and domain information |
|---|
| >cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases | Back alignment and domain information |
|---|
| >cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis | Back alignment and domain information |
|---|
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >KOG3553|consensus | Back alignment and domain information |
|---|
| >PLN00049 carboxyl-terminal processing protease; Provisional | Back alignment and domain information |
|---|
| >KOG3580|consensus | Back alignment and domain information |
|---|
| >TIGR00225 prc C-terminal peptidase (prc) | Back alignment and domain information |
|---|
| >PRK10779 zinc metallopeptidase RseP; Provisional | Back alignment and domain information |
|---|
| >PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous | Back alignment and domain information |
|---|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >KOG1892|consensus | Back alignment and domain information |
|---|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >TIGR01713 typeII_sec_gspC general secretion pathway protein C | Back alignment and domain information |
|---|
| >COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >KOG3605|consensus | Back alignment and domain information |
|---|
| >TIGR02038 protease_degS periplasmic serine pepetdase DegS | Back alignment and domain information |
|---|
| >PRK10898 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR02860 spore_IV_B stage IV sporulation protein B | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase | Back alignment and domain information |
|---|
| >KOG3606|consensus | Back alignment and domain information |
|---|
| >PRK11186 carboxy-terminal protease; Provisional | Back alignment and domain information |
|---|
| >cd06885 PX_SNX17_31 The phosphoinositide binding Phox Homology domain of Sorting Nexins 17 and 31 | Back alignment and domain information |
|---|
| >KOG3580|consensus | Back alignment and domain information |
|---|
| >KOG3129|consensus | Back alignment and domain information |
|---|
| >KOG0606|consensus | Back alignment and domain information |
|---|
| >TIGR00054 RIP metalloprotease RseP | Back alignment and domain information |
|---|
| >KOG3571|consensus | Back alignment and domain information |
|---|
| >KOG3542|consensus | Back alignment and domain information |
|---|
| >cd01768 RA RA (Ras-associating) ubiquitin domain | Back alignment and domain information |
|---|
| >KOG0609|consensus | Back alignment and domain information |
|---|
| >PF00373 FERM_M: FERM central domain; InterPro: IPR019748 The FERM domain (F for 4 | Back alignment and domain information |
|---|
| >smart00314 RA Ras association (RalGDS/AF-6) domain | Back alignment and domain information |
|---|
| >KOG3938|consensus | Back alignment and domain information |
|---|
| >KOG3605|consensus | Back alignment and domain information |
|---|
| >PF00788 RA: Ras association (RalGDS/AF-6) domain; InterPro: IPR000159 Proteins with this domain are mostly RasGTP effectors and include guanine-nucleotide releasing factor in mammals [] | Back alignment and domain information |
|---|
| >COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A | Back alignment and domain information |
|---|
| >cd06862 PX_SNX9_18_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 9 and 18 | Back alignment and domain information |
|---|
| >COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07301 PX_SNX21 The phosphoinositide binding Phox Homology domain of Sorting Nexin 21 | Back alignment and domain information |
|---|
| >cd07279 PX_SNX20_21_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 20 and 21 | Back alignment and domain information |
|---|
| >KOG3530|consensus | Back alignment and domain information |
|---|
| >cd07300 PX_SNX20 The phosphoinositide binding Phox Homology domain of Sorting Nexin 20 | Back alignment and domain information |
|---|
| >cd06867 PX_SNX41_42 The phosphoinositide binding Phox Homology domain of fungal Sorting Nexins 41 and 42 | Back alignment and domain information |
|---|
| >cd06870 PX_CISK The phosphoinositide binding Phox Homology Domain of Cytokine-Independent Survival Kinase | Back alignment and domain information |
|---|
| >cd06877 PX_SNX14 The phosphoinositide binding Phox Homology domain of Sorting Nexin 14 | Back alignment and domain information |
|---|
| >PRK09681 putative type II secretion protein GspC; Provisional | Back alignment and domain information |
|---|
| >COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain | Back alignment and domain information |
|---|
| >cd06872 PX_SNX19_like_plant The phosphoinositide binding Phox Homology domain of uncharacterized SNX19-like plant proteins | Back alignment and domain information |
|---|
| >cd07280 PX_YPT35 The phosphoinositide binding Phox Homology domain of the fungal protein YPT35 | Back alignment and domain information |
|---|
| >cd06861 PX_Vps5p The phosphoinositide binding Phox Homology domain of yeast sorting nexin Vps5p | Back alignment and domain information |
|---|
| >COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG3532|consensus | Back alignment and domain information |
|---|
| >cd06866 PX_SNX8_Mvp1p_like The phosphoinositide binding Phox Homology domain of Sorting Nexin 8 and yeast Mvp1p | Back alignment and domain information |
|---|
| >cd01787 GRB7_RA RA (RAS-associated like) domain of Grb7 | Back alignment and domain information |
|---|
| >cd06893 PX_SNX19 The phosphoinositide binding Phox Homology domain of Sorting Nexin 19 | Back alignment and domain information |
|---|
| >cd01784 rasfadin_RA Ubiquitin-like domain of Rasfadin | Back alignment and domain information |
|---|
| >KOG1421|consensus | Back alignment and domain information |
|---|
| >KOG1320|consensus | Back alignment and domain information |
|---|
| >cd07281 PX_SNX1 The phosphoinositide binding Phox Homology domain of Sorting Nexin 1 | Back alignment and domain information |
|---|
| >cd06873 PX_SNX13 The phosphoinositide binding Phox Homology domain of Sorting Nexin 13 | Back alignment and domain information |
|---|
| >cd06898 PX_SNX10 The phosphoinositide binding Phox Homology domain of Sorting Nexin 10 | Back alignment and domain information |
|---|
| >cd06879 PX_UP1_plant The phosphoinositide binding Phox Homology domain of uncharacterized plant proteins | Back alignment and domain information |
|---|
| >cd07295 PX_Grd19 The phosphoinositide binding Phox Homology domain of fungal Grd19 | Back alignment and domain information |
|---|
| >cd06864 PX_SNX4 The phosphoinositide binding Phox Homology domain of Sorting Nexin 4 | Back alignment and domain information |
|---|
| >cd06868 PX_HS1BP3 The phosphoinositide binding Phox Homology domain of HS1BP3 | Back alignment and domain information |
|---|
| >cd07286 PX_SNX18 The phosphoinositide binding Phox Homology domain of Sorting Nexin 18 | Back alignment and domain information |
|---|
| >cd06163 S2P-M50_PDZ_RseP-like RseP-like Site-2 proteases (S2P), zinc metalloproteases (MEROPS family M50A), cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms | Back alignment and domain information |
|---|
| >cd06878 PX_SNX25 The phosphoinositide binding Phox Homology domain of Sorting Nexin 25 | Back alignment and domain information |
|---|
| >cd06881 PX_SNX15_like The phosphoinositide binding Phox Homology domain of Sorting Nexin 15-like proteins | Back alignment and domain information |
|---|
| >cd07282 PX_SNX2 The phosphoinositide binding Phox Homology domain of Sorting Nexin 2 | Back alignment and domain information |
|---|
| >PF12812 PDZ_1: PDZ-like domain | Back alignment and domain information |
|---|
| >cd06897 PX_SNARE The phosphoinositide binding Phox Homology domain of SNARE proteins from fungi | Back alignment and domain information |
|---|
| >cd01782 AF6_RA_repeat1 Ubiquitin domain of AT-6, first repeat | Back alignment and domain information |
|---|
| >cd07293 PX_SNX3 The phosphoinositide binding Phox Homology domain of Sorting Nexin 3 | Back alignment and domain information |
|---|
| >cd01778 RASSF1_RA Ubiquitin-like domain of RASSF1 tumour supproessor protein | Back alignment and domain information |
|---|
| >cd06865 PX_SNX_like The phosphoinositide binding Phox Homology domain of SNX-like proteins | Back alignment and domain information |
|---|
| >cd06860 PX_SNX7_30_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 7 and 30 | Back alignment and domain information |
|---|
| >KOG2527|consensus | Back alignment and domain information |
|---|
| >cd07288 PX_SNX15 The phosphoinositide binding Phox Homology domain of Sorting Nexin 15 | Back alignment and domain information |
|---|
| >KOG4407|consensus | Back alignment and domain information |
|---|
| >cd07285 PX_SNX9 The phosphoinositide binding Phox Homology domain of Sorting Nexin 9 | Back alignment and domain information |
|---|
| >cd06863 PX_Atg24p The phosphoinositide binding Phox Homology domain of yeast Atg24p, an autophagic degradation protein | Back alignment and domain information |
|---|
| >cd07287 PX_RPK118_like The phosphoinositide binding Phox Homology domain of RPK118-like proteins | Back alignment and domain information |
|---|
| >cd07276 PX_SNX16 The phosphoinositide binding Phox Homology domain of Sorting Nexin 16 | Back alignment and domain information |
|---|
| >cd07283 PX_SNX30 The phosphoinositide binding Phox Homology domain of Sorting Nexin 30 | Back alignment and domain information |
|---|
| >cd07294 PX_SNX12 The phosphoinositide binding Phox Homology domain of Sorting Nexin 12 | Back alignment and domain information |
|---|
| >cd06869 PX_UP2_fungi The phosphoinositide binding Phox Homology domain of uncharacterized fungal proteins | Back alignment and domain information |
|---|
| >cd06894 PX_SNX3_like The phosphoinositide binding Phox Homology domain of Sorting Nexin 3 and related proteins | Back alignment and domain information |
|---|
| >cd06871 PX_MONaKA The phosphoinositide binding Phox Homology domain of Modulator of Na,K-ATPase | Back alignment and domain information |
|---|
| >smart00455 RBD Raf-like Ras-binding domain | Back alignment and domain information |
|---|
| >cd07284 PX_SNX7 The phosphoinositide binding Phox Homology domain of Sorting Nexin 7 | Back alignment and domain information |
|---|
| >cd06859 PX_SNX1_2_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 1 and 2 | Back alignment and domain information |
|---|
| >KOG1738|consensus | Back alignment and domain information |
|---|
| >cd06876 PX_MDM1p The phosphoinositide binding Phox Homology domain of yeast MDM1p | Back alignment and domain information |
|---|
| >cd06880 PX_SNX22 The phosphoinositide binding Phox Homology domain of Sorting Nexin 22 | Back alignment and domain information |
|---|
| >smart00312 PX PhoX homologous domain, present in p47phox and p40phox | Back alignment and domain information |
|---|
| >PF02196 RBD: Raf-like Ras-binding domain; InterPro: IPR003116 This is the Ras-binding domain found in proteins related to Ras | Back alignment and domain information |
|---|
| >cd06875 PX_IRAS The phosphoinositide binding Phox Homology domain of the Imidazoline Receptor Antisera-Selected | Back alignment and domain information |
|---|
| >KOG3834|consensus | Back alignment and domain information |
|---|
| >cd01760 RBD Ubiquitin-like domain of RBD-like S/T kinases | Back alignment and domain information |
|---|
| >KOG3834|consensus | Back alignment and domain information |
|---|
| >KOG4257|consensus | Back alignment and domain information |
|---|
| >PF00787 PX: PX domain; InterPro: IPR001683 The PX (phox) domain [] occurs in a variety of eukaryotic proteins and have been implicated in highly diverse functions such as cell signalling, vesicular trafficking, protein sorting and lipid modification [, , ] | Back alignment and domain information |
|---|
| >cd06891 PX_Vps17p The phosphoinositide binding Phox Homology domain of yeast sorting nexin Vps17p | Back alignment and domain information |
|---|
| >cd01781 AF6_RA_repeat2 Ubiquitin domain of AT-6, second repeat | Back alignment and domain information |
|---|
| >cd06883 PX_PI3K_C2 The phosphoinositide binding Phox Homology Domain of Class II Phosphoinositide 3-Kinases | Back alignment and domain information |
|---|
| >cd01817 RGS12_RBD Ubiquitin domain of RGS12 and RGS14 | Back alignment and domain information |
|---|
| >cd06882 PX_p40phox The phosphoinositide binding Phox Homology domain of the p40phox subunit of NADPH oxidase | Back alignment and domain information |
|---|
| >cd07277 PX_RUN The phosphoinositide binding Phox Homology domain of uncharacterized proteins containing PX and RUN domains | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 373 | ||||
| 3qdo_A | 109 | Crystal Structure Of Pdz Domain Of Sorting Nexin 27 | 1e-37 | ||
| 3qe1_A | 107 | Crystal Structure Of Pdz Domain Of Sorting Nexin 27 | 1e-37 | ||
| 3qgl_A | 101 | Crystal Structure Of Pdz Domain Of Sorting Nexin 27 | 5e-37 | ||
| 1ozi_A | 99 | The Alternatively Spliced Pdz2 Domain Of Ptp-Bl Len | 4e-12 | ||
| 1q7x_A | 108 | Solution Structure Of The Alternatively Spliced Pdz | 6e-12 | ||
| 1vj6_A | 102 | Pdz2 From Ptp-Bl In Complex With The C-Terminal Lig | 1e-11 | ||
| 1d5g_A | 96 | Solution Structure Of The Pdz2 Domain From Human Ph | 1e-11 | ||
| 3pdz_A | 96 | Solution Structure Of The Pdz2 Domain From Human Ph | 1e-11 | ||
| 1gm1_A | 94 | Second Pdz Domain (Pdz2) Of Ptp-Bl Length = 94 | 1e-11 | ||
| 1um7_A | 113 | Solution Structure Of The Third Pdz Domain Of Synap | 2e-10 | ||
| 3jxt_A | 104 | Crystal Structure Of The Third Pdz Domain Of Sap-10 | 3e-10 | ||
| 1q3o_A | 109 | Crystal Structure Of The Shank Pdz-ligand Complex R | 8e-10 | ||
| 3qjm_A | 115 | Structural Flexibility Of Shank Pdz Domain Is Impor | 1e-09 | ||
| 2xkx_A | 721 | Single Particle Analysis Of Psd-95 In Negative Stai | 1e-09 | ||
| 1i92_A | 91 | Structural Basis Of The Nherf Pdz1-Cftr Interaction | 3e-09 | ||
| 3l4f_D | 132 | Crystal Structure Of Betapix Coiled-Coil Domain And | 4e-09 | ||
| 3k82_A | 98 | Crystal Structure Of The Third Pdz Domain Of Psd-95 | 5e-09 | ||
| 1g9o_A | 91 | First Pdz Domain Of The Human Na+H+ EXCHANGER REGUL | 6e-09 | ||
| 3i4w_A | 104 | Crystal Structure Of The Third Pdz Domain Of Psd-95 | 7e-09 | ||
| 2kv8_A | 83 | Solution Structure Ofrgs12 Pdz Domain Length = 83 | 7e-09 | ||
| 1gq5_A | 91 | Structural Determinants Of The Nherf Interaction Wi | 7e-09 | ||
| 3r68_A | 95 | Molecular Analysis Of The Pdz3 Domain Of Pdzk1 Leng | 9e-09 | ||
| 2he2_A | 102 | Crystal Structure Of The 3rd Pdz Domain Of Human Di | 1e-08 | ||
| 1tp3_A | 119 | Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv | 1e-08 | ||
| 1be9_A | 119 | The Third Pdz Domain From The Synaptic Protein Psd- | 1e-08 | ||
| 2krg_A | 216 | Solution Structure Of Human Sodium HYDROGEN EXCHANG | 1e-08 | ||
| 2ocs_A | 88 | The Crystal Structure Of The First Pdz Domain Of Hu | 2e-08 | ||
| 3r69_A | 89 | Molecular Analysis Of The Interaction Of The Hdl-Re | 2e-08 | ||
| 2jxo_A | 98 | Structure Of The Second Pdz Domain Of Nherf-1 Lengt | 2e-08 | ||
| 2dls_A | 93 | Solution Structure Of The Pdz Domain Of Human Rho G | 3e-08 | ||
| 1gq4_A | 90 | Structural Determinants Of The Nherf Interaction Wi | 3e-08 | ||
| 2kjd_A | 128 | Solution Structure Of Extended Pdz2 Domain From Nhe | 6e-08 | ||
| 2dkr_A | 93 | Solution Structure Of The Pdz Domain From Human Lin | 8e-08 | ||
| 2x7z_A | 99 | Crystal Structure Of The Sap97 Pdz2 I342w C378a Mut | 9e-08 | ||
| 2ozf_A | 92 | The Crystal Structure Of The 2nd Pdz Domain Of The | 1e-07 | ||
| 3rl8_A | 105 | Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc L | 1e-07 | ||
| 2oqs_A | 97 | Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV | 1e-07 | ||
| 2byg_A | 117 | 2nd Pdz Domain Of Discs Large Homologue 2 Length = | 1e-07 | ||
| 4g69_A | 100 | Structure Of The Human Discs Large 1 Pdz2 - Adenoma | 1e-07 | ||
| 2fe5_A | 94 | The Crystal Structure Of The Second Pdz Domain Of H | 2e-07 | ||
| 2v90_A | 96 | Crystal Structure Of The 3rd Pdz Domain Of Intestin | 2e-07 | ||
| 3o5n_A | 112 | Tetrahydroquinoline Carboxylates Are Potent Inhibit | 3e-07 | ||
| 3ngh_A | 106 | Molecular Analysis Of The Interaction Of The Hdl Re | 3e-07 | ||
| 2aww_A | 105 | Synapse Associated Protein 97 Pdz2 Domain Variant C | 3e-07 | ||
| 2awx_A | 105 | Synapse Associated Protein 97 Pdz2 Domain Variant C | 3e-07 | ||
| 2awu_A | 105 | Synapse Associated Protein 97 Pdz2 Domain Variant C | 4e-07 | ||
| 2edz_A | 114 | Solution Structures Of The Pdz Domain Of Mus Muscul | 6e-07 | ||
| 4amh_A | 106 | Influence Of Circular Permutation On The Folding Pa | 6e-07 | ||
| 2he4_A | 90 | The Crystal Structure Of The Second Pdz Domain Of H | 6e-07 | ||
| 2g2l_A | 105 | Crystal Structure Of The Second Pdz Domain Of Sap97 | 6e-07 | ||
| 1qlc_A | 95 | Solution Structure Of The Second Pdz Domain Of Post | 6e-07 | ||
| 2omj_A | 89 | Solution Structure Of Larg Pdz Domain Length = 89 | 8e-07 | ||
| 2i0l_A | 84 | X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The | 1e-06 | ||
| 4f8k_A | 109 | Molecular Analysis Of The Interaction Between The P | 1e-06 | ||
| 2eej_A | 96 | Solution Structure Of Fourth Pdz Domain Of Pdz Doma | 2e-06 | ||
| 2d90_A | 102 | Solution Structure Of The Third Pdz Domain Of Pdz D | 2e-06 | ||
| 3gsl_A | 196 | Crystal Structure Of Psd-95 Tandem Pdz Domains 1 An | 3e-06 | ||
| 3zrt_A | 199 | Crystal Structure Of Human Psd-95 Pdz1-2 Length = 1 | 5e-06 | ||
| 2ka9_A | 189 | Solution Structure Of Psd-95 Pdz12 Complexed With C | 8e-06 | ||
| 1pdr_A | 99 | Crystal Structure Of The Third Pdz Domain From The | 1e-05 | ||
| 2i0i_A | 85 | X-Ray Crystal Structure Of Sap97 Pdz3 Bound To The | 1e-05 | ||
| 2kqf_A | 96 | Solution Structure Of Mast205-Pdz Complexed With Th | 2e-05 | ||
| 2pnt_A | 98 | Crystal Structure Of The Pdz Domain Of Human Grasp | 2e-05 | ||
| 3tmh_A | 87 | Crystal Structure Of Dual-Specific A-Kinase Anchori | 3e-05 | ||
| 2fne_A | 117 | The Crystal Structure Of The 13th Pdz Domain Of Mpd | 3e-05 | ||
| 2kom_A | 121 | Solution Structure Of Humar Par-3b Pdz2 (Residues 4 | 4e-05 | ||
| 2yuy_A | 126 | Solution Structure Of Pdz Domain Of Rho Gtpase Acti | 4e-05 | ||
| 2egk_A | 101 | Crystal Structure Of Tamalin Pdz-Intrinsic Ligand F | 4e-05 | ||
| 2vsp_A | 91 | Crystal Structure Of The Fourth Pdz Domain Of Pdz D | 4e-05 | ||
| 2ego_A | 96 | Crystal Structure Of Tamalin Pdz Domain Length = 96 | 4e-05 | ||
| 2dmz_A | 129 | Solution Structure Of The Third Pdz Domain Of Human | 5e-05 | ||
| 2koj_A | 111 | Solution Structure Of Mouse Par-3 Pdz2 (Residues 45 | 5e-05 | ||
| 2r4h_B | 112 | Crystal Structure Of A C1190s Mutant Of The 6th Pdz | 5e-05 | ||
| 2z17_A | 104 | Crystal Sturcture Of Pdz Domain From Human Pleckstr | 9e-05 | ||
| 2dlu_A | 111 | Solution Structure Of The Second Pdz Domain Of Huma | 1e-04 | ||
| 2djt_A | 104 | Solution Structures Of The Pdz Domain Of Human Unna | 1e-04 | ||
| 1wi2_A | 104 | Solution Structure Of The Pdz Domain From Riken Cdn | 1e-04 | ||
| 3k1r_A | 192 | Structure Of Harmonin Npdz1 In Complex With The Sam | 2e-04 | ||
| 3ps4_A | 102 | Pdz Domain From Human Microtubule-Associated Serine | 2e-04 | ||
| 2iwo_A | 120 | 12th Pdz Domain Of Multiple Pdz Domain Protein Mpdz | 3e-04 | ||
| 1wfv_A | 103 | Solution Structure Of The Fifth Pdz Domain Of Human | 4e-04 | ||
| 2i04_A | 85 | X-Ray Crystal Structure Of Magi-1 Pdz1 Bound To The | 6e-04 | ||
| 2w4f_A | 97 | Crystal Structure Of The First Pdz Domain Of Human | 8e-04 | ||
| 1x5q_A | 110 | Solution Structure Of The First Pdz Domain Of Scrib | 8e-04 | ||
| 1uew_A | 114 | Solution Structure Of The Forth Pdz Domain Of Human | 8e-04 | ||
| 2kpk_A | 129 | Magi-1 Pdz1 Length = 129 | 8e-04 | ||
| 2fcf_A | 103 | The Crystal Structure Of The 7th Pdz Domain Of Mpdz | 9e-04 |
| >pdb|3QDO|A Chain A, Crystal Structure Of Pdz Domain Of Sorting Nexin 27 (Snx27) Fused To The Gly-Gly Linker Followed By C-Terminal (Eseskv) Of Girk3 Length = 109 | Back alignment and structure |
|
| >pdb|3QGL|A Chain A, Crystal Structure Of Pdz Domain Of Sorting Nexin 27 (Snx27) In Complex With The Eseskv Peptide Corresponding To The C-Terminal Tail Of Girk3 Length = 101 | Back alignment and structure |
| >pdb|1OZI|A Chain A, The Alternatively Spliced Pdz2 Domain Of Ptp-Bl Length = 99 | Back alignment and structure |
| >pdb|1Q7X|A Chain A, Solution Structure Of The Alternatively Spliced Pdz2 Domain (Pdz2b) Of Ptp-Bas (Hptp1e) Length = 108 | Back alignment and structure |
| >pdb|1VJ6|A Chain A, Pdz2 From Ptp-Bl In Complex With The C-Terminal Ligand From The Apc Protein Length = 102 | Back alignment and structure |
| >pdb|1D5G|A Chain A, Solution Structure Of The Pdz2 Domain From Human Phosphatase Hptp1e Complexed With A Peptide Length = 96 | Back alignment and structure |
| >pdb|3PDZ|A Chain A, Solution Structure Of The Pdz2 Domain From Human Phosphatase Hptp1e Length = 96 | Back alignment and structure |
| >pdb|1GM1|A Chain A, Second Pdz Domain (Pdz2) Of Ptp-Bl Length = 94 | Back alignment and structure |
| >pdb|1UM7|A Chain A, Solution Structure Of The Third Pdz Domain Of Synapse- Associated Protein 102 Length = 113 | Back alignment and structure |
| >pdb|3JXT|A Chain A, Crystal Structure Of The Third Pdz Domain Of Sap-102 In Complex With A Fluorogenic Peptide-Based Ligand Length = 104 | Back alignment and structure |
| >pdb|1Q3O|A Chain A, Crystal Structure Of The Shank Pdz-ligand Complex Reveals A Class I Pdz Interaction And A Novel Pdz-pdz Dimerization Length = 109 | Back alignment and structure |
| >pdb|3QJM|A Chain A, Structural Flexibility Of Shank Pdz Domain Is Important For Its Binding To Different Ligands Length = 115 | Back alignment and structure |
| >pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 | Back alignment and structure |
| >pdb|1I92|A Chain A, Structural Basis Of The Nherf Pdz1-Cftr Interaction Length = 91 | Back alignment and structure |
| >pdb|3L4F|D Chain D, Crystal Structure Of Betapix Coiled-Coil Domain And Shank Pdz Complex Length = 132 | Back alignment and structure |
| >pdb|3K82|A Chain A, Crystal Structure Of The Third Pdz Domain Of Psd-95 Length = 98 | Back alignment and structure |
| >pdb|1G9O|A Chain A, First Pdz Domain Of The Human Na+H+ EXCHANGER REGULATORY Factor Length = 91 | Back alignment and structure |
| >pdb|3I4W|A Chain A, Crystal Structure Of The Third Pdz Domain Of Psd-95 Length = 104 | Back alignment and structure |
| >pdb|2KV8|A Chain A, Solution Structure Ofrgs12 Pdz Domain Length = 83 | Back alignment and structure |
| >pdb|1GQ5|A Chain A, Structural Determinants Of The Nherf Interaction With Beta2- Ar And Pdgfr Length = 91 | Back alignment and structure |
| >pdb|3R68|A Chain A, Molecular Analysis Of The Pdz3 Domain Of Pdzk1 Length = 95 | Back alignment and structure |
| >pdb|2HE2|A Chain A, Crystal Structure Of The 3rd Pdz Domain Of Human Discs Large Homologue 2, Dlg2 Length = 102 | Back alignment and structure |
| >pdb|1TP3|A Chain A, Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv Peptide Ligand Length = 119 | Back alignment and structure |
| >pdb|1BE9|A Chain A, The Third Pdz Domain From The Synaptic Protein Psd-95 In Complex With A C-Terminal Peptide Derived From Cript. Length = 119 | Back alignment and structure |
| >pdb|2KRG|A Chain A, Solution Structure Of Human Sodium HYDROGEN EXCHANGE Regulatory Factor 1(150-358) Length = 216 | Back alignment and structure |
| >pdb|2OCS|A Chain A, The Crystal Structure Of The First Pdz Domain Of Human Nherf-2 (slc9a3r2) Length = 88 | Back alignment and structure |
| >pdb|3R69|A Chain A, Molecular Analysis Of The Interaction Of The Hdl-Receptor Sr-Bi With The Pdz3 Domain Of Its Adaptor Protein Pdzk1 Length = 89 | Back alignment and structure |
| >pdb|2JXO|A Chain A, Structure Of The Second Pdz Domain Of Nherf-1 Length = 98 | Back alignment and structure |
| >pdb|2DLS|A Chain A, Solution Structure Of The Pdz Domain Of Human Rho Guanine Nucleotide Exchange Factor 11 Length = 93 | Back alignment and structure |
| >pdb|1GQ4|A Chain A, Structural Determinants Of The Nherf Interaction With Beta2ar And Pdgfr Length = 90 | Back alignment and structure |
| >pdb|2KJD|A Chain A, Solution Structure Of Extended Pdz2 Domain From Nherf1 (150- 270) Length = 128 | Back alignment and structure |
| >pdb|2DKR|A Chain A, Solution Structure Of The Pdz Domain From Human Lin-7 Homolog B Length = 93 | Back alignment and structure |
| >pdb|2X7Z|A Chain A, Crystal Structure Of The Sap97 Pdz2 I342w C378a Mutant Protein Domain Length = 99 | Back alignment and structure |
| >pdb|2OZF|A Chain A, The Crystal Structure Of The 2nd Pdz Domain Of The Human Nherf-1 (Slc9a3r1) Length = 92 | Back alignment and structure |
| >pdb|3RL8|A Chain A, Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc Length = 105 | Back alignment and structure |
| >pdb|2OQS|A Chain A, Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV-18 Papillomavirus E6 Peptide Length = 97 | Back alignment and structure |
| >pdb|2BYG|A Chain A, 2nd Pdz Domain Of Discs Large Homologue 2 Length = 117 | Back alignment and structure |
| >pdb|4G69|A Chain A, Structure Of The Human Discs Large 1 Pdz2 - Adenomatous Polyposis Coli Cytoskeletal Polarity Complex Length = 100 | Back alignment and structure |
| >pdb|2FE5|A Chain A, The Crystal Structure Of The Second Pdz Domain Of Human Dlg3 Length = 94 | Back alignment and structure |
| >pdb|2V90|A Chain A, Crystal Structure Of The 3rd Pdz Domain Of Intestine- And Kidney-enriched Pdz Domain Ikepp (pdzd3) Length = 96 | Back alignment and structure |
| >pdb|3O5N|A Chain A, Tetrahydroquinoline Carboxylates Are Potent Inhibitors Of The Shank Pdz Domain, A Putative Target In Autism Disorders Length = 112 | Back alignment and structure |
| >pdb|3NGH|A Chain A, Molecular Analysis Of The Interaction Of The Hdl Receptor Sr-Bi With The Adaptor Protein Pdzk1 Length = 106 | Back alignment and structure |
| >pdb|2AWW|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g With C-Terminal Glur-A Peptide Length = 105 | Back alignment and structure |
| >pdb|2AWX|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378s Length = 105 | Back alignment and structure |
| >pdb|2AWU|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g Length = 105 | Back alignment and structure |
| >pdb|2EDZ|A Chain A, Solution Structures Of The Pdz Domain Of Mus Musculus Pdz Domain-Containing Protein 1 Length = 114 | Back alignment and structure |
| >pdb|4AMH|A Chain A, Influence Of Circular Permutation On The Folding Pathway Of A Pdz Domain Length = 106 | Back alignment and structure |
| >pdb|2HE4|A Chain A, The Crystal Structure Of The Second Pdz Domain Of Human Nherf-2 (Slc9a3r2) Interacting With A Mode 1 Pdz Binding Motif Length = 90 | Back alignment and structure |
| >pdb|2G2L|A Chain A, Crystal Structure Of The Second Pdz Domain Of Sap97 In Complex With A Glur-A C-Terminal Peptide Length = 105 | Back alignment and structure |
| >pdb|1QLC|A Chain A, Solution Structure Of The Second Pdz Domain Of Postsynaptic Density-95 Length = 95 | Back alignment and structure |
| >pdb|2OMJ|A Chain A, Solution Structure Of Larg Pdz Domain Length = 89 | Back alignment and structure |
| >pdb|2I0L|A Chain A, X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The C- Terminal Peptide Of Hpv18 E6. Length = 84 | Back alignment and structure |
| >pdb|4F8K|A Chain A, Molecular Analysis Of The Interaction Between The Prostacyclin Receptor And The First Pdz Domain Of Pdzk1 Length = 109 | Back alignment and structure |
| >pdb|2EEJ|A Chain A, Solution Structure Of Fourth Pdz Domain Of Pdz Domain Containing Protein 1 Length = 96 | Back alignment and structure |
| >pdb|2D90|A Chain A, Solution Structure Of The Third Pdz Domain Of Pdz Domain Containing Protein 1 Length = 102 | Back alignment and structure |
| >pdb|3GSL|A Chain A, Crystal Structure Of Psd-95 Tandem Pdz Domains 1 And 2 Length = 196 | Back alignment and structure |
| >pdb|3ZRT|A Chain A, Crystal Structure Of Human Psd-95 Pdz1-2 Length = 199 | Back alignment and structure |
| >pdb|2KA9|A Chain A, Solution Structure Of Psd-95 Pdz12 Complexed With Cypin Peptide Length = 189 | Back alignment and structure |
| >pdb|1PDR|A Chain A, Crystal Structure Of The Third Pdz Domain From The Human Homolog Of Discs Large Protein Length = 99 | Back alignment and structure |
| >pdb|2I0I|A Chain A, X-Ray Crystal Structure Of Sap97 Pdz3 Bound To The C- Terminal Peptide Of Hpv18 E6 Length = 85 | Back alignment and structure |
| >pdb|2KQF|A Chain A, Solution Structure Of Mast205-Pdz Complexed With The C-Terminus Of A Rabies Virus G Protein Length = 96 | Back alignment and structure |
| >pdb|2PNT|A Chain A, Crystal Structure Of The Pdz Domain Of Human Grasp (Grp1) In Complex With The C-Terminal Peptide Of The Metabotropic Glutamate Receptor Type 1 Length = 98 | Back alignment and structure |
| >pdb|3TMH|A Chain A, Crystal Structure Of Dual-Specific A-Kinase Anchoring Protein 2 In Complex With Camp-Dependent Protein Kinase A Type Ii Alpha And Pdzk1 Length = 87 | Back alignment and structure |
| >pdb|2FNE|A Chain A, The Crystal Structure Of The 13th Pdz Domain Of Mpdz Length = 117 | Back alignment and structure |
| >pdb|2KOM|A Chain A, Solution Structure Of Humar Par-3b Pdz2 (Residues 451-549) Length = 121 | Back alignment and structure |
| >pdb|2YUY|A Chain A, Solution Structure Of Pdz Domain Of Rho Gtpase Activating Protein 21 Length = 126 | Back alignment and structure |
| >pdb|2EGK|A Chain A, Crystal Structure Of Tamalin Pdz-Intrinsic Ligand Fusion Protein Length = 101 | Back alignment and structure |
| >pdb|2VSP|A Chain A, Crystal Structure Of The Fourth Pdz Domain Of Pdz Domain- Containing Protein 1 Length = 91 | Back alignment and structure |
| >pdb|2EGO|A Chain A, Crystal Structure Of Tamalin Pdz Domain Length = 96 | Back alignment and structure |
| >pdb|2DMZ|A Chain A, Solution Structure Of The Third Pdz Domain Of Human Inad- Like Protein Length = 129 | Back alignment and structure |
| >pdb|2KOJ|A Chain A, Solution Structure Of Mouse Par-3 Pdz2 (Residues 450-558) Length = 111 | Back alignment and structure |
| >pdb|2R4H|B Chain B, Crystal Structure Of A C1190s Mutant Of The 6th Pdz Domain Of Human Membrane Associated Guanylate Kinase Length = 112 | Back alignment and structure |
| >pdb|2Z17|A Chain A, Crystal Sturcture Of Pdz Domain From Human Pleckstrin Homology, Sec7 Length = 104 | Back alignment and structure |
| >pdb|2DLU|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Inad- Like Protein Length = 111 | Back alignment and structure |
| >pdb|2DJT|A Chain A, Solution Structures Of The Pdz Domain Of Human Unnamed Protein Product Length = 104 | Back alignment and structure |
| >pdb|1WI2|A Chain A, Solution Structure Of The Pdz Domain From Riken Cdna 2700099c19 Length = 104 | Back alignment and structure |
| >pdb|3K1R|A Chain A, Structure Of Harmonin Npdz1 In Complex With The Sam-Pbm Of Sans Length = 192 | Back alignment and structure |
| >pdb|3PS4|A Chain A, Pdz Domain From Human Microtubule-Associated SerineTHREONINE-Protein Kinase 1 Length = 102 | Back alignment and structure |
| >pdb|2IWO|A Chain A, 12th Pdz Domain Of Multiple Pdz Domain Protein Mpdz (Casp Target) Length = 120 | Back alignment and structure |
| >pdb|1WFV|A Chain A, Solution Structure Of The Fifth Pdz Domain Of Human Membrane Associated Guanylate Kinase Inverted-2 (Kiaa0705 Protein) Length = 103 | Back alignment and structure |
| >pdb|2I04|A Chain A, X-Ray Crystal Structure Of Magi-1 Pdz1 Bound To The C- Terminal Peptide Of Hpv18 E6 Length = 85 | Back alignment and structure |
| >pdb|2W4F|A Chain A, Crystal Structure Of The First Pdz Domain Of Human Scrib1 Length = 97 | Back alignment and structure |
| >pdb|1X5Q|A Chain A, Solution Structure Of The First Pdz Domain Of Scribble Homolog Protein (Hscrib) Length = 110 | Back alignment and structure |
| >pdb|1UEW|A Chain A, Solution Structure Of The Forth Pdz Domain Of Human Atrophin-1 Interacting Protein 1 (Kiaa0705 Protein) Length = 114 | Back alignment and structure |
| >pdb|2KPK|A Chain A, Magi-1 Pdz1 Length = 129 | Back alignment and structure |
| >pdb|2FCF|A Chain A, The Crystal Structure Of The 7th Pdz Domain Of Mpdz (Mupp-1) Length = 103 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 373 | |||
| 3qe1_A | 107 | Sorting nexin-27, G protein-activated inward RECT | 2e-43 | |
| 1q3o_A | 109 | Shank1; PDZ, GKAP, peptide binding protein; 1.80A | 2e-35 | |
| 2d90_A | 102 | PDZ domain containing protein 1; structural genomi | 2e-35 | |
| 2v90_A | 96 | PDZ domain-containing protein 3; membrane, protein | 5e-35 | |
| 2eei_A | 106 | PDZ domain-containing protein 1; regulatory factor | 6e-35 | |
| 2jxo_A | 98 | Ezrin-radixin-moesin-binding phosphoprotein 50; nh | 8e-35 | |
| 3l4f_D | 132 | SH3 and multiple ankyrin repeat domains protein 1; | 2e-34 | |
| 3r68_A | 95 | Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P | 3e-34 | |
| 1g9o_A | 91 | NHE-RF; PDZ domain, complex, signaling protein; 1. | 3e-34 | |
| 3khf_A | 99 | Microtubule-associated serine/threonine-protein ki | 1e-33 | |
| 2he4_A | 90 | Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p | 1e-33 | |
| 2vsp_A | 91 | PDZ domain-containing protein 1; membrane, cytopla | 4e-33 | |
| 2ego_A | 96 | General receptor for phosphoinositides 1- associat | 7e-33 | |
| 2kjd_A | 128 | Sodium/hydrogen exchange regulatory cofactor NHE- | 3e-32 | |
| 3ngh_A | 106 | PDZ domain-containing protein 1; adaptor protein, | 6e-32 | |
| 2yuy_A | 126 | RHO GTPase activating protein 21; PDZ domain, stru | 6e-32 | |
| 2z17_A | 104 | Pleckstrin homology SEC7 and coiled-coil domains- | 8e-32 | |
| 2dls_A | 93 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 9e-31 | |
| 2kv8_A | 83 | RGS12, regulator of G-protein signaling 12; PDZ do | 2e-30 | |
| 2krg_A | 216 | Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a | 2e-30 | |
| 2edz_A | 114 | PDZ domain-containing protein 1; CFTR-associated p | 4e-30 | |
| 2f5y_A | 91 | Regulator of G-protein signalling 3 isoform 1; PDZ | 1e-29 | |
| 1vae_A | 111 | Rhophilin 2, rhophilin, RHO GTPase binding protein | 7e-29 | |
| 1um7_A | 113 | Synapse-associated protein 102; PDZ, discs large h | 1e-28 | |
| 2vsv_A | 109 | Rhophilin-2; scaffold protein, RHO GTPase binding, | 8e-28 | |
| 1x5q_A | 110 | LAP4 protein; PDZ domain, scribble homolog protein | 1e-27 | |
| 1whd_A | 100 | RGS3, regulator of G-protein signaling 3; PDZ doma | 2e-27 | |
| 3i4w_A | 104 | Disks large homolog 4; alpha and beta protein, alt | 1e-26 | |
| 2w4f_A | 97 | Protein LAP4; structural protein, phosphoprotein, | 1e-26 | |
| 2vz5_A | 139 | TAX1-binding protein 3; WNT signaling pathway, pro | 2e-26 | |
| 1tp5_A | 119 | Presynaptic density protein 95; PDZ-peptide ligand | 2e-26 | |
| 1uew_A | 114 | Membrane associated guanylate kinase inverted-2 (M | 6e-26 | |
| 2ehr_A | 117 | INAD-like protein; PDZ domain, inadl protein, hina | 7e-26 | |
| 1x5n_A | 114 | Harmonin; PDZ domain, usher syndrome 1C protein, a | 3e-25 | |
| 3bpu_A | 88 | Membrane-associated guanylate kinase, WW and PDZ c | 3e-25 | |
| 1q7x_A | 108 | PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str | 4e-25 | |
| 1nf3_C | 128 | PAR-6B; semi-CRIB motif, switch I and II, PDZ doma | 5e-25 | |
| 1uit_A | 117 | Human discs large 5 protein; PDZ domain, HDLG5, ma | 5e-25 | |
| 2dkr_A | 93 | LIN-7 homolog B; LIN-7B, PDZ, structural genomics, | 8e-25 | |
| 1m5z_A | 91 | GRIP, AMPA receptor interacting protein; six beta- | 1e-24 | |
| 1r6j_A | 82 | Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap | 3e-24 | |
| 1d5g_A | 96 | Human phosphatase HPTP1E; protein-peptide complex, | 3e-24 | |
| 2eeh_A | 100 | PDZ domain-containing protein 7; structural genomi | 7e-24 | |
| 3k1r_A | 192 | Harmonin; protein-protein complex, alternative spl | 8e-24 | |
| 2fcf_A | 103 | Multiple PDZ domain protein; adaptor molecule, pro | 1e-23 | |
| 2iwq_A | 123 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 3e-23 | |
| 1um1_A | 110 | KIAA1849 protein, RSGI RUH-007; PDZ domain, human | 3e-23 | |
| 1wha_A | 105 | KIAA0147 protein, scribble; PDZ domain, cellular s | 4e-23 | |
| 1uez_A | 101 | KIAA1526 protein; PDZ domain, structural genomics, | 9e-23 | |
| 1y7n_A | 90 | Amyloid beta A4 precursor protein-binding family A | 1e-22 | |
| 3o46_A | 93 | Maguk P55 subfamily member 7; PDZ domain, structur | 1e-22 | |
| 2djt_A | 104 | Unnamed protein product; PDZ domain, structural ge | 1e-22 | |
| 1wf8_A | 107 | Neurabin-I; PDZ domain, structural genomics, NPPSF | 3e-22 | |
| 2eeg_A | 94 | PDZ and LIM domain protein 4; PDZ domain, structur | 4e-22 | |
| 1uf1_A | 128 | KIAA1526 protein; PDZ domain, structural genomics, | 5e-22 | |
| 1v62_A | 117 | KIAA1719 protein; structural genomics, synaptic tr | 7e-22 | |
| 1wi2_A | 104 | Riken cDNA 2700099C19; structural genomics, riken | 2e-21 | |
| 1wf7_A | 103 | Enigma homologue protein; PDZ domain, structural g | 3e-21 | |
| 1uhp_A | 107 | Hypothetical protein KIAA1095; PDZ domain, semapho | 3e-21 | |
| 2dc2_A | 103 | GOPC, golgi associated PDZ and coiled-coil motif c | 5e-21 | |
| 2opg_A | 98 | Multiple PDZ domain protein; structural protein, s | 5e-21 | |
| 1wfv_A | 103 | Membrane associated guanylate kinase inverted-2; a | 5e-21 | |
| 2r4h_A | 112 | Membrane-associated guanylate kinase, WW and PDZ c | 6e-21 | |
| 1rgw_A | 85 | ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, | 7e-21 | |
| 2eno_A | 120 | Synaptojanin-2-binding protein; mitochondrial oute | 7e-21 | |
| 2jik_A | 101 | Synaptojanin-2 binding protein; transmembrane, out | 8e-21 | |
| 1n7e_A | 97 | AMPA receptor interacting protein GRIP; PDZ, prote | 8e-21 | |
| 3gsl_A | 196 | Disks large homolog 4; PDZ domain, tandem, PSD-95, | 8e-21 | |
| 3gsl_A | 196 | Disks large homolog 4; PDZ domain, tandem, PSD-95, | 9e-18 | |
| 2dmz_A | 129 | INAD-like protein; PDZ domain, inadl protein, hina | 1e-20 | |
| 2cs5_A | 119 | Tyrosine-protein phosphatase, non-receptor type 4; | 1e-20 | |
| 2fne_A | 117 | Multiple PDZ domain protein; structural protein, s | 1e-20 | |
| 1v5l_A | 103 | PDZ and LIM domain 3; actinin alpha 2 associated L | 1e-20 | |
| 2dm8_A | 116 | INAD-like protein; PDZ domain, inadl protein, hina | 2e-20 | |
| 2gzv_A | 114 | PRKCA-binding protein; protein kinase C, PDZ domai | 2e-20 | |
| 2d8i_A | 114 | T-cell lymphoma invasion and metastasis 1 variant; | 2e-20 | |
| 2qt5_A | 200 | Glutamate receptor-interacting protein 1; PDZ-pept | 2e-20 | |
| 2qt5_A | 200 | Glutamate receptor-interacting protein 1; PDZ-pept | 7e-20 | |
| 1ujv_A | 96 | Membrane associated guanylate kinase inverted-2 (M | 2e-20 | |
| 2dlu_A | 111 | INAD-like protein; PDZ domain, inadl protein, hina | 3e-20 | |
| 2jil_A | 97 | GRIP1 protein, glutamate receptor interacting prot | 3e-20 | |
| 2edv_A | 96 | FERM and PDZ domain-containing protein 1; cytoskel | 3e-20 | |
| 2iwn_A | 97 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 3e-20 | |
| 2g5m_B | 113 | Neurabin-2; spinophilin, PDZ domain, CNS, synaptic | 3e-20 | |
| 2iwo_A | 120 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 3e-20 | |
| 1vb7_A | 94 | PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, | 5e-20 | |
| 2awx_A | 105 | Synapse associated protein 97; membrane protein, s | 6e-20 | |
| 1i16_A | 130 | Interleukin 16, LCF; cytokine, lymphocyte chemoatt | 6e-20 | |
| 2fe5_A | 94 | Presynaptic protein SAP102; PDZ domain, DLG3, huma | 6e-20 | |
| 2uzc_A | 88 | Human pdlim5, PDZ and LIM domain 5; metal-binding, | 7e-20 | |
| 1uju_A | 111 | Scribble; PDZ domain, cellular signaling, structur | 7e-20 | |
| 1v5q_A | 122 | GRIP1 homolog, glutamate receptor interacting prot | 8e-20 | |
| 3nfk_A | 107 | Tyrosine-protein phosphatase non-receptor type 4; | 9e-20 | |
| 1uep_A | 103 | Membrane associated guanylate kinase inverted-2 (M | 1e-19 | |
| 2pa1_A | 87 | PDZ and LIM domain protein 2; PDZ domain, structur | 1e-19 | |
| 2byg_A | 117 | Channel associated protein of synapse-110; DLG2, P | 1e-19 | |
| 2eaq_A | 90 | LIM domain only protein 7; conserved hypothetical | 1e-19 | |
| 2koj_A | 111 | Partitioning defective 3 homolog; PDZ domain, stru | 2e-19 | |
| 1ihj_A | 98 | INAD; intermolecular disulfide bond, PDZ domain, s | 2e-19 | |
| 2q3g_A | 89 | PDZ and LIM domain protein 7; structural genomics, | 2e-19 | |
| 2i1n_A | 102 | Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig | 2e-19 | |
| 1ujd_A | 117 | KIAA0559 protein; PDZ domain, structural genomics, | 3e-19 | |
| 3soe_A | 113 | Membrane-associated guanylate kinase, WW and PDZ c | 3e-19 | |
| 2jre_A | 108 | C60-1 PDZ domain peptide; de novo protein; NMR {Sy | 3e-19 | |
| 1b8q_A | 127 | Protein (neuronal nitric oxide synthase); PDZ doma | 4e-19 | |
| 3b76_A | 118 | E3 ubiquitin-protein ligase LNX; PDZ, bound ligand | 5e-19 | |
| 1qav_A | 90 | Alpha-1 syntrophin (residues 77-171); beta-finger, | 6e-19 | |
| 2lob_A | 112 | Golgi-associated PDZ and coiled-coil motif-contai | 6e-19 | |
| 2kpk_A | 129 | Membrane-associated guanylate kinase, WW and PDZ c | 6e-19 | |
| 2daz_A | 124 | INAD-like protein; PDZ domain, inadl protein, hina | 7e-19 | |
| 3egg_C | 170 | Spinophilin; PP1, serine/threonine phosphatase, po | 8e-19 | |
| 1ueq_A | 123 | Membrane associated guanylate kinase inverted-2 (M | 9e-19 | |
| 2pkt_A | 91 | PDZ and LIM domain protein 1; PDZ domain, structur | 1e-18 | |
| 1p1d_A | 196 | PDZ45, glutamate receptor interacting protein; PDZ | 1e-18 | |
| 1p1d_A | 196 | PDZ45, glutamate receptor interacting protein; PDZ | 9e-17 | |
| 3axa_A | 106 | Afadin, nectin-3, protein AF-6; PDZ domain, fusion | 1e-18 | |
| 1mfg_A | 95 | ERB-B2 interacting protein; PDZ domain, protein-pe | 1e-18 | |
| 1x6d_A | 119 | Interleukin-16; PDZ domain, lymphocyte chemoattrac | 1e-18 | |
| 1qau_A | 112 | Neuronal nitric oxide synthase (residues 1-130); b | 2e-18 | |
| 1ufx_A | 103 | KIAA1526 protein; PDZ domain, structural genomics, | 2e-18 | |
| 2i04_A | 85 | Membrane-associated guanylate kinase, WW and PDZ d | 2e-18 | |
| 1va8_A | 113 | Maguk P55 subfamily member 5; PDZ domain, palmitoy | 2e-18 | |
| 1wif_A | 126 | RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s | 2e-18 | |
| 2h2b_A | 107 | Tight junction protein ZO-1; PDZ domain, phage der | 3e-18 | |
| 1v6b_A | 118 | Harmonin isoform A1; structural genomics, usher sy | 3e-18 | |
| 2qg1_A | 92 | Multiple PDZ domain protein; MPDZ, MUPP1, structur | 4e-18 | |
| 2q9v_A | 90 | Membrane-associated guanylate kinase, WW and PDZ c | 4e-18 | |
| 2kom_A | 121 | Partitioning defective 3 homolog; PAR-3B, PDZ doma | 4e-18 | |
| 2yt7_A | 101 | Amyloid beta A4 precursor protein-binding family A | 5e-18 | |
| 3cyy_A | 92 | Tight junction protein ZO-1; protein-ligand comple | 5e-18 | |
| 3tsv_A | 124 | Tight junction protein ZO-1; PDZ, scaffolding, JAM | 7e-18 | |
| 3hpk_A | 125 | Protein interacting with PRKCA 1; oxidized, PDZ do | 1e-17 | |
| 1n7t_A | 103 | 99-MER peptide of densin-180-like protein; PDZ dom | 1e-17 | |
| 2vwr_A | 95 | Ligand of NUMB protein X 2; protein-binding, metal | 1e-17 | |
| 1w9e_A | 166 | Syntenin 1; cell adhesion, adhesion/complex, PDZ d | 2e-17 | |
| 1w9e_A | 166 | Syntenin 1; cell adhesion, adhesion/complex, PDZ d | 1e-14 | |
| 2d92_A | 108 | INAD-like protein; PDZ domain, inadl protein, hina | 3e-17 | |
| 2csj_A | 117 | TJP2 protein; PDZ domain, structural genomics, NPP | 6e-17 | |
| 2db5_A | 128 | INAD-like protein; PDZ domain, hinadl, PALS1- asso | 1e-16 | |
| 3kzd_A | 94 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 3e-16 | |
| 3e17_A | 88 | Tight junction protein ZO-2; domain swapping, alte | 3e-16 | |
| 3gge_A | 95 | PDZ domain-containing protein GIPC2; structural ge | 4e-16 | |
| 2o2t_A | 117 | Multiple PDZ domain protein; structural protein, s | 6e-16 | |
| 1wi4_A | 109 | Synip, syntaxin binding protein 4; syntaxin4-inter | 7e-16 | |
| 2ejy_A | 97 | 55 kDa erythrocyte membrane protein; GPC, maguk, P | 8e-16 | |
| 2qkv_A | 96 | Inactivation-NO-after-potential D protein; PDZ dom | 1e-15 | |
| 1wg6_A | 127 | Hypothetical protein (riken cDNA 2810455B10); stru | 1e-15 | |
| 3cbz_A | 108 | Dishevelled-2; PDZ domain, phage derived high affi | 2e-15 | |
| 2la8_A | 106 | Inactivation-NO-after-potential D protein, KON-TI | 2e-15 | |
| 2rcz_A | 81 | Tight junction protein ZO-1; PDZ, domain-swapping, | 3e-15 | |
| 3lui_A | 115 | Sorting nexin-17, SNX17; PX domain, endosome, phos | 3e-15 | |
| 1wfg_A | 131 | Regulating synaptic membrane exocytosis protein 2; | 4e-15 | |
| 1kwa_A | 88 | Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca | 5e-15 | |
| 2edp_A | 100 | Fragment, shroom family member 4; APX/shroom famil | 7e-15 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 8e-15 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 9e-15 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 2e-06 | |
| 3suz_A | 388 | Amyloid beta A4 precursor protein-binding family 2 | 9e-15 | |
| 3suz_A | 388 | Amyloid beta A4 precursor protein-binding family 2 | 1e-10 | |
| 3r0h_A | 206 | INAD, inactivation-NO-after-potential D protein; p | 5e-14 | |
| 3r0h_A | 206 | INAD, inactivation-NO-after-potential D protein; p | 4e-11 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 3e-12 | |
| 1wh1_A | 124 | KIAA1095 protein; PDZ domain, structural genomics, | 4e-12 | |
| 1z87_A | 263 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 9e-12 | |
| 2e7k_A | 91 | Maguk P55 subfamily member 2; PDZ domain, MPP2 pro | 3e-11 | |
| 3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 9e-11 | |
| 2qbw_A | 195 | PDZ-fibronectin fusion protein; fibronectin PDZ, u | 3e-09 | |
| 2ett_A | 128 | Sorting nexin-22; PX domain, BC019655, SNX22_human | 4e-09 | |
| 2pzd_A | 113 | Serine protease HTRA2; PDZ domain, apoptosis, mito | 5e-09 | |
| 1lcy_A | 325 | HTRA2 serine protease; apoptosis, PDZ domain, casp | 2e-08 | |
| 3num_A | 332 | Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom | 4e-08 | |
| 2v14_A | 134 | Kinesin-like motor protein C20ORF23; plus-END kine | 5e-08 | |
| 1xte_A | 154 | Serine/threonine-protein kinase SGK3; CISK, PX dom | 5e-08 | |
| 2p3w_A | 112 | Probable serine protease HTRA3; PDZ domain, phage | 1e-07 | |
| 2zpm_A | 91 | Regulator of sigma E protease; metalloproteinase, | 3e-07 | |
| 1y8t_A | 324 | Hypothetical protein RV0983; serine protease, stru | 4e-07 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 7e-07 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 3e-05 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 8e-07 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 3e-05 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 1e-06 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 3e-05 | |
| 2yub_A | 118 | LIMK-2, LIM domain kinase 2; PDZ domain, structura | 2e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-04 | |
| 3id1_A | 95 | Regulator of sigma E protease; hydrolase, cell inn | 3e-06 | |
| 1te0_A | 318 | Protease DEGS; two domains, serine protease, PDZ, | 5e-06 | |
| 2kl1_A | 94 | YLBL protein; structure genomics, structural genom | 6e-06 | |
| 2kjp_A | 91 | Uncharacterized protein YLBL; mixed alpha-beta pro | 9e-06 | |
| 3k50_A | 403 | Putative S41 protease; structural genomics, joint | 1e-05 | |
| 2hga_A | 125 | Conserved protein MTH1368; GFT structural genomics | 2e-05 | |
| 1fc6_A | 388 | Photosystem II D1 protease; D1 C-terminal processi | 2e-05 | |
| 4fgm_A | 597 | Aminopeptidase N family protein; structural genomi | 3e-05 | |
| 3stj_A | 345 | Protease DEGQ; serine protease, PDZ domain, protea | 4e-05 | |
| 3i18_A | 100 | LMO2051 protein; alpha-beta protein, structural ge | 5e-05 | |
| 2l97_A | 134 | HTRA, putative serine protease; HTRA-PDZ, protein | 6e-05 | |
| 3p0c_A | 130 | Nischarin; structural genomics, structural genomic | 2e-04 | |
| 2i4s_A | 105 | General secretion pathway protein C; EPSC, GSPC, P | 3e-04 | |
| 3rle_A | 209 | Golgi reassembly-stacking protein 2; PDZ, tether, | 3e-04 | |
| 3rle_A | 209 | Golgi reassembly-stacking protein 2; PDZ, tether, | 4e-04 | |
| 2i6v_A | 87 | General secretion pathway protein C; EPSC, GSPC, P | 8e-04 |
| >1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 | Back alignment and structure |
|---|
| >2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 | Back alignment and structure |
|---|
| >2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 | Back alignment and structure |
|---|
| >3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 | Back alignment and structure |
|---|
| >1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 | Back alignment and structure |
|---|
| >3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 | Back alignment and structure |
|---|
| >2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 | Back alignment and structure |
|---|
| >2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 | Back alignment and structure |
|---|
| >2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 | Back alignment and structure |
|---|
| >2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 | Back alignment and structure |
|---|
| >2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 | Back alignment and structure |
|---|
| >2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 | Back alignment and structure |
|---|
| >2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 | Back alignment and structure |
|---|
| >2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 | Back alignment and structure |
|---|
| >1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 | Back alignment and structure |
|---|
| >1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 | Back alignment and structure |
|---|
| >2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 | Back alignment and structure |
|---|
| >1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 | Back alignment and structure |
|---|
| >3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 | Back alignment and structure |
|---|
| >2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 | Back alignment and structure |
|---|
| >1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 | Back alignment and structure |
|---|
| >1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 | Back alignment and structure |
|---|
| >2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 | Back alignment and structure |
|---|
| >3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 | Back alignment and structure |
|---|
| >1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 | Back alignment and structure |
|---|
| >1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 | Back alignment and structure |
|---|
| >2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 | Back alignment and structure |
|---|
| >1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 | Back alignment and structure |
|---|
| >1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 | Back alignment and structure |
|---|
| >1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 | Back alignment and structure |
|---|
| >2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 | Back alignment and structure |
|---|
| >2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 | Back alignment and structure |
|---|
| >2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 | Back alignment and structure |
|---|
| >1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 | Back alignment and structure |
|---|
| >1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 | Back alignment and structure |
|---|
| >1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 | Back alignment and structure |
|---|
| >3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 | Back alignment and structure |
|---|
| >2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 | Back alignment and structure |
|---|
| >2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 | Back alignment and structure |
|---|
| >1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 | Back alignment and structure |
|---|
| >1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 | Back alignment and structure |
|---|
| >1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 | Back alignment and structure |
|---|
| >1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 | Back alignment and structure |
|---|
| >2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 | Back alignment and structure |
|---|
| >2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 | Back alignment and structure |
|---|
| >2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 | Back alignment and structure |
|---|
| >1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 | Back alignment and structure |
|---|
| >2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 | Back alignment and structure |
|---|
| >2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 | Back alignment and structure |
|---|
| >2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 | Back alignment and structure |
|---|
| >1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 | Back alignment and structure |
|---|
| >2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 | Back alignment and structure |
|---|
| >2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 | Back alignment and structure |
|---|
| >1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 | Back alignment and structure |
|---|
| >2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 | Back alignment and structure |
|---|
| >2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 | Back alignment and structure |
|---|
| >1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 | Back alignment and structure |
|---|
| >2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 | Back alignment and structure |
|---|
| >1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 | Back alignment and structure |
|---|
| >2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 | Back alignment and structure |
|---|
| >2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 | Back alignment and structure |
|---|
| >1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 | Back alignment and structure |
|---|
| >3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 | Back alignment and structure |
|---|
| >1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 | Back alignment and structure |
|---|
| >2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 | Back alignment and structure |
|---|
| >2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 | Back alignment and structure |
|---|
| >2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 | Back alignment and structure |
|---|
| >1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 | Back alignment and structure |
|---|
| >2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 | Back alignment and structure |
|---|
| >1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 | Back alignment and structure |
|---|
| >3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 | Back alignment and structure |
|---|
| >1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 | Back alignment and structure |
|---|
| >3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 | Back alignment and structure |
|---|
| >2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 | Back alignment and structure |
|---|
| >2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 | Back alignment and structure |
|---|
| >1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 | Back alignment and structure |
|---|
| >2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 | Back alignment and structure |
|---|
| >1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 | Back alignment and structure |
|---|
| >1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 | Back alignment and structure |
|---|
| >3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 | Back alignment and structure |
|---|
| >1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 | Back alignment and structure |
|---|
| >1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 | Back alignment and structure |
|---|
| >1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 | Back alignment and structure |
|---|
| >1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 | Back alignment and structure |
|---|
| >2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 | Back alignment and structure |
|---|
| >1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 | Back alignment and structure |
|---|
| >2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 | Back alignment and structure |
|---|
| >1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 | Back alignment and structure |
|---|
| >2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 | Back alignment and structure |
|---|
| >3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 | Back alignment and structure |
|---|
| >1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 | Back alignment and structure |
|---|
| >2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 | Back alignment and structure |
|---|
| >1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 | Back alignment and structure |
|---|
| >2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 | Back alignment and structure |
|---|
| >2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 | Back alignment and structure |
|---|
| >3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 | Back alignment and structure |
|---|
| >2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 | Back alignment and structure |
|---|
| >2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 | Back alignment and structure |
|---|
| >1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 | Back alignment and structure |
|---|
| >3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 | Back alignment and structure |
|---|
| >2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 | Back alignment and structure |
|---|
| >2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 | Back alignment and structure |
|---|
| >3lui_A Sorting nexin-17, SNX17; PX domain, endosome, phosphoprotein, P transport, transport; 1.80A {Homo sapiens} PDB: 3fog_A Length = 115 | Back alignment and structure |
|---|
| >1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 | Back alignment and structure |
|---|
| >1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 | Back alignment and structure |
|---|
| >2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 | Back alignment and structure |
|---|
| >3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 | Back alignment and structure |
|---|
| >3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 | Back alignment and structure |
|---|
| >1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 | Back alignment and structure |
|---|
| >1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 | Back alignment and structure |
|---|
| >2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 | Back alignment and structure |
|---|
| >2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 | Back alignment and structure |
|---|
| >2ett_A Sorting nexin-22; PX domain, BC019655, SNX22_human, HS.157607, structural genomics,protein structure initiative PSI; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Length = 113 | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 | Back alignment and structure |
|---|
| >2v14_A Kinesin-like motor protein C20ORF23; plus-END kinesin complex, transport protein, phosphatidylinositol 3-phosphate binding, nucleotide-binding; 2.20A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >1xte_A Serine/threonine-protein kinase SGK3; CISK, PX domain, transferase; 1.60A {Mus musculus} SCOP: d.189.1.1 PDB: 1xtn_A Length = 154 | Back alignment and structure |
|---|
| >2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Length = 91 | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Length = 324 | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 | Back alignment and structure |
|---|
| >2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Length = 95 | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Length = 318 | Back alignment and structure |
|---|
| >2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Length = 94 | Back alignment and structure |
|---|
| >2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Length = 91 | Back alignment and structure |
|---|
| >3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Length = 403 | Back alignment and structure |
|---|
| >2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 | Back alignment and structure |
|---|
| >1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Length = 388 | Back alignment and structure |
|---|
| >4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Length = 597 | Back alignment and structure |
|---|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Length = 345 | Back alignment and structure |
|---|
| >3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Length = 100 | Back alignment and structure |
|---|
| >2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Length = 134 | Back alignment and structure |
|---|
| >3p0c_A Nischarin; structural genomics, structural genomics consortium, SGC, PX signaling protein; 2.27A {Homo sapiens} Length = 130 | Back alignment and structure |
|---|
| >2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Length = 105 | Back alignment and structure |
|---|
| >3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} Length = 209 | Back alignment and structure |
|---|
| >3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} Length = 209 | Back alignment and structure |
|---|
| >2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Length = 87 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 373 | |||
| 3qe1_A | 107 | Sorting nexin-27, G protein-activated inward RECT | 99.65 | |
| 1r6j_A | 82 | Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap | 99.61 | |
| 2he4_A | 90 | Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p | 99.57 | |
| 3l4f_D | 132 | SH3 and multiple ankyrin repeat domains protein 1; | 99.54 | |
| 2vsp_A | 91 | PDZ domain-containing protein 1; membrane, cytopla | 99.53 | |
| 3r68_A | 95 | Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P | 99.53 | |
| 2v90_A | 96 | PDZ domain-containing protein 3; membrane, protein | 99.53 | |
| 3i4w_A | 104 | Disks large homolog 4; alpha and beta protein, alt | 99.52 | |
| 2f5y_A | 91 | Regulator of G-protein signalling 3 isoform 1; PDZ | 99.51 | |
| 1g9o_A | 91 | NHE-RF; PDZ domain, complex, signaling protein; 1. | 99.51 | |
| 2iwo_A | 120 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 99.5 | |
| 2dkr_A | 93 | LIN-7 homolog B; LIN-7B, PDZ, structural genomics, | 99.49 | |
| 1d5g_A | 96 | Human phosphatase HPTP1E; protein-peptide complex, | 99.49 | |
| 2ego_A | 96 | General receptor for phosphoinositides 1- associat | 99.48 | |
| 2d92_A | 108 | INAD-like protein; PDZ domain, inadl protein, hina | 99.48 | |
| 2fne_A | 117 | Multiple PDZ domain protein; structural protein, s | 99.48 | |
| 1uhp_A | 107 | Hypothetical protein KIAA1095; PDZ domain, semapho | 99.48 | |
| 1m5z_A | 91 | GRIP, AMPA receptor interacting protein; six beta- | 99.48 | |
| 2jik_A | 101 | Synaptojanin-2 binding protein; transmembrane, out | 99.48 | |
| 1qav_A | 90 | Alpha-1 syntrophin (residues 77-171); beta-finger, | 99.48 | |
| 3b76_A | 118 | E3 ubiquitin-protein ligase LNX; PDZ, bound ligand | 99.47 | |
| 2awx_A | 105 | Synapse associated protein 97; membrane protein, s | 99.47 | |
| 2fe5_A | 94 | Presynaptic protein SAP102; PDZ domain, DLG3, huma | 99.46 | |
| 2d90_A | 102 | PDZ domain containing protein 1; structural genomi | 99.46 | |
| 2q9v_A | 90 | Membrane-associated guanylate kinase, WW and PDZ c | 99.46 | |
| 1q3o_A | 109 | Shank1; PDZ, GKAP, peptide binding protein; 1.80A | 99.46 | |
| 1um1_A | 110 | KIAA1849 protein, RSGI RUH-007; PDZ domain, human | 99.46 | |
| 1ufx_A | 103 | KIAA1526 protein; PDZ domain, structural genomics, | 99.46 | |
| 2jil_A | 97 | GRIP1 protein, glutamate receptor interacting prot | 99.45 | |
| 2dls_A | 93 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 99.45 | |
| 4e34_A | 87 | Golgi-associated PDZ and coiled-coil motif-contai | 99.45 | |
| 2i1n_A | 102 | Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig | 99.45 | |
| 2vsv_A | 109 | Rhophilin-2; scaffold protein, RHO GTPase binding, | 99.45 | |
| 2eei_A | 106 | PDZ domain-containing protein 1; regulatory factor | 99.45 | |
| 2opg_A | 98 | Multiple PDZ domain protein; structural protein, s | 99.44 | |
| 1wi4_A | 109 | Synip, syntaxin binding protein 4; syntaxin4-inter | 99.44 | |
| 2dc2_A | 103 | GOPC, golgi associated PDZ and coiled-coil motif c | 99.44 | |
| 2i04_A | 85 | Membrane-associated guanylate kinase, WW and PDZ d | 99.43 | |
| 2jxo_A | 98 | Ezrin-radixin-moesin-binding phosphoprotein 50; nh | 99.43 | |
| 2uzc_A | 88 | Human pdlim5, PDZ and LIM domain 5; metal-binding, | 99.43 | |
| 2r4h_A | 112 | Membrane-associated guanylate kinase, WW and PDZ c | 99.43 | |
| 3o46_A | 93 | Maguk P55 subfamily member 7; PDZ domain, structur | 99.42 | |
| 2djt_A | 104 | Unnamed protein product; PDZ domain, structural ge | 99.42 | |
| 2kv8_A | 83 | RGS12, regulator of G-protein signaling 12; PDZ do | 99.42 | |
| 2byg_A | 117 | Channel associated protein of synapse-110; DLG2, P | 99.42 | |
| 1ihj_A | 98 | INAD; intermolecular disulfide bond, PDZ domain, s | 99.42 | |
| 1wi2_A | 104 | Riken cDNA 2700099C19; structural genomics, riken | 99.42 | |
| 2eeg_A | 94 | PDZ and LIM domain protein 4; PDZ domain, structur | 99.41 | |
| 1wha_A | 105 | KIAA0147 protein, scribble; PDZ domain, cellular s | 99.41 | |
| 3ngh_A | 106 | PDZ domain-containing protein 1; adaptor protein, | 99.41 | |
| 2daz_A | 124 | INAD-like protein; PDZ domain, inadl protein, hina | 99.41 | |
| 1ujd_A | 117 | KIAA0559 protein; PDZ domain, structural genomics, | 99.4 | |
| 1wf8_A | 107 | Neurabin-I; PDZ domain, structural genomics, NPPSF | 99.4 | |
| 2vwr_A | 95 | Ligand of NUMB protein X 2; protein-binding, metal | 99.4 | |
| 1uep_A | 103 | Membrane associated guanylate kinase inverted-2 (M | 99.4 | |
| 1ueq_A | 123 | Membrane associated guanylate kinase inverted-2 (M | 99.4 | |
| 2qg1_A | 92 | Multiple PDZ domain protein; MPDZ, MUPP1, structur | 99.4 | |
| 3axa_A | 106 | Afadin, nectin-3, protein AF-6; PDZ domain, fusion | 99.4 | |
| 1n7e_A | 97 | AMPA receptor interacting protein GRIP; PDZ, prote | 99.39 | |
| 1kwa_A | 88 | Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca | 99.39 | |
| 2eno_A | 120 | Synaptojanin-2-binding protein; mitochondrial oute | 99.39 | |
| 3khf_A | 99 | Microtubule-associated serine/threonine-protein ki | 99.39 | |
| 1tp5_A | 119 | Presynaptic density protein 95; PDZ-peptide ligand | 99.39 | |
| 1i16_A | 130 | Interleukin 16, LCF; cytokine, lymphocyte chemoatt | 99.39 | |
| 1q7x_A | 108 | PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str | 99.39 | |
| 1rgw_A | 85 | ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, | 99.39 | |
| 1wf7_A | 103 | Enigma homologue protein; PDZ domain, structural g | 99.38 | |
| 2q3g_A | 89 | PDZ and LIM domain protein 7; structural genomics, | 99.38 | |
| 2pa1_A | 87 | PDZ and LIM domain protein 2; PDZ domain, structur | 99.38 | |
| 3hpk_A | 125 | Protein interacting with PRKCA 1; oxidized, PDZ do | 99.38 | |
| 2kpk_A | 129 | Membrane-associated guanylate kinase, WW and PDZ c | 99.37 | |
| 3cbz_A | 108 | Dishevelled-2; PDZ domain, phage derived high affi | 99.37 | |
| 2db5_A | 128 | INAD-like protein; PDZ domain, hinadl, PALS1- asso | 99.37 | |
| 2ehr_A | 117 | INAD-like protein; PDZ domain, inadl protein, hina | 99.37 | |
| 2yuy_A | 126 | RHO GTPase activating protein 21; PDZ domain, stru | 99.37 | |
| 3bpu_A | 88 | Membrane-associated guanylate kinase, WW and PDZ c | 99.36 | |
| 2g5m_B | 113 | Neurabin-2; spinophilin, PDZ domain, CNS, synaptic | 99.36 | |
| 3gge_A | 95 | PDZ domain-containing protein GIPC2; structural ge | 99.36 | |
| 2pkt_A | 91 | PDZ and LIM domain protein 1; PDZ domain, structur | 99.36 | |
| 2o2t_A | 117 | Multiple PDZ domain protein; structural protein, s | 99.36 | |
| 2koj_A | 111 | Partitioning defective 3 homolog; PDZ domain, stru | 99.36 | |
| 2dlu_A | 111 | INAD-like protein; PDZ domain, inadl protein, hina | 99.36 | |
| 1uew_A | 114 | Membrane associated guanylate kinase inverted-2 (M | 99.36 | |
| 2gzv_A | 114 | PRKCA-binding protein; protein kinase C, PDZ domai | 99.36 | |
| 1nf3_C | 128 | PAR-6B; semi-CRIB motif, switch I and II, PDZ doma | 99.36 | |
| 2qkv_A | 96 | Inactivation-NO-after-potential D protein; PDZ dom | 99.35 | |
| 2kjd_A | 128 | Sodium/hydrogen exchange regulatory cofactor NHE- | 99.35 | |
| 2yt7_A | 101 | Amyloid beta A4 precursor protein-binding family A | 99.35 | |
| 1uju_A | 111 | Scribble; PDZ domain, cellular signaling, structur | 99.35 | |
| 1va8_A | 113 | Maguk P55 subfamily member 5; PDZ domain, palmitoy | 99.34 | |
| 3sfj_A | 104 | TAX1-binding protein 3; PDZ:peptide complex, signa | 99.34 | |
| 1mfg_A | 95 | ERB-B2 interacting protein; PDZ domain, protein-pe | 99.34 | |
| 1x5q_A | 110 | LAP4 protein; PDZ domain, scribble homolog protein | 99.34 | |
| 2ejy_A | 97 | 55 kDa erythrocyte membrane protein; GPC, maguk, P | 99.34 | |
| 4amh_A | 106 | Disks large homolog 1; permutation, protein foldin | 99.33 | |
| 1wfv_A | 103 | Membrane associated guanylate kinase inverted-2; a | 99.33 | |
| 3soe_A | 113 | Membrane-associated guanylate kinase, WW and PDZ c | 99.33 | |
| 2vz5_A | 139 | TAX1-binding protein 3; WNT signaling pathway, pro | 99.33 | |
| 1v62_A | 117 | KIAA1719 protein; structural genomics, synaptic tr | 99.33 | |
| 2fcf_A | 103 | Multiple PDZ domain protein; adaptor molecule, pro | 99.33 | |
| 2jre_A | 108 | C60-1 PDZ domain peptide; de novo protein; NMR {Sy | 99.32 | |
| 2w4f_A | 97 | Protein LAP4; structural protein, phosphoprotein, | 99.32 | |
| 2e7k_A | 91 | Maguk P55 subfamily member 2; PDZ domain, MPP2 pro | 99.32 | |
| 1n7t_A | 103 | 99-MER peptide of densin-180-like protein; PDZ dom | 99.32 | |
| 3kzd_A | 94 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 99.32 | |
| 1um7_A | 113 | Synapse-associated protein 102; PDZ, discs large h | 99.31 | |
| 1vae_A | 111 | Rhophilin 2, rhophilin, RHO GTPase binding protein | 99.31 | |
| 3egg_C | 170 | Spinophilin; PP1, serine/threonine phosphatase, po | 99.31 | |
| 3k1r_A | 192 | Harmonin; protein-protein complex, alternative spl | 99.31 | |
| 2csj_A | 117 | TJP2 protein; PDZ domain, structural genomics, NPP | 99.3 | |
| 2kom_A | 121 | Partitioning defective 3 homolog; PAR-3B, PDZ doma | 99.3 | |
| 2eeh_A | 100 | PDZ domain-containing protein 7; structural genomi | 99.3 | |
| 2dm8_A | 116 | INAD-like protein; PDZ domain, inadl protein, hina | 99.29 | |
| 3nfk_A | 107 | Tyrosine-protein phosphatase non-receptor type 4; | 99.29 | |
| 2iwq_A | 123 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 99.29 | |
| 1wg6_A | 127 | Hypothetical protein (riken cDNA 2810455B10); stru | 99.29 | |
| 2edz_A | 114 | PDZ domain-containing protein 1; CFTR-associated p | 99.28 | |
| 1whd_A | 100 | RGS3, regulator of G-protein signaling 3; PDZ doma | 99.28 | |
| 2h2b_A | 107 | Tight junction protein ZO-1; PDZ domain, phage der | 99.28 | |
| 1v6b_A | 118 | Harmonin isoform A1; structural genomics, usher sy | 99.27 | |
| 2iwn_A | 97 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 99.27 | |
| 1ujv_A | 96 | Membrane associated guanylate kinase inverted-2 (M | 99.27 | |
| 2edv_A | 96 | FERM and PDZ domain-containing protein 1; cytoskel | 99.27 | |
| 2z17_A | 104 | Pleckstrin homology SEC7 and coiled-coil domains- | 99.27 | |
| 1wfg_A | 131 | Regulating synaptic membrane exocytosis protein 2; | 99.26 | |
| 2cs5_A | 119 | Tyrosine-protein phosphatase, non-receptor type 4; | 99.26 | |
| 3qik_A | 101 | Phosphatidylinositol 3,4,5-trisphosphate-dependen | 99.26 | |
| 3gsl_A | 196 | Disks large homolog 4; PDZ domain, tandem, PSD-95, | 99.26 | |
| 1x6d_A | 119 | Interleukin-16; PDZ domain, lymphocyte chemoattrac | 99.25 | |
| 1y7n_A | 90 | Amyloid beta A4 precursor protein-binding family A | 99.25 | |
| 1v5q_A | 122 | GRIP1 homolog, glutamate receptor interacting prot | 99.25 | |
| 1z87_A | 263 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 99.24 | |
| 2dmz_A | 129 | INAD-like protein; PDZ domain, inadl protein, hina | 99.24 | |
| 2la8_A | 106 | Inactivation-NO-after-potential D protein, KON-TI | 99.23 | |
| 3e17_A | 88 | Tight junction protein ZO-2; domain swapping, alte | 99.22 | |
| 1vb7_A | 94 | PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, | 99.22 | |
| 1wif_A | 126 | RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s | 99.22 | |
| 2edp_A | 100 | Fragment, shroom family member 4; APX/shroom famil | 99.2 | |
| 1qau_A | 112 | Neuronal nitric oxide synthase (residues 1-130); b | 99.2 | |
| 1uit_A | 117 | Human discs large 5 protein; PDZ domain, HDLG5, ma | 99.19 | |
| 2d8i_A | 114 | T-cell lymphoma invasion and metastasis 1 variant; | 99.19 | |
| 3r0h_A | 206 | INAD, inactivation-NO-after-potential D protein; p | 99.18 | |
| 1uez_A | 101 | KIAA1526 protein; PDZ domain, structural genomics, | 99.17 | |
| 3tsv_A | 124 | Tight junction protein ZO-1; PDZ, scaffolding, JAM | 99.16 | |
| 1b8q_A | 127 | Protein (neuronal nitric oxide synthase); PDZ doma | 99.16 | |
| 2eaq_A | 90 | LIM domain only protein 7; conserved hypothetical | 99.15 | |
| 2qt5_A | 200 | Glutamate receptor-interacting protein 1; PDZ-pept | 99.15 | |
| 1x5n_A | 114 | Harmonin; PDZ domain, usher syndrome 1C protein, a | 99.14 | |
| 3cyy_A | 92 | Tight junction protein ZO-1; protein-ligand comple | 99.14 | |
| 2lob_A | 112 | Golgi-associated PDZ and coiled-coil motif-contai | 98.75 | |
| 3gsl_A | 196 | Disks large homolog 4; PDZ domain, tandem, PSD-95, | 99.12 | |
| 1v5l_A | 103 | PDZ and LIM domain 3; actinin alpha 2 associated L | 99.12 | |
| 2krg_A | 216 | Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a | 99.11 | |
| 1p1d_A | 196 | PDZ45, glutamate receptor interacting protein; PDZ | 99.1 | |
| 1uf1_A | 128 | KIAA1526 protein; PDZ domain, structural genomics, | 99.06 | |
| 1w9e_A | 166 | Syntenin 1; cell adhesion, adhesion/complex, PDZ d | 99.05 | |
| 4eku_A | 392 | Protein-tyrosine kinase 2-beta; proline-rich tyros | 99.02 | |
| 3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 99.02 | |
| 1wh1_A | 124 | KIAA1095 protein; PDZ domain, structural genomics, | 99.01 | |
| 2yub_A | 118 | LIMK-2, LIM domain kinase 2; PDZ domain, structura | 99.01 | |
| 3r0h_A | 206 | INAD, inactivation-NO-after-potential D protein; p | 99.0 | |
| 2rcz_A | 81 | Tight junction protein ZO-1; PDZ, domain-swapping, | 99.0 | |
| 1ef1_A | 294 | Moesin; membrane, FERM domain, tail domain, membra | 99.0 | |
| 2qbw_A | 195 | PDZ-fibronectin fusion protein; fibronectin PDZ, u | 99.0 | |
| 4dxa_B | 322 | KREV interaction trapped protein 1; GTPase, FERM, | 98.98 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 98.97 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 98.96 | |
| 3ivf_A | 371 | Talin-1; FERM domain, cell membrane, cell projecti | 98.95 | |
| 2qt5_A | 200 | Glutamate receptor-interacting protein 1; PDZ-pept | 98.93 | |
| 1h4r_A | 314 | Merlin; FERM, neurofibromatosis, NF2, structural p | 98.93 | |
| 3au4_A | 555 | Myosin-X; protein-protein complex, motor protein c | 98.92 | |
| 3i18_A | 100 | LMO2051 protein; alpha-beta protein, structural ge | 98.87 | |
| 3qij_A | 296 | Protein 4.1; cytoskeleton, structural genomics, st | 98.82 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 98.81 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 98.77 | |
| 2al6_A | 375 | Focal adhesion kinase 1; transferase; 2.35A {Gallu | 98.77 | |
| 3id1_A | 95 | Regulator of sigma E protease; hydrolase, cell inn | 98.75 | |
| 3suz_A | 388 | Amyloid beta A4 precursor protein-binding family 2 | 98.74 | |
| 2kjp_A | 91 | Uncharacterized protein YLBL; mixed alpha-beta pro | 98.72 | |
| 2kl1_A | 94 | YLBL protein; structure genomics, structural genom | 98.7 | |
| 2zpm_A | 91 | Regulator of sigma E protease; metalloproteinase, | 98.67 | |
| 1p1d_A | 196 | PDZ45, glutamate receptor interacting protein; PDZ | 98.66 | |
| 2pzd_A | 113 | Serine protease HTRA2; PDZ domain, apoptosis, mito | 98.66 | |
| 2i6v_A | 87 | General secretion pathway protein C; EPSC, GSPC, P | 98.65 | |
| 2l97_A | 134 | HTRA, putative serine protease; HTRA-PDZ, protein | 98.63 | |
| 3pvl_A | 655 | Myosin VIIA isoform 1; protein complex, novel fold | 98.62 | |
| 2p3w_A | 112 | Probable serine protease HTRA3; PDZ domain, phage | 98.57 | |
| 2hga_A | 125 | Conserved protein MTH1368; GFT structural genomics | 98.53 | |
| 2i4s_A | 105 | General secretion pathway protein C; EPSC, GSPC, P | 98.47 | |
| 1w9e_A | 166 | Syntenin 1; cell adhesion, adhesion/complex, PDZ d | 98.39 | |
| 3rle_A | 209 | Golgi reassembly-stacking protein 2; PDZ, tether, | 98.37 | |
| 3stj_A | 345 | Protease DEGQ; serine protease, PDZ domain, protea | 98.33 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 98.28 | |
| 3suz_A | 388 | Amyloid beta A4 precursor protein-binding family 2 | 98.25 | |
| 1te0_A | 318 | Protease DEGS; two domains, serine protease, PDZ, | 98.25 | |
| 1y8t_A | 324 | Hypothetical protein RV0983; serine protease, stru | 98.24 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 98.24 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 98.23 | |
| 1fc6_A | 388 | Photosystem II D1 protease; D1 C-terminal processi | 98.23 | |
| 3rle_A | 209 | Golgi reassembly-stacking protein 2; PDZ, tether, | 98.21 | |
| 4fgm_A | 597 | Aminopeptidase N family protein; structural genomi | 98.2 | |
| 1lcy_A | 325 | HTRA2 serine protease; apoptosis, PDZ domain, casp | 98.18 | |
| 3qo6_A | 348 | Protease DO-like 1, chloroplastic; protease, HTRA, | 98.1 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 98.08 | |
| 3k50_A | 403 | Putative S41 protease; structural genomics, joint | 98.03 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 98.0 | |
| 3num_A | 332 | Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom | 97.89 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 97.58 | |
| 3lui_A | 115 | Sorting nexin-17, SNX17; PX domain, endosome, phos | 97.37 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 97.36 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 97.15 | |
| 4fln_A | 539 | Protease DO-like 2, chloroplastic; protease, DEG, | 97.08 | |
| 2wwe_A | 127 | Phosphoinositide-3-kinase, class 2, gamma polypept | 96.9 | |
| 1wgr_A | 100 | Growth factor receptor-bound protein 7; RA domain, | 96.76 | |
| 1mix_A | 206 | Talin; focal adhesion, integrin binding, FERM doma | 96.7 | |
| 4fln_A | 539 | Protease DO-like 2, chloroplastic; protease, DEG, | 96.19 | |
| 4f7g_A | 222 | Talin-1; alpha-helix bundle, integrin activation, | 96.02 | |
| 3iq2_A | 138 | Sorting nexin-7; SNX7, PHOX, protein signalling, S | 94.16 | |
| 4az9_A | 129 | Sorting nexin-24; protein transport; 1.75A {Homo s | 92.88 | |
| 3p0c_A | 130 | Nischarin; structural genomics, structural genomic | 92.59 | |
| 2csk_A | 146 | Sorting nexin 12; SNX12, PX domain, structural gen | 92.19 | |
| 2i4k_A | 128 | Sorting nexin-1, SNX1; 3-stranded beta sheet, 3 al | 92.04 | |
| 1ocs_A | 162 | Sorting nexin GRD19; sorting protein, PX-domain, y | 91.83 | |
| 4gmv_A | 281 | RAS-associated and pleckstrin homology domains-CO | 91.61 | |
| 1xte_A | 154 | Serine/threonine-protein kinase SGK3; CISK, PX dom | 91.17 | |
| 1kmd_A | 117 | VAM7P, vacuolar morphogenesis protein VAM7; PX dom | 90.7 | |
| 1wxa_A | 116 | Afadin, AF-6 protein; RAS-binding domain, ubiquiti | 90.16 | |
| 3ddc_B | 163 | RAS association domain-containing family protein; | 89.41 | |
| 1h6h_A | 143 | Neutrophil cytosol factor 4; PX domain; HET: PIB; | 87.81 | |
| 2ett_A | 128 | Sorting nexin-22; PX domain, BC019655, SNX22_human | 85.7 | |
| 2ar5_A | 121 | Phosphoinositide 3-kinase; PX domain, transferase; | 84.79 | |
| 3dyt_A | 366 | Sorting nexin-9; 3-helix bundle, BAR domain, PX do | 83.91 | |
| 2iwl_X | 140 | Phosphatidylinositol-4-phosphate 3-kinase C2 domai | 83.27 | |
| 3hpc_X | 161 | SNX5 protein; sprting nexin, PHOX, SNX5-PX, phosph | 81.05 | |
| 4akv_A | 386 | Sorting nexin-33; transport protein, organelle bio | 80.75 | |
| 2v14_A | 134 | Kinesin-like motor protein C20ORF23; plus-END kine | 80.16 |
| >1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A | Back alignment and structure |
|---|
| >2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A | Back alignment and structure |
|---|
| >3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A | Back alignment and structure |
|---|
| >3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* | Back alignment and structure |
|---|
| >2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A | Back alignment and structure |
|---|
| >2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A | Back alignment and structure |
|---|
| >2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A | Back alignment and structure |
|---|
| >2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A | Back alignment and structure |
|---|
| >2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A | Back alignment and structure |
|---|
| >2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A | Back alignment and structure |
|---|
| >1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A | Back alignment and structure |
|---|
| >3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A | Back alignment and structure |
|---|
| >2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A | Back alignment and structure |
|---|
| >2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* | Back alignment and structure |
|---|
| >1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A | Back alignment and structure |
|---|
| >4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A | Back alignment and structure |
|---|
| >2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A | Back alignment and structure |
|---|
| >2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} | Back alignment and structure |
|---|
| >2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 | Back alignment and structure |
|---|
| >2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 | Back alignment and structure |
|---|
| >2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A | Back alignment and structure |
|---|
| >1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A | Back alignment and structure |
|---|
| >1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A | Back alignment and structure |
|---|
| >1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A | Back alignment and structure |
|---|
| >1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 | Back alignment and structure |
|---|
| >1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A | Back alignment and structure |
|---|
| >1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} | Back alignment and structure |
|---|
| >2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A | Back alignment and structure |
|---|
| >3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A | Back alignment and structure |
|---|
| >2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A | Back alignment and structure |
|---|
| >3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A | Back alignment and structure |
|---|
| >2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* | Back alignment and structure |
|---|
| >2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A | Back alignment and structure |
|---|
| >2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A | Back alignment and structure |
|---|
| >1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A | Back alignment and structure |
|---|
| >2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A | Back alignment and structure |
|---|
| >2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A | Back alignment and structure |
|---|
| >1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A | Back alignment and structure |
|---|
| >1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A | Back alignment and structure |
|---|
| >4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A | Back alignment and structure |
|---|
| >1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A | Back alignment and structure |
|---|
| >3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A | Back alignment and structure |
|---|
| >1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A | Back alignment and structure |
|---|
| >3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A | Back alignment and structure |
|---|
| >2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A | Back alignment and structure |
|---|
| >2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A | Back alignment and structure |
|---|
| >2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A | Back alignment and structure |
|---|
| >1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A | Back alignment and structure |
|---|
| >2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A | Back alignment and structure |
|---|
| >1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 | Back alignment and structure |
|---|
| >1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B | Back alignment and structure |
|---|
| >1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A | Back alignment and structure |
|---|
| >1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A | Back alignment and structure |
|---|
| >3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A | Back alignment and structure |
|---|
| >1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A | Back alignment and structure |
|---|
| >1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A | Back alignment and structure |
|---|
| >4eku_A Protein-tyrosine kinase 2-beta; proline-rich tyrosine kinase 2, FERM domain, transferase; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A | Back alignment and structure |
|---|
| >1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A | Back alignment and structure |
|---|
| >2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A | Back alignment and structure |
|---|
| >4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} PDB: 3u7d_A | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A | Back alignment and structure |
|---|
| >3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A | Back alignment and structure |
|---|
| >3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A | Back alignment and structure |
|---|
| >3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2al6_A Focal adhesion kinase 1; transferase; 2.35A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 2j0m_A* 2aeh_A | Back alignment and structure |
|---|
| >3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A | Back alignment and structure |
|---|
| >2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} | Back alignment and structure |
|---|
| >2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A | Back alignment and structure |
|---|
| >1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A | Back alignment and structure |
|---|
| >2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 | Back alignment and structure |
|---|
| >2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 | Back alignment and structure |
|---|
| >2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 | Back alignment and structure |
|---|
| >2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 | Back alignment and structure |
|---|
| >1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A | Back alignment and structure |
|---|
| >3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A | Back alignment and structure |
|---|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A | Back alignment and structure |
|---|
| >3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A | Back alignment and structure |
|---|
| >4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
| >3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A | Back alignment and structure |
|---|
| >3lui_A Sorting nexin-17, SNX17; PX domain, endosome, phosphoprotein, P transport, transport; 1.80A {Homo sapiens} PDB: 3fog_A | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2wwe_A Phosphoinositide-3-kinase, class 2, gamma polypeptide; phosphoprotein, nucleotide-binding, PIK3C2G, membrane, PX-domain, transferase, ATP-binding; 1.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1wgr_A Growth factor receptor-bound protein 7; RA domain, GRB7, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.15.1.5 | Back alignment and structure |
|---|
| >1mix_A Talin; focal adhesion, integrin binding, FERM domain, cytoskeleton, structural protein; 1.75A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 PDB: 1miz_B 1mk7_B 1mk9_B 1y19_B 3g9w_A 2hrj_A 2g35_A* 2k00_A 2h7d_A* 2h7e_A* 2kgx_B | Back alignment and structure |
|---|
| >4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3iq2_A Sorting nexin-7; SNX7, PHOX, protein signalling, SGC, structur genomics consortium, protein transport, transport; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4az9_A Sorting nexin-24; protein transport; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3p0c_A Nischarin; structural genomics, structural genomics consortium, SGC, PX signaling protein; 2.27A {Homo sapiens} | Back alignment and structure |
|---|
| >2csk_A Sorting nexin 12; SNX12, PX domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i4k_A Sorting nexin-1, SNX1; 3-stranded beta sheet, 3 alpha helices, proline rich loop, protein transport; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ocs_A Sorting nexin GRD19; sorting protein, PX-domain, yeast protein; HET: CME; 2.03A {Saccharomyces cerevisiae} SCOP: d.189.1.1 PDB: 1ocu_A* | Back alignment and structure |
|---|
| >4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A | Back alignment and structure |
|---|
| >1xte_A Serine/threonine-protein kinase SGK3; CISK, PX domain, transferase; 1.60A {Mus musculus} SCOP: d.189.1.1 PDB: 1xtn_A | Back alignment and structure |
|---|
| >1kmd_A VAM7P, vacuolar morphogenesis protein VAM7; PX domain, phosphoinositide binding, endocytosis/exocytosis complex; NMR {Saccharomyces cerevisiae} SCOP: d.189.1.1 | Back alignment and structure |
|---|
| >1wxa_A Afadin, AF-6 protein; RAS-binding domain, ubiquitin-like fold, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.15.1.5 | Back alignment and structure |
|---|
| >3ddc_B RAS association domain-containing family protein; oncogene, tumorsuppressor, ubiquitin fold, RAS effector, RAP rassf1, rassf5, RAPL, NORE1, GMPPNP; HET: GNP; 1.80A {Mus musculus} | Back alignment and structure |
|---|
| >1h6h_A Neutrophil cytosol factor 4; PX domain; HET: PIB; 1.7A {Homo sapiens} SCOP: d.189.1.1 | Back alignment and structure |
|---|
| >2ett_A Sorting nexin-22; PX domain, BC019655, SNX22_human, HS.157607, structural genomics,protein structure initiative PSI; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ar5_A Phosphoinositide 3-kinase; PX domain, transferase; 1.80A {Homo sapiens} PDB: 2rea_A 2red_A | Back alignment and structure |
|---|
| >3dyt_A Sorting nexin-9; 3-helix bundle, BAR domain, PX domain, phosphoprotein, protein transport, SH3 domain, transport, transport protein; 2.08A {Homo sapiens} PDB: 3dyu_A 2raj_A 2rai_A 2rak_A* | Back alignment and structure |
|---|
| >2iwl_X Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing alpha polypeptide; PI3K, PX domain, transferase; 2.6A {Homo sapiens} | Back alignment and structure |
|---|
| >3hpc_X SNX5 protein; sprting nexin, PHOX, SNX5-PX, phosphatidylinositol, PI(4,5)P2, cell adhesion, protein transport; 1.47A {Rattus norvegicus} PDB: 3hpb_A | Back alignment and structure |
|---|
| >4akv_A Sorting nexin-33; transport protein, organelle biogenesis; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2v14_A Kinesin-like motor protein C20ORF23; plus-END kinesin complex, transport protein, phosphatidylinositol 3-phosphate binding, nucleotide-binding; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 373 | ||||
| d1q3oa_ | 104 | b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv | 2e-26 | |
| d1g9oa_ | 91 | b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, | 1e-25 | |
| d2fcfa1 | 96 | b.36.1.1 (A:1148-1243) Multiple PDZ domain protein | 1e-20 | |
| d2fnea1 | 88 | b.36.1.1 (A:1955-2042) Multiple PDZ domain protein | 1e-20 | |
| d1whaa_ | 105 | b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap | 8e-20 | |
| d1x5qa1 | 97 | b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom | 3e-19 | |
| d1vaea_ | 111 | b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T | 4e-19 | |
| d1um1a_ | 110 | b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human | 4e-19 | |
| d2csja1 | 104 | b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj | 6e-19 | |
| d1ozia_ | 99 | b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu | 7e-19 | |
| d2f5ya1 | 77 | b.36.1.1 (A:19-95) Regulator of G-protein signalin | 1e-18 | |
| d1wf8a1 | 94 | b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens | 2e-18 | |
| d1tp5a1 | 102 | b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat | 2e-18 | |
| d2fe5a1 | 92 | b.36.1.1 (A:223-314) Synapse-associated protein 10 | 3e-18 | |
| d1n7ea_ | 95 | b.36.1.1 (A:) Glutamate receptor-interacting prote | 6e-18 | |
| d1ueqa_ | 123 | b.36.1.1 (A:) Membrane associated guanylate kinase | 6e-18 | |
| d1m5za_ | 91 | b.36.1.1 (A:) Glutamate receptor interacting prote | 7e-18 | |
| d1uita_ | 117 | b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma | 1e-17 | |
| d1rzxa_ | 98 | b.36.1.1 (A:) GTPase-binding domain of the cell po | 2e-17 | |
| d1ueza_ | 101 | b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien | 2e-17 | |
| d1rgwa_ | 85 | b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo | 2e-17 | |
| d2h3la1 | 103 | b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) | 3e-17 | |
| d1y7na1 | 79 | b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote | 4e-17 | |
| d1rgra_ | 93 | b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus | 5e-17 | |
| d1uepa_ | 103 | b.36.1.1 (A:) Membrane associated guanylate kinase | 5e-17 | |
| d1uf1a_ | 128 | b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien | 6e-17 | |
| d1v62a_ | 117 | b.36.1.1 (A:) Glutamate receptor interacting prote | 6e-17 | |
| d1x5ra1 | 99 | b.36.1.1 (A:8-106) Glutamate receptor interacting | 7e-17 | |
| d1wfva_ | 103 | b.36.1.1 (A:) Membrane associated guanylate kinase | 1e-16 | |
| d1ujda_ | 117 | b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human | 1e-16 | |
| d1ufxa_ | 103 | b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien | 1e-16 | |
| d1wi2a_ | 104 | b.36.1.1 (A:) PDZ domain containing protein 11, Pd | 1e-16 | |
| d1qava_ | 90 | b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta | 3e-16 | |
| d1ihja_ | 94 | b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga | 6e-16 | |
| d1x5na1 | 101 | b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) | 6e-16 | |
| d1uhpa_ | 107 | b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human | 8e-16 | |
| d1uewa_ | 114 | b.36.1.1 (A:) Membrane associated guanylate kinase | 8e-16 | |
| d1ujua_ | 111 | b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap | 9e-16 | |
| d1x6da1 | 107 | b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap | 1e-15 | |
| d1v6ba_ | 118 | b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI | 2e-15 | |
| d1vb7a_ | 94 | b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus | 2e-15 | |
| d1w9ea1 | 85 | b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie | 2e-15 | |
| d2cs5a1 | 106 | b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no | 5e-15 | |
| d1v5qa_ | 122 | b.36.1.1 (A:) Glutamate receptor interacting prote | 6e-15 | |
| d1t2ma1 | 92 | b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta | 1e-14 | |
| d1kwaa_ | 88 | b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta | 1e-14 | |
| d1p1da2 | 99 | b.36.1.1 (A:115-213) Glutamate receptor interactin | 1e-14 | |
| d1wf7a_ | 103 | b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu | 3e-14 | |
| d2cssa1 | 108 | b.36.1.1 (A:8-115) Regulating synaptic membrane ex | 4e-14 | |
| d1v5la_ | 103 | b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote | 9e-14 | |
| d1i16a_ | 130 | b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) | 2e-13 | |
| d1r6ja_ | 82 | b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta | 3e-13 | |
| d1ujva_ | 96 | b.36.1.1 (A:) Membrane associated guanylate kinase | 3e-13 | |
| d1x45a1 | 85 | b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei | 3e-13 | |
| d1wi4a1 | 96 | b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou | 6e-13 | |
| d1va8a1 | 100 | b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M | 7e-13 | |
| d1wifa_ | 126 | b.36.1.1 (A:) hypothetical PDZ domain containing p | 2e-12 | |
| d1wg6a_ | 127 | b.36.1.1 (A:) Partitioning-defective 3-like protei | 3e-12 | |
| d2f0aa1 | 92 | b.36.1.1 (A:251-342) Segment polarity protein dish | 1e-11 | |
| d1qaua_ | 112 | b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS | 4e-11 | |
| d1wh1a_ | 124 | b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human | 7e-10 | |
| d2z9ia1 | 88 | b.36.1.4 (A:227-314) Protease PepD {Mycobacterium | 2e-08 | |
| d1ky9b2 | 88 | b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t | 1e-07 | |
| d1fc6a3 | 92 | b.36.1.3 (A:157-248) Photosystem II D1 C-terminal | 6e-07 | |
| d1xtea_ | 116 | d.189.1.1 (A:) Serine/threonine-protein kinase Sgk | 2e-06 | |
| d2i6va1 | 87 | b.36.1.5 (A:219-305) General secretion pathway pro | 2e-05 | |
| d1lcya1 | 100 | b.36.1.4 (A:226-325) Mitochondrial serine protease | 2e-05 | |
| d1wgra_ | 100 | d.15.1.5 (A:) Growth factor receptor-bound protein | 2e-04 | |
| d1k32a1 | 91 | b.36.1.3 (A:763-853) Tricorn protease {Archaeon Th | 0.003 |
| >d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 | Back information, alignment and structure |
|---|
class: All beta proteins fold: PDZ domain-like superfamily: PDZ domain-like family: PDZ domain domain: Shank1, PDZ domain species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 99.3 bits (247), Expect = 2e-26
Identities = 34/98 (34%), Positives = 55/98 (56%), Gaps = 1/98 (1%)
Query: 9 PREVQIAKSDT-GFGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLAGGAAEKAGIRKGD 67
+ V + K D+ GFGF +RG ++ + LQ++ +V GG A +AG+R GD
Sbjct: 6 EKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMGD 65
Query: 68 RILAVNNVNVEGATHKQVVELIKSGGDVLSLTVISVSP 105
++ VN NV H+QVV +I+ GG+ L + V+ V+
Sbjct: 66 FLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR 103
|
| >d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 | Back information, alignment and structure |
|---|
| >d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 | Back information, alignment and structure |
|---|
| >d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
| >d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 | Back information, alignment and structure |
|---|
| >d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 | Back information, alignment and structure |
|---|
| >d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 | Back information, alignment and structure |
|---|
| >d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 | Back information, alignment and structure |
|---|
| >d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 | Back information, alignment and structure |
|---|
| >d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
| >d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 | Back information, alignment and structure |
|---|
| >d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 | Back information, alignment and structure |
|---|
| >d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 | Back information, alignment and structure |
|---|
| >d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 | Back information, alignment and structure |
|---|
| >d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 | Back information, alignment and structure |
|---|
| >d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 | Back information, alignment and structure |
|---|
| >d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 | Back information, alignment and structure |
|---|
| >d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 | Back information, alignment and structure |
|---|
| >d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 | Back information, alignment and structure |
|---|
| >d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 | Back information, alignment and structure |
|---|
| >d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 | Back information, alignment and structure |
|---|
| >d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 | Back information, alignment and structure |
|---|
| >d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 | Back information, alignment and structure |
|---|
| >d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 | Back information, alignment and structure |
|---|
| >d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88 | Back information, alignment and structure |
|---|
| >d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 92 | Back information, alignment and structure |
|---|
| >d1xtea_ d.189.1.1 (A:) Serine/threonine-protein kinase Sgk3, Cisk {Mouse (Mus musculus) [TaxId: 10090]} Length = 116 | Back information, alignment and structure |
|---|
| >d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Length = 87 | Back information, alignment and structure |
|---|
| >d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1wgra_ d.15.1.5 (A:) Growth factor receptor-bound protein 7, GRB-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 91 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 373 | |||
| d1g9oa_ | 91 | Na+/H+ exchanger regulatory factor, NHERF {Human ( | 99.66 | |
| d1q3oa_ | 104 | Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId | 99.64 | |
| d1r6ja_ | 82 | Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | 99.64 | |
| d1tp5a1 | 102 | Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ | 99.62 | |
| d1m5za_ | 91 | Glutamate receptor interacting protein {Rat (Rattu | 99.61 | |
| d2f5ya1 | 77 | Regulator of G-protein signaling 3, RGS3 {Human (H | 99.61 | |
| d1rgra_ | 93 | Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ | 99.61 | |
| d2fcfa1 | 96 | Multiple PDZ domain protein {Human (Homo sapiens) | 99.6 | |
| d1rgwa_ | 85 | Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax | 99.59 | |
| d2fe5a1 | 92 | Synapse-associated protein 102 {Human (Homo sapien | 99.59 | |
| d1ozia_ | 99 | Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 | 99.59 | |
| d1x5qa1 | 97 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 99.58 | |
| d1uhpa_ | 107 | Hypothetical protein KIAA1095 {Human (Homo sapiens | 99.58 | |
| d1whaa_ | 105 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 99.58 | |
| d2fnea1 | 88 | Multiple PDZ domain protein {Human (Homo sapiens) | 99.58 | |
| d1qava_ | 90 | Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | 99.57 | |
| d1vaea_ | 111 | Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} | 99.55 | |
| d1wf8a1 | 94 | Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} | 99.55 | |
| d1um1a_ | 110 | Hypothetical protein KIAA1849 {Human (Homo sapiens | 99.54 | |
| d1ihja_ | 94 | Inad {Fruit fly (Drosophila melanogaster) [TaxId: | 99.54 | |
| d1wi2a_ | 104 | PDZ domain containing protein 11, Pdzk11 {Mouse (M | 99.53 | |
| d1uita_ | 117 | Discs large 5 protein KIAA0583 {Human (Homo sapien | 99.51 | |
| d1w9ea1 | 85 | Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | 99.51 | |
| d1n7ea_ | 95 | Glutamate receptor-interacting protein 1, GRIP1 {R | 99.5 | |
| d1kwaa_ | 88 | Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.49 | |
| d1t2ma1 | 92 | Afadin {Human (Homo sapiens) [TaxId: 9606]} | 99.49 | |
| d1y7na1 | 79 | Amyloid beta A4 precursor protein-binding family A | 99.48 | |
| d1vb7a_ | 94 | PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta | 99.47 | |
| d1rzxa_ | 98 | GTPase-binding domain of the cell polarity protein | 99.46 | |
| d1uewa_ | 114 | Membrane associated guanylate kinase inverted-2 (M | 99.45 | |
| d1wfva_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 99.44 | |
| d1uf1a_ | 128 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 99.44 | |
| d1ujua_ | 111 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 99.44 | |
| d1uepa_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 99.43 | |
| d2csja1 | 104 | Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc | 99.43 | |
| d1v62a_ | 117 | Glutamate receptor interacting protein 2, GRIP2 (K | 99.43 | |
| d1x5na1 | 101 | Harmonin {Human (Homo sapiens) [TaxId: 9606]} | 99.43 | |
| d1wi4a1 | 96 | Syntaxin binding protein 4 {Mouse (Mus musculus) [ | 99.43 | |
| d2f0aa1 | 92 | Segment polarity protein dishevelled homolog Dvl-2 | 99.42 | |
| d1p1da2 | 99 | Glutamate receptor interacting protein {Rat (Rattu | 99.42 | |
| d2h3la1 | 103 | Erbin {Human (Homo sapiens) [TaxId: 9606]} | 99.41 | |
| d1ueqa_ | 123 | Membrane associated guanylate kinase inverted-2 (M | 99.41 | |
| d1qaua_ | 112 | Neuronal nitric oxide synthase, NNOS {Rat (Rattus | 99.4 | |
| d1i16a_ | 130 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 99.4 | |
| d1ueza_ | 101 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 99.4 | |
| d1wf7a_ | 103 | Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 | 99.39 | |
| d1x45a1 | 85 | Amyloid beta A4 precursor protein-binding family A | 99.38 | |
| d1x6da1 | 107 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 99.38 | |
| d1va8a1 | 100 | Maguk p55 subfamily member 5 {Mouse (Mus musculus) | 99.37 | |
| d1x5ra1 | 99 | Glutamate receptor interacting protein 2, GRIP2 (K | 99.34 | |
| d1ujda_ | 117 | Hypothetical protein KIAA0559 {Human (Homo sapiens | 99.34 | |
| d1v5la_ | 103 | Alpha-actinin-2 associated LIM protein {Mouse (Mus | 99.31 | |
| d1ufxa_ | 103 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 99.31 | |
| d1wifa_ | 126 | hypothetical PDZ domain containing protein Uqcrc2 | 99.3 | |
| d1v5qa_ | 122 | Glutamate receptor interacting protein {Mouse (Mus | 99.3 | |
| d1v6ba_ | 118 | Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | 99.29 | |
| d2cs5a1 | 106 | Tyrosine-protein phosphatase non-receptor type 4, | 99.28 | |
| d1ujva_ | 96 | Membrane associated guanylate kinase inverted-2 (M | 99.28 | |
| d2cssa1 | 108 | Regulating synaptic membrane exocytosis protein 1, | 99.27 | |
| d1wg6a_ | 127 | Partitioning-defective 3-like protein, PAR3-L (RIK | 99.26 | |
| d1fc6a3 | 92 | Photosystem II D1 C-terminal processing protease { | 99.2 | |
| d1wh1a_ | 124 | Hypothetical protein KIAA1095 {Human (Homo sapiens | 99.15 | |
| d2z9ia1 | 88 | Protease PepD {Mycobacterium tuberculosis [TaxId: | 99.05 | |
| d2hgaa1 | 103 | Uncharacterized protein MTH1368 {Methanobacterium | 98.95 | |
| d1lcya1 | 100 | Mitochondrial serine protease HtrA2 {Human (Homo s | 98.9 | |
| d1ky9b2 | 88 | Protease Do (DegP, HtrA), C-terminal domains {Esch | 98.83 | |
| d1ky9a1 | 94 | Protease Do (DegP, HtrA), C-terminal domains {Esch | 98.64 | |
| d2i6va1 | 87 | General secretion pathway protein C, EpsC {Vibrio | 98.64 | |
| d1k32a1 | 91 | Tricorn protease {Archaeon Thermoplasma acidophilu | 98.63 | |
| d1sota1 | 99 | Stress sensor protease DegS, C-terminal domain {Es | 98.55 | |
| d1wgra_ | 100 | Growth factor receptor-bound protein 7, GRB-7 {Hum | 98.44 | |
| d1mixa1 | 114 | Talin {Chicken (Gallus gallus) [TaxId: 9031]} | 97.04 | |
| d2al6a1 | 123 | Focal adhesion kinase 1 {Chicken (Gallus gallus) [ | 96.64 | |
| d1xtea_ | 116 | Serine/threonine-protein kinase Sgk3, Cisk {Mouse | 95.03 | |
| d1h4ra1 | 111 | Merlin {Human (Homo sapiens) [TaxId: 9606]} | 94.8 | |
| d1gg3a1 | 106 | Erythroid membrane protein 4.1R {Human (Homo sapie | 94.5 | |
| d1wxaa1 | 103 | Afadin {Mouse (Mus musculus) [TaxId: 10090]} | 93.7 | |
| d1ef1a1 | 111 | Moesin {Human (Homo sapiens) [TaxId: 9606]} | 93.66 | |
| d1ocsa_ | 132 | Sorting nexin grd19 {Baker's yeast (Saccharomyces | 90.61 | |
| d1c1yb_ | 77 | c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} | 86.62 | |
| d1wxma1 | 73 | A-Raf proto-oncogene serine/threonine-protein kina | 86.1 | |
| d1kmda_ | 117 | Vam7p {Baker's yeast (Saccharomyces cerevisiae) [T | 83.77 |
| >d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: PDZ domain-like superfamily: PDZ domain-like family: PDZ domain domain: Na+/H+ exchanger regulatory factor, NHERF species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.66 E-value=5.8e-16 Score=119.92 Aligned_cols=83 Identities=37% Similarity=0.550 Sum_probs=75.2
Q ss_pred CCcEEEEEEcCCCCccEEEEecccCCCccccccccccCCceEEEEecCCCHHHHcCCCCCCEEEEECCEEcCCCCHHHHH
Q psy2827 7 TGPREVQIAKSDTGFGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLAGGAAEKAGIRKGDRILAVNNVNVEGATHKQVV 86 (373)
Q Consensus 7 ~~~r~v~l~r~~~g~Gfsi~g~~~~~~~~~~~g~~~~~p~~~V~~V~~gspA~~aGL~~GD~Il~InG~~v~~~s~~~~~ 86 (373)
..||.|+|.|+..+|||++.++.. ..+++|..|.+||||+++||++||+|++|||.++.+++++++.
T Consensus 2 ~~Pr~v~l~k~~~g~Gf~i~~~~~-------------~~~~~V~~V~~g~~A~~aGl~~GD~Il~VNg~~v~~~t~~e~~ 68 (91)
T d1g9oa_ 2 MLPRLCCLEKGPNGYGFHLHGEKG-------------KLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVV 68 (91)
T ss_dssp CCCEEEEEECBTTBCCEEEEECTT-------------CSSEEEEEECTTSHHHHTTCCTTCEEEEETTEECTTCCHHHHH
T ss_pred CCCEEEEEEECCCeeeEEEEecCC-------------CCCEEEEEEcCCCHHHHcCCCCCCEEEEECCEECCCCCHHHHH
Confidence 358999999999999999988632 2345899999999999999999999999999999999999999
Q ss_pred HHHHhCCCeEEEEEEe
Q psy2827 87 ELIKSGGDVLSLTVIS 102 (373)
Q Consensus 87 ~~i~~~g~~v~l~V~r 102 (373)
++++.++..++|+|.+
T Consensus 69 ~ll~~~~~~v~L~v~~ 84 (91)
T d1g9oa_ 69 SRIRAALNAVRLLVVD 84 (91)
T ss_dssp HHHHTCSSEEEEEEEC
T ss_pred HHHHcCCCeEEEEEEC
Confidence 9999988999999875
|
| >d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} | Back information, alignment and structure |
|---|
| >d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wgra_ d.15.1.5 (A:) Growth factor receptor-bound protein 7, GRB-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2al6a1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1xtea_ d.189.1.1 (A:) Serine/threonine-protein kinase Sgk3, Cisk {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wxaa1 d.15.1.5 (A:8-110) Afadin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ocsa_ d.189.1.1 (A:) Sorting nexin grd19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c1yb_ d.15.1.5 (B:) c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wxma1 d.15.1.5 (A:8-80) A-Raf proto-oncogene serine/threonine-protein kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmda_ d.189.1.1 (A:) Vam7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|