Psyllid ID: psy2837

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MGSDKKKFLSMLLALRTKMNADTGEPLDELETDTKDWLKSLGVYKATQAAIDRANLKSISNAQKIQKFEFLPADFSIPTGELGPTMKVKRPFVVKKYQSIIDKFYDV
ccccccccEEEEEEccccccHHHHcccccccccHHHHHHcHHHHHHHHHHHHHHHHHccccccccEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHcc
cccccccHHHHHEEEccccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHEEEcccccccccccccccHHccHHHHHHHHHHHHHHHHcc
MGSDKKKFLSMLLALRTKmnadtgepldeleTDTKDWLKSLGVYKATQAAIDRANLKSISNAQKIQkfeflpadfsiptgelgptmkvkrpFVVKKYQSIIDKFYDV
MGSDKKKFLSMLLALRTkmnadtgepldeLETDTKDWLKSLGVYKATQAAIDRANLKSISNAQKIQKFEFLPADfsiptgelgptmkvkrpfvVKKYQSIIDKFYDV
MGSDKKKFLSMLLALRTKMNADTGEPLDELETDTKDWLKSLGVYKATQAAIDRANLKSISNAQKIQKFEFLPADFSIPTGELGPTMKVKRPFVVKKYQSIIDKFYDV
***********LLA*******************TKDWLKSLGVYKATQAAIDRANLKSISNAQKIQKFEFLPADFSIPTGELGPTMKVKRPFVVKKYQSIIDKFY**
MGSDKKKFLSMLLALRTKMNADTGEPLDELETDTKDWLKSLGVYKATQAAIDRANLKSISNAQKIQKFEFLPADFSIPTGELGPTMKVKRPFVVKKYQSIIDKFYDV
MGSDKKKFLSMLLALRTKMNADTGEPLDELETDTKDWLKSLGVYKATQAAIDRANLKSISNAQKIQKFEFLPADFSIPTGELGPTMKVKRPFVVKKYQSIIDKFYDV
*****KKFLSMLLALRTKMNADTGEPLDELETDTKDWLKSLGVYKATQAAIDRANLKSISNAQKIQKFEFLPADFSIPTGELGPTMKVKRPFVVKKYQSIIDKFYDV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
iiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSDKKKFLSMLLALRTKMNADTGEPLDELETDTKDWLKSLGVYKATQAAIDRANLKSISNAQKIQKFEFLPADFSIPTGELGPTMKVKRPFVVKKYQSIIDKFYDV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query107 2.2.26 [Sep-21-2011]
Q9V3S9666 Very long-chain-fatty-aci yes N/A 0.962 0.154 0.491 1e-26
Q7ZYC4739 Long-chain-fatty-acid--Co N/A N/A 0.962 0.139 0.495 3e-24
Q5ZKR7763 Long-chain-fatty-acid--Co yes N/A 0.962 0.134 0.453 9e-24
Q5FVE4666 Long-chain-fatty-acid--Co yes N/A 0.971 0.156 0.441 4e-21
Q4R4P9724 Long-chain-fatty-acid--Co N/A N/A 0.981 0.145 0.4 5e-19
Q9V3U0681 Long-chain-fatty-acid--Co no N/A 0.953 0.149 0.355 9e-19
Q2KHW5726 Long-chain-fatty-acid--Co no N/A 0.953 0.140 0.398 7e-18
Q924N5721 Long-chain-fatty-acid--Co yes N/A 0.953 0.141 0.406 8e-18
Q99PU5721 Long-chain-fatty-acid--Co yes N/A 0.953 0.141 0.398 3e-17
Q2XU92667 Long-chain-fatty-acid--Co no N/A 0.953 0.152 0.389 3e-17
>sp|Q9V3S9|BGM_DROME Very long-chain-fatty-acid--CoA ligase bubblegum OS=Drosophila melanogaster GN=bgm PE=2 SV=1 Back     alignment and function desciption
 Score =  118 bits (296), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 81/120 (67%), Gaps = 17/120 (14%)

Query: 3   SDKKKFLSMLLALRTKMNADTGEPLDELETDTKDWLKSLGV-----------------YK 45
            +++K+L++L+ L+T+++ D+GEPLDEL  ++  W+KSLGV                 +K
Sbjct: 546 GEQRKYLTVLITLKTEVDKDSGEPLDELSHESSVWVKSLGVEHKTVSDILAAGPCPKVWK 605

Query: 46  ATQAAIDRANLKSISNAQKIQKFEFLPADFSIPTGELGPTMKVKRPFVVKKYQSIIDKFY 105
           + + AI RAN +SISNAQK+QKF  LP DFSIPTGELGPT+KVKR  V K Y   I+K Y
Sbjct: 606 SIEDAIKRANKQSISNAQKVQKFTILPHDFSIPTGELGPTLKVKRNVVSKMYADEIEKLY 665
Mediates activation of very-long-chain fatty acids. Probably also able to mediate activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation.
Drosophila melanogaster (taxid: 7227)
EC: 6EC: .EC: 2EC: .EC: 1EC: .EC: 3
>sp|Q7ZYC4|ACBG2_XENLA Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Xenopus laevis GN=acsbg2 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZKR7|ACBG2_CHICK Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Gallus gallus GN=ACSBG2 PE=2 SV=2 Back     alignment and function description
>sp|Q5FVE4|ACBG2_HUMAN Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Homo sapiens GN=ACSBG2 PE=1 SV=2 Back     alignment and function description
>sp|Q4R4P9|ACBG1_MACFA Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Macaca fascicularis GN=ACSBG1 PE=2 SV=2 Back     alignment and function description
>sp|Q9V3U0|BGML_DROME Long-chain-fatty-acid--CoA ligase bubblegum-like OS=Drosophila melanogaster GN=CG4500 PE=2 SV=1 Back     alignment and function description
>sp|Q2KHW5|ACBG1_BOVIN Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Bos taurus GN=ACSBG1 PE=2 SV=1 Back     alignment and function description
>sp|Q924N5|ACBG1_RAT Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Rattus norvegicus GN=Acsbg1 PE=1 SV=1 Back     alignment and function description
>sp|Q99PU5|ACBG1_MOUSE Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Mus musculus GN=Acsbg1 PE=1 SV=1 Back     alignment and function description
>sp|Q2XU92|ACBG2_MOUSE Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Mus musculus GN=Acsbg2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query107
215259863145 long-chain acyl-CoA synthetases [Culex t 0.962 0.710 0.55 6e-29
170050090 645 conserved hypothetical protein [Culex qu 0.962 0.159 0.541 9e-29
345488807 663 PREDICTED: very long-chain-fatty-acid--C 0.962 0.155 0.504 3e-28
103058188 397 AMP-binding enzyme [Bombyx mori] 0.953 0.256 0.525 6e-28
328708315 693 PREDICTED: long-chain-fatty-acid--CoA li 0.971 0.150 0.508 2e-26
357622046 690 hypothetical protein KGM_01876 [Danaus p 0.962 0.149 0.512 2e-26
312376080 723 hypothetical protein AND_13180 [Anophele 0.962 0.142 0.55 3e-26
307188070 689 Long-chain-fatty-acid--CoA ligase ACSBG2 0.962 0.149 0.495 7e-26
195433535 666 GK15027 [Drosophila willistoni] gi|19416 0.962 0.154 0.491 2e-25
195031684 668 GH11132 [Drosophila grimshawi] gi|193904 0.962 0.154 0.491 2e-25
>gi|215259863|gb|ACJ64423.1| long-chain acyl-CoA synthetases [Culex tarsalis] Back     alignment and taxonomy information
 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 81/120 (67%), Gaps = 17/120 (14%)

Query: 3   SDKKKFLSMLLALRTKMNADTGEPLDELETDTKDWLKSLGV-----------------YK 45
            DK+KFL+ML+ L+T+MN D+GEP DEL  +T  W+K LGV                  +
Sbjct: 25  GDKRKFLTMLVTLKTQMNLDSGEPRDELAPETAAWVKGLGVEYTKLSQIVAAGPCPKVLQ 84

Query: 46  ATQAAIDRANLKSISNAQKIQKFEFLPADFSIPTGELGPTMKVKRPFVVKKYQSIIDKFY 105
           A Q  IDRAN K+ISNAQKIQKF  LP DFS+P GELGPT+KVKR  V +KY+ II+KFY
Sbjct: 85  AIQEGIDRANKKAISNAQKIQKFALLPVDFSVPGGELGPTLKVKRNIVQEKYKDIIEKFY 144

Source: Culex tarsalis

Species: Culex tarsalis

Genus: Culex

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|170050090|ref|XP_001859223.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167871665|gb|EDS35048.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|345488807|ref|XP_001606071.2| PREDICTED: very long-chain-fatty-acid--CoA ligase bubblegum-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|103058188|gb|ABF71571.1| AMP-binding enzyme [Bombyx mori] Back     alignment and taxonomy information
>gi|328708315|ref|XP_001945956.2| PREDICTED: long-chain-fatty-acid--CoA ligase ACSBG2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|357622046|gb|EHJ73666.1| hypothetical protein KGM_01876 [Danaus plexippus] Back     alignment and taxonomy information
>gi|312376080|gb|EFR23274.1| hypothetical protein AND_13180 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|307188070|gb|EFN72902.1| Long-chain-fatty-acid--CoA ligase ACSBG2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|195433535|ref|XP_002064766.1| GK15027 [Drosophila willistoni] gi|194160851|gb|EDW75752.1| GK15027 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195031684|ref|XP_001988376.1| GH11132 [Drosophila grimshawi] gi|193904376|gb|EDW03243.1| GH11132 [Drosophila grimshawi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query107
FB|FBgn0027348666 bgm "bubblegum" [Drosophila me 0.588 0.094 0.650 7.5e-25
UNIPROTKB|F1NI43700 ACSBG2 "Long-chain-fatty-acid- 0.953 0.145 0.457 6.9e-20
UNIPROTKB|Q5ZKR7763 ACSBG2 "Long-chain-fatty-acid- 0.953 0.133 0.457 8.1e-20
FB|FBgn0028519681 CG4500 [Drosophila melanogaste 0.570 0.089 0.491 1.4e-19
ZFIN|ZDB-GENE-030131-7099794 acsbg2 "acyl-CoA synthetase bu 0.953 0.128 0.474 6.3e-19
UNIPROTKB|F1PS77671 ACSBG2 "Uncharacterized protei 0.953 0.152 0.440 7.1e-18
UNIPROTKB|F1SBT8674 ACSBG2 "Uncharacterized protei 0.953 0.151 0.449 9.1e-18
UNIPROTKB|Q5FVE4666 ACSBG2 "Long-chain-fatty-acid- 0.953 0.153 0.449 3.1e-17
UNIPROTKB|E1BCN4678 ACSBG2 "Uncharacterized protei 0.953 0.150 0.449 6.7e-17
UNIPROTKB|F1NLD6643 ACSBG1 "Uncharacterized protei 0.962 0.160 0.403 1e-16
FB|FBgn0027348 bgm "bubblegum" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 201 (75.8 bits), Expect = 7.5e-25, Sum P(2) = 7.5e-25
 Identities = 41/63 (65%), Positives = 48/63 (76%)

Query:    43 VYKATQAAIDRANLKSISNAQKIQKFEFLPADFSIPTGELGPTMKVKRPFVVKKYQSIID 102
             V+K+ + AI RAN +SISNAQK+QKF  LP DFSIPTGELGPT+KVKR  V K Y   I+
Sbjct:   603 VWKSIEDAIKRANKQSISNAQKVQKFTILPHDFSIPTGELGPTLKVKRNVVSKMYADEIE 662

Query:   103 KFY 105
             K Y
Sbjct:   663 KLY 665
GO:0004467 "long-chain fatty acid-CoA ligase activity" evidence=ISS;IMP
GO:0001676 "long-chain fatty acid metabolic process" evidence=IMP
GO:0005575 "cellular_component" evidence=ND
UNIPROTKB|F1NI43 ACSBG2 "Long-chain-fatty-acid--CoA ligase ACSBG2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKR7 ACSBG2 "Long-chain-fatty-acid--CoA ligase ACSBG2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0028519 CG4500 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7099 acsbg2 "acyl-CoA synthetase bubblegum family member 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1PS77 ACSBG2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SBT8 ACSBG2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5FVE4 ACSBG2 "Long-chain-fatty-acid--CoA ligase ACSBG2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BCN4 ACSBG2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NLD6 ACSBG1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query107
cd05933594 cd05933, ACSBG_like, Bubblegum-like very long-chai 3e-43
cd05907456 cd05907, VL_LC_FACS_like, Long-chain fatty acid Co 1e-15
COG1022613 COG1022, FAA1, Long-chain acyl-CoA synthetases (AM 8e-09
cd05927539 cd05927, LC-FACS_euk, Eukaryotic long-chain fatty 7e-07
PLN02736651 PLN02736, PLN02736, long-chain acyl-CoA synthetase 2e-04
PLN02861660 PLN02861, PLN02861, long-chain-fatty-acid-CoA liga 4e-04
PLN02614666 PLN02614, PLN02614, long-chain acyl-CoA synthetase 0.001
>gnl|CDD|213299 cd05933, ACSBG_like, Bubblegum-like very long-chain fatty acid CoA synthetase (VL-FACS) Back     alignment and domain information 
 Score =  147 bits (374), Expect = 3e-43
 Identities = 57/118 (48%), Positives = 76/118 (64%), Gaps = 16/118 (13%)

Query: 4   DKKKFLSMLLALRTKMNADTGEPLDELETDTKDWLKSLG----------------VYKAT 47
           DK+KFLSMLL L+ +++ +TGEPLD L  +  ++ + LG                VY+A 
Sbjct: 477 DKRKFLSMLLTLKCEVDPETGEPLDNLTEEAIEFCRLLGSHATTVSEILAGKDPLVYEAI 536

Query: 48  QAAIDRANLKSISNAQKIQKFEFLPADFSIPTGELGPTMKVKRPFVVKKYQSIIDKFY 105
           +  I R N ++ISNAQK+QK+  L  DFS+P GELGPTMK+KRP V KKY+  IDK Y
Sbjct: 537 EEGIKRVNKEAISNAQKVQKWVILEKDFSVPGGELGPTMKLKRPVVAKKYKDEIDKLY 594

This family of very long-chain fatty acid CoA synthetase is named bubblegum because Drosophila melanogaster mutant bubblegum (BGM) has elevated levels of very-long-chain fatty acids (VLCFA) caused by a defective gene of this family. The human homolog (hsBG) has been characterized as a very long chain fatty acid CoA synthetase that functions specifically in the brain; hsBG may play a central role in brain VLCFA metabolism and myelinogenesis. VL-FACS is involved in the first reaction step of very long chain fatty acid degradation. It catalyzes the formation of fatty acyl-CoA in a two-step reaction: the formation of a fatty acyl-AMP molecule as an intermediate, and the formation of a fatty acyl-CoA. Free fatty acids must be "activated" to their CoA thioesters before participating in most catabolic and anabolic reactions. Length = 594
>gnl|CDD|213275 cd05907, VL_LC_FACS_like, Long-chain fatty acid CoA synthetases and Bubblegum-like very long-chain fatty acid CoA synthetases Back     alignment and domain information
>gnl|CDD|223953 COG1022, FAA1, Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|213293 cd05927, LC-FACS_euk, Eukaryotic long-chain fatty acid CoA synthetase (LC-FACS) Back     alignment and domain information
>gnl|CDD|178337 PLN02736, PLN02736, long-chain acyl-CoA synthetase Back     alignment and domain information
>gnl|CDD|178452 PLN02861, PLN02861, long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>gnl|CDD|166255 PLN02614, PLN02614, long-chain acyl-CoA synthetase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 107
KOG1256|consensus691 99.9
PLN02614666 long-chain acyl-CoA synthetase 99.88
PLN02387696 long-chain-fatty-acid-CoA ligase family protein 99.85
PLN02430660 long-chain-fatty-acid-CoA ligase 99.84
PTZ00297 1452 pantothenate kinase; Provisional 99.83
PTZ00216700 acyl-CoA synthetase; Provisional 99.82
KOG1180|consensus678 99.81
PLN02861660 long-chain-fatty-acid-CoA ligase 99.8
PTZ00342746 acyl-CoA synthetase; Provisional 99.79
PLN02736651 long-chain acyl-CoA synthetase 99.76
COG1022613 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) 99.68
PRK12582624 acyl-CoA synthetase; Provisional 99.62
PRK08180614 feruloyl-CoA synthase; Reviewed 99.54
PRK08316523 acyl-CoA synthetase; Validated 96.56
PTZ00237647 acetyl-CoA synthetase; Provisional 95.96
PRK07445452 O-succinylbenzoic acid--CoA ligase; Reviewed 95.74
PRK05852534 acyl-CoA synthetase; Validated 95.37
PLN02860563 o-succinylbenzoate-CoA ligase 95.36
TIGR01734502 D-ala-DACP-lig D-alanine--poly(phosphoribitol) lig 95.29
PRK07514504 malonyl-CoA synthase; Validated 95.02
PRK04813503 D-alanine--poly(phosphoribitol) ligase subunit 1; 94.55
PRK07824358 O-succinylbenzoic acid--CoA ligase; Provisional 94.35
PRK08276502 long-chain-fatty-acid--CoA ligase; Validated 94.27
PRK06839496 acyl-CoA synthetase; Validated 94.1
PRK03584655 acetoacetyl-CoA synthetase; Provisional 93.76
PRK07470528 acyl-CoA synthetase; Validated 93.64
TIGR01217652 ac_ac_CoA_syn acetoacetyl-CoA synthase. This enzym 93.38
PLN03052728 acetate--CoA ligase; Provisional 93.21
PRK06164540 acyl-CoA synthetase; Validated 93.07
PRK06188524 acyl-CoA synthetase; Validated 93.03
KOG1176|consensus537 93.01
TIGR02188625 Ac_CoA_lig_AcsA acetate--CoA ligase. This model de 92.71
PRK09088488 acyl-CoA synthetase; Validated 92.53
PRK05605573 long-chain-fatty-acid--CoA ligase; Validated 92.34
PLN02574560 4-coumarate--CoA ligase-like 92.3
PRK13391511 acyl-CoA synthetase; Provisional 92.05
PLN02246537 4-coumarate--CoA ligase 91.91
PLN02479567 acetate-CoA ligase 91.86
PRK00174637 acetyl-CoA synthetase; Provisional 91.63
PRK07788549 acyl-CoA synthetase; Validated 91.62
PRK03640483 O-succinylbenzoic acid--CoA ligase; Provisional 91.54
PRK04319570 acetyl-CoA synthetase; Provisional 91.48
PRK123165163 peptide synthase; Provisional 91.47
PLN02330546 4-coumarate--CoA ligase-like 1 91.39
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 91.36
PLN03051499 acyl-activating enzyme; Provisional 91.14
PRK06187521 long-chain-fatty-acid--CoA ligase; Validated 91.06
PRK06060 705 acyl-CoA synthetase; Validated 90.83
PRK08315559 AMP-binding domain protein; Validated 90.8
PLN02654666 acetate-CoA ligase 90.74
PRK09274552 peptide synthase; Provisional 90.52
PRK06178567 acyl-CoA synthetase; Validated 90.04
PRK12583558 acyl-CoA synthetase; Provisional 89.93
PRK06018542 putative acyl-CoA synthetase; Provisional 89.76
PRK10946536 entE enterobactin synthase subunit E; Provisional 89.65
PRK13382537 acyl-CoA synthetase; Provisional 89.56
PLN03102579 acyl-activating enzyme; Provisional 89.54
PRK07786542 long-chain-fatty-acid--CoA ligase; Validated 89.53
PRK12406509 long-chain-fatty-acid--CoA ligase; Provisional 89.47
PRK13295547 cyclohexanecarboxylate-CoA ligase; Reviewed 89.25
PRK06155542 crotonobetaine/carnitine-CoA ligase; Provisional 89.11
COG0365528 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid l 88.55
PRK05850578 acyl-CoA synthetase; Validated 88.27
PRK06087547 short chain acyl-CoA synthetase; Reviewed 87.97
PRK07798533 acyl-CoA synthetase; Validated 87.91
PRK12316 5163 peptide synthase; Provisional 87.83
TIGR02372386 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv 87.74
PRK05857540 acyl-CoA synthetase; Validated 87.66
PRK07638487 acyl-CoA synthetase; Validated 87.58
PRK06145497 acyl-CoA synthetase; Validated 87.54
TIGR03098515 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosor 86.86
PRK08162545 acyl-CoA synthetase; Validated 86.49
PRK05620576 long-chain-fatty-acid--CoA ligase; Validated 86.42
PRK07868994 acyl-CoA synthetase; Validated 86.18
PRK08279600 long-chain-acyl-CoA synthetase; Validated 86.08
PRK10524629 prpE propionyl-CoA synthetase; Provisional 86.0
PRK13390501 acyl-CoA synthetase; Provisional 85.78
PF1319373 AMP-binding_C: AMP-binding enzyme C-terminal domai 85.73
PRK09029458 O-succinylbenzoic acid--CoA ligase; Provisional 85.73
PRK08314546 long-chain-fatty-acid--CoA ligase; Validated 85.68
TIGR02316628 propion_prpE propionate--CoA ligase. This family c 85.07
PRK07867529 acyl-CoA synthetase; Validated 85.06
PRK07529632 AMP-binding domain protein; Validated 84.99
PRK07008539 long-chain-fatty-acid--CoA ligase; Validated 84.49
PRK05677562 long-chain-fatty-acid--CoA ligase; Validated 84.47
PRK07787471 acyl-CoA synthetase; Validated 83.36
KOG1177|consensus596 83.35
PRK13388540 acyl-CoA synthetase; Provisional 83.03
COG0318534 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid l 82.48
PRK10252 1296 entF enterobactin synthase subunit F; Provisional 81.13
PRK08043718 bifunctional acyl-[acyl carrier protein] synthetas 80.55
PRK09188365 serine/threonine protein kinase; Provisional 80.42
>KOG1256|consensus Back     alignment and domain information 
Probab=99.90  E-value=5e-24  Score=167.01  Aligned_cols=106  Identities=25%  Similarity=0.436  Sum_probs=95.5

Q ss_pred             CccCC-CCceEEEEeecccCCcCCCCCCccchHHHHHHHHhcChHHHHHHHHHHH-hhhCCCCCcceeeEEEecCCCCCC
Q psy2837           1 MGSDK-KKFLSMLLALRTKMNADTGEPLDELETDTKDWLKSLGVYKATQAAIDRA-NLKSISNAQKIQKFEFLPADFSIP   78 (107)
Q Consensus         1 V~G~~-~~~l~alv~p~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~~l~~~-n~~~l~~~e~i~~~~l~~~~ft~e   78 (107)
                      |+|++ ++||+|||+|+.+.++++++ ...+..+..+||++..+++.+..++.+. |++++.+||+|++|+|.++|||++
T Consensus       581 V~g~s~~~~LvaiVvpd~e~~~~~a~-~~~~~~~~eelc~n~~~k~~vl~el~~~~~~~~l~~fe~vk~v~l~~~~Fsie  659 (691)
T KOG1256|consen  581 VLGDSLRSFLVAIVVPDPEVLKSWAA-KDGVKGTFEELCRNLDVKEAVLSELVKVGKENGLKGFEQVKKVHLLPDPFSIE  659 (691)
T ss_pred             EECCcchhcEEEEEecChhhchhhHH-HccCchhHHHHhcChhhHHHHHHHHHHHHhhhhccChhhEeeEEEeccccccc
Confidence            57888 99999999999877666555 3345578999999999999999999997 777899999999999999999999


Q ss_pred             CCcccccCCCchHHHHHHHHHHHHhhhcC
Q psy2837          79 TGELGPTMKVKRPFVVKKYQSIIDKFYDV  107 (107)
Q Consensus        79 ng~lT~t~KlkR~~v~~~y~~~I~~ly~~  107 (107)
                      ||+||||+|+||+.+.++|+++||+||+.
T Consensus       660 nglltPTlK~KR~~l~~~yk~~Id~mY~~  688 (691)
T KOG1256|consen  660 NGLLTPTLKIKRPQLLKYYKKQIDELYKE  688 (691)
T ss_pred             CCccchhhhhhhHHHHHHHHHHHHHHHhh
Confidence            99999999999999999999999999963

>PLN02614 long-chain acyl-CoA synthetase Back     alignment and domain information
>PLN02387 long-chain-fatty-acid-CoA ligase family protein Back     alignment and domain information
>PLN02430 long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>PTZ00297 pantothenate kinase; Provisional Back     alignment and domain information
>PTZ00216 acyl-CoA synthetase; Provisional Back     alignment and domain information
>KOG1180|consensus Back     alignment and domain information
>PLN02861 long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>PTZ00342 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PLN02736 long-chain acyl-CoA synthetase Back     alignment and domain information
>COG1022 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] Back     alignment and domain information
>PRK12582 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK08180 feruloyl-CoA synthase; Reviewed Back     alignment and domain information
>PRK08316 acyl-CoA synthetase; Validated Back     alignment and domain information
>PTZ00237 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK07445 O-succinylbenzoic acid--CoA ligase; Reviewed Back     alignment and domain information
>PRK05852 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN02860 o-succinylbenzoate-CoA ligase Back     alignment and domain information
>TIGR01734 D-ala-DACP-lig D-alanine--poly(phosphoribitol) ligase, subunit 1 Back     alignment and domain information
>PRK07514 malonyl-CoA synthase; Validated Back     alignment and domain information
>PRK04813 D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional Back     alignment and domain information
>PRK07824 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PRK08276 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK06839 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK03584 acetoacetyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK07470 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR01217 ac_ac_CoA_syn acetoacetyl-CoA synthase Back     alignment and domain information
>PLN03052 acetate--CoA ligase; Provisional Back     alignment and domain information
>PRK06164 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06188 acyl-CoA synthetase; Validated Back     alignment and domain information
>KOG1176|consensus Back     alignment and domain information
>TIGR02188 Ac_CoA_lig_AcsA acetate--CoA ligase Back     alignment and domain information
>PRK09088 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK05605 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PLN02574 4-coumarate--CoA ligase-like Back     alignment and domain information
>PRK13391 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PLN02246 4-coumarate--CoA ligase Back     alignment and domain information
>PLN02479 acetate-CoA ligase Back     alignment and domain information
>PRK00174 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK07788 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK03640 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PRK04319 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PLN02330 4-coumarate--CoA ligase-like 1 Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PLN03051 acyl-activating enzyme; Provisional Back     alignment and domain information
>PRK06187 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK06060 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08315 AMP-binding domain protein; Validated Back     alignment and domain information
>PLN02654 acetate-CoA ligase Back     alignment and domain information
>PRK09274 peptide synthase; Provisional Back     alignment and domain information
>PRK06178 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK12583 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK06018 putative acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK10946 entE enterobactin synthase subunit E; Provisional Back     alignment and domain information
>PRK13382 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PLN03102 acyl-activating enzyme; Provisional Back     alignment and domain information
>PRK07786 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK12406 long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>PRK13295 cyclohexanecarboxylate-CoA ligase; Reviewed Back     alignment and domain information
>PRK06155 crotonobetaine/carnitine-CoA ligase; Provisional Back     alignment and domain information
>COG0365 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] Back     alignment and domain information
>PRK05850 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06087 short chain acyl-CoA synthetase; Reviewed Back     alignment and domain information
>PRK07798 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family Back     alignment and domain information
>PRK05857 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07638 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06145 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR03098 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosortase system type 1 associated Back     alignment and domain information
>PRK08162 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK05620 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08279 long-chain-acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK10524 prpE propionyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK13390 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PF13193 AMP-binding_C: AMP-binding enzyme C-terminal domain; PDB: 3L8C_B 2VSQ_A 3R44_A 3RG2_B 3A9U_A 3A9V_A 3NI2_A 1V26_B 1ULT_B 1V25_B Back     alignment and domain information
>PRK09029 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PRK08314 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>TIGR02316 propion_prpE propionate--CoA ligase Back     alignment and domain information
>PRK07867 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07529 AMP-binding domain protein; Validated Back     alignment and domain information
>PRK07008 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK05677 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK07787 acyl-CoA synthetase; Validated Back     alignment and domain information
>KOG1177|consensus Back     alignment and domain information
>PRK13388 acyl-CoA synthetase; Provisional Back     alignment and domain information
>COG0318 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>PRK08043 bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query107
1mdb_A539 2,3-dihydroxybenzoate-AMP ligase; adenylation doma 97.47
3fce_A512 D-alanine--poly(phosphoribitol) ligase subunit 1; 97.16
2d1s_A548 Luciferase, luciferin 4-monooxygenase; alpha/beta, 97.07
3e7w_A511 D-alanine--poly(phosphoribitol) ligase subunit 1; 96.93
4gs5_A358 Acyl-COA synthetase (AMP-forming)/AMP-acid ligase 96.9
1pg4_A652 Acetyl-COA synthetase; AMP-forming, adenylate-form 96.39
1t5h_X504 4-chlorobenzoyl COA ligase; adenylate-forming coen 96.1
1ry2_A663 Acetyl-coenzyme A synthetase 1, acyl-activating en 95.94
4fuq_A503 Malonyl COA synthetase; ANL superfamily, methylma 95.92
3c5e_A570 Acyl-coenzyme A synthetase ACSM2A, mitochondrial; 95.84
3l8c_A521 D-alanine--poly(phosphoribitol) ligase subunit 1; 95.53
3ni2_A536 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy 95.44
3etc_A580 AMP-binding protein; adenylate-forming acyl-COA sy 95.3
3r44_A517 Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s 94.69
3tsy_A 979 Fusion protein 4-coumarate--COA ligase 1, resvera 94.56
3g7s_A549 Long-chain-fatty-acid--COA ligase (FADD-1); protei 94.47
2v7b_A529 Benzoate-coenzyme A ligase; benzoate oxidation, be 94.4
3ivr_A509 Putative long-chain-fatty-acid COA ligase; structu 94.33
3ipl_A501 2-succinylbenzoate--COA ligase; structural genomic 93.73
3nyq_A505 Malonyl-COA ligase; A/B topology ababa sandwich be 93.36
3rg2_A617 Enterobactin synthase component E (ENTE), 2,3-DIH 93.32
1amu_A563 GRSA, gramicidin synthetase 1; peptide synthetase, 92.81
3gqw_A576 Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen 92.58
1v25_A541 Long-chain-fatty-acid-COA synthetase; ligase, stru 91.26
4gr5_A570 Non-ribosomal peptide synthetase; MBTH-like domain 87.31
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl c 86.89
4dg8_A620 PA1221; ANL superfamily, adenylation domain, pepti 85.98
3ite_A562 SIDN siderophore synthetase; ligase, non-ribosomal 85.39
3rix_A550 Luciferase, luciferin 4-monooxygenase; oxidoreduct 82.7
3o83_A544 Peptide arylation enzyme; ligase, adenylation of 2 82.69
>1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A Back     alignment and structure
Probab=97.47  E-value=0.00018  Score=54.50  Aligned_cols=44  Identities=11%  Similarity=0.117  Sum_probs=37.1

Q ss_pred             CCCCCcceeeEEEecCCCCCCCCcccccCCCchHHHHHHHHHHHHhhhcC
Q psy2837          58 SISNAQKIQKFEFLPADFSIPTGELGPTMKVKRPFVVKKYQSIIDKFYDV  107 (107)
Q Consensus        58 ~l~~~e~i~~~~l~~~~ft~eng~lT~t~KlkR~~v~~~y~~~I~~ly~~  107 (107)
                      +|+.|..++.|.+++ .|     -+|++||+.|+.+.+.|.+.|++||++
T Consensus       496 ~L~~~~~P~~i~~v~-~l-----P~t~~GKi~r~~L~~~~~~~i~~~y~~  539 (539)
T 1mdb_A          496 GLAAYKIPDRVEFVE-SF-----PQTGVGKVSKKALREAISEKLLAGFKK  539 (539)
T ss_dssp             TCCGGGSCSEEEECS-SC-----CBCTTSCBCHHHHHHHHHHHHHTC---
T ss_pred             CCCcccCCCEEEEec-cC-----CCCCCcCEeHHHHHHHHHHHHhccccC
Confidence            389999999999885 34     489999999999999999999999974
>3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* Back     alignment and structure
>2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* Back     alignment and structure
>3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* Back     alignment and structure
>4gs5_A Acyl-COA synthetase (AMP-forming)/AMP-acid ligase protein; structural genomics, PSI-biology; 2.02A {Dyadobacter fermentans} Back     alignment and structure
>1pg4_A Acetyl-COA synthetase; AMP-forming, adenylate-forming, thioester-forming, ligase; HET: COA PRX; 1.75A {Salmonella enterica} SCOP: e.23.1.1 PDB: 1pg3_A* 2p2f_A* 2p2b_A* 2p2q_A* 2p2j_A* 2p20_A* 2p2m_A* Back     alignment and structure
>1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* Back     alignment and structure
>1ry2_A Acetyl-coenzyme A synthetase 1, acyl-activating enzyme 1; AMP forming, related to firefly luciferase, ligase; HET: AMP; 2.30A {Saccharomyces cerevisiae} SCOP: e.23.1.1 Back     alignment and structure
>4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* 4gxr_A* 4gxq_A* Back     alignment and structure
>3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* Back     alignment and structure
>3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* Back     alignment and structure
>3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* Back     alignment and structure
>3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} Back     alignment and structure
>3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Back     alignment and structure
>3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} Back     alignment and structure
>3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} SCOP: e.23.1.0 Back     alignment and structure
>3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* Back     alignment and structure
>3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Back     alignment and structure
>1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 Back     alignment and structure
>1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* Back     alignment and structure
>4gr5_A Non-ribosomal peptide synthetase; MBTH-like domain, adenylation domain, ligase, rossmann fold, binding; HET: APC TLA; 1.92A {Streptomyces lydicus} PDB: 4gr4_A Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* Back     alignment and structure
>3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} Back     alignment and structure
>3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} SCOP: e.23.1.1 PDB: 1ba3_A 1lci_A* 4e5d_A* 3ies_A* 3iep_A* 3ier_A* 4g36_A* 4g37_A* 3qya_A Back     alignment and structure
>3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} SCOP: e.23.1.0 PDB: 3o82_A* 3o84_A* 3u16_A* 3u17_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query107
d1mdba_536 Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtil 97.28
d1ry2a_640 Acetyl-CoA synthetase {Baker's yeast (Saccharomyce 96.97
d3cw9a1503 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId 96.51
d1amua_514 Phenylalanine activating domain of gramicidin synt 95.74
d1pg4a_643 Acetyl-CoA synthetase {Salmonella enterica [TaxId: 95.66
d1v25a_534 Long chain fatty acid-CoA ligase TT0168 {Thermus t 95.23
d1lcia_541 Luciferase {Firefly (Photinus pyralis) [TaxId: 705 94.76
>d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Acetyl-CoA synthetase-like
superfamily: Acetyl-CoA synthetase-like
family: Acetyl-CoA synthetase-like
domain: Dihydroxybenzoate-AMP ligase DhbE
species: Bacillus subtilis [TaxId: 1423]

Probab=97.28  E-value=0.00024  Score=50.88  Aligned_cols=39  Identities=13%  Similarity=0.152  Sum_probs=33.6

Q ss_pred             CCCCCcceeeEEEecCCCCCCCCcccccCCCchHHHHHHHHHHHH
Q psy2837          58 SISNAQKIQKFEFLPADFSIPTGELGPTMKVKRPFVVKKYQSIID  102 (107)
Q Consensus        58 ~l~~~e~i~~~~l~~~~ft~eng~lT~t~KlkR~~v~~~y~~~I~  102 (107)
                      .++.|..++.|.++++ +     -+|++|||.|+++.+.|++.|.
T Consensus       496 ~l~~~~~P~~i~~v~~-l-----P~t~~GKi~r~~L~~~~~~~l~  534 (536)
T d1mdba_         496 GLAAYKIPDRVEFVES-F-----PQTGVGKVSKKALREAISEKLL  534 (536)
T ss_dssp             TCCGGGSCSEEEECSS-C-----CBCTTSCBCHHHHHHHHHHHHH
T ss_pred             CCCcCcCccEEEEECC-C-----CcCCCcCccHHHHHHHHHHHHh
Confidence            4899999999998864 3     3899999999999999998775
>d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Back     information, alignment and structure
>d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Back     information, alignment and structure