Psyllid ID: psy2915

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880---
MTDSKYFTTTKKGEIFELKGELNSDKKEKKREAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSHPDMAIMAFSTFFYQKSSSSFQCMIDIRSIPLFDLCSSVGVFVKDCEDSNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLYDINAQLVEDQGFLDQLKDLLSDSNPMVVANAVAAILLLPRKSYWQRNLSSRKKQICWNLPYLMNLSVIYPAWPLSTINPHTPLLKVLMKLMEMLPGEGDFVSTLTKKLAPPLVTLLSSEPEVQYVALRNINLIVQKRPDILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLSELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKYAERIDNADELLESFLEGFHDENTQVQLQLLTAIVKLFLKRPTDTQELVQQVLSLATQDSDNPDLRDRGFIYWRLLSTGNTFYILLHLTRLVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSHPDMAIMAVNTFVKDCEDSNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLYDINAQLVEDQGFLDQLKDLLSDSNPMVVANAVAALSEMNEASTSGVALIEMNAQTINKLLTALNECTEWGQVFILDSLSNYSPKDDREAQSICERITPRLAHANAAVVLSAVKVLMKLMEMLPGEGDFVSTLTKKLAPPLVTLLSSEPEVQYVALRNINLIVQKRPDILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVNYVVQEAIVVIKDIFRKYPNKYETIISTLCENLDTLDEPEARASMIWIIGEYAERIDNADELLESFLE
ccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccHHHHHcccccccccccHHHHHHHcccccHHHHHHHHHHHccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHcHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHcccEEEEEccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccccHHHHHHHcccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccHHHccHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccHHHHcccccHHHHHHHHHHHHHHHHHcccHHHHcccEEEEcccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHHHHccccccccHHHHHHHHHc
ccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccHEEEEEHcccccccEEEEEEEEccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHccHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHcccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcHHHHHHHcccHHHHHHHHHHHHHHHHHcHHHHHHHcEEEEEEcccccEEEHHHHHHHHHHHcHHcHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHEEEHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHccHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccHEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcHHHHHHHcccHHHHHHHHHHHHHHHHHcHHHHHHHHEEEEEEcccccEEEHHHHHHHHHHHcHHcHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHc
mtdskyftttKKGEIFElkgelnsdkKEKKREAVKKVIASMtvgkdvsalfpdvvncmqtdnlELKKLVYLYLMNYAKSHPDMAIMAFSTFFYQkssssfqcmidirsiplfdlcssvgvfvkdcedsnpLIRALAVRTMGCIRVDKITEYLCEPlrkclkdedpyvRKTAAVCVAKLYDINAQLVEDQGFLDQLKdllsdsnpmVVANAVAAILLLPRKSYWQRNLSSrkkqicwnlpylmnlsviypawplstinphtPLLKVLMKLMEmlpgegdfvstltkklapplvtllssepevQYVALRNINLIVQKRPDILKHEMKVFFVKyndpiyvklEKLDIMIRLASQANIAQVLSELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKYAERIDNADELLESFLEGFHDENTQVQLQLLTAIVKLFLKRPTDTQELVQQVLSLatqdsdnpdlrdrgFIYWRLLSTGNTFYILLHLTRLVIASMtvgkdvsalfpdvvncmqtdnlELKKLVYLYLMNYAKSHPDMAIMAVNTFVkdcedsnpLIRALAVRTMGCIRVDKITEYLCEPlrkclkdedpyvRKTAAVCVAKLYDINAQLVEDQGFLDQLKdllsdsnpMVVANAVAALSEMNEASTSGVALIEMNAQTINKLLTALNECTEWGQVFildslsnyspkddreAQSICERITPRLAHANAAVVLSAVKVLMKLMEmlpgegdfvstltkklapplvtllssepevQYVALRNINLIVQKRPDILKHEMKVFFVKyndpiyvklEKLDIMIRLASQANIAQVNYVVQEAIVVIKDIFRKYPNKYETIISTLCEnldtldepeaRASMIWIIGEYAERIDNADELLESFLE
mtdskyftttkkgeifelkgelnsdkkekKREAVKKVIAsmtvgkdvsalfpDVVNCMQTDNLELKKLVYLYLMNYAKSHPDMAIMAFSTFFYQKSSSSFQCMIDIRSIPLFDLCSSVGVFVKDCEDSNPLIRALAVRTMGCIRVDKITEYLCEPlrkclkdedpyvRKTAAVCVAKLYDINAQLVEDQGFLDQLKDLLSDSNPMVVANAVAAILLLPRKSYWQRNLSSRKKQICWNLPYLMNLSVIYPAWPLSTINPHTPLLKVLMKLMEMLPGEGDFVSTLTKKLAPPLVTLLSSEPEVQYVALRNINLIVQKRPDILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLSELKEYATEVDVDFVRKAVRAIGRcaikveqsaerCVSTLLDLIQTKYAERIDNADELLESFLEGFHDENTQVQLQLLTAIVKLFLKRPTDTQELVQQVLslatqdsdnpdlRDRGFIYWRLLSTGNTFYILLHLTRLVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSHPDMAIMAVNTFVKDCEDSNPLIRALAVRTMGCIRVDKITEYLCEPlrkclkdedpyvRKTAAVCVAKLYDINAQLVEDQGFLDQLKDLLSDSNPMVVANAVAALSEMNEASTSGVALIEMNAQTINKLLTALNECTEWGQVFILDSLSNYSPKDDREAQSICERITPRLAHANAAVVLSAVKVLMKLMEMLPGEGDFVSTLTKKLAPPLVTLLSSEPEVQYVALRNINLIVQKRPDILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVNYVVQEAIVVIKDIFRKYPNKYETIISTLCENLDTLDEPEARASMIWIIGEYAERIDNADELLESFLE
MTDSKYFTTTKKGEIFELKGELNSDkkekkreavkkvIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSHPDMAIMAFSTFFYQKSSSSFQCMIDIRSIPLFDLCSSVGVFVKDCEDSNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLYDINAQLVEDQGFLDQLKDLLSDSNPMvvanavaailllPRKSYWQRNLSSRKKQICWNLPYLMNLSVIYPAWPLSTINPHTPllkvlmklmemlPGEGDFVSTLTKKLAPPLVTLLSSEPEVQYVALRNINLIVQKRPDILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLSELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKYAERIDNADELLESFLEGFHDENTQVQLQLLTAIVKLFLKRPTDTQELVQQVLSLATQDSDNPDLRDRGFIYWRLLSTGNTFYILLHLTRLVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSHPDMAIMAVNTFVKDCEDSNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLYDINAQLVEDQGFLDQLKDLLSDSNPMVVANAVAALSEMNEASTSGVALIEMNAQTINKLLTALNECTEWGQVFILDSLSNYSPKDDREAQSICERITPRLAHANAAVVLSAVKVLMKLMEMLPGEGDFVSTLTKKLAPPLVTLLSSEPEVQYVALRNINLIVQKRPDILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVNYVVQEAIVVIKDIFRKYPNKYETIISTLCENLDTLDEPEARASMIWIIGEYAERIDNADELLESFLE
************************************VIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSHPDMAIMAFSTFFYQKSSSSFQCMIDIRSIPLFDLCSSVGVFVKDCEDSNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLYDINAQLVEDQGFLDQLKDLLSDSNPMVVANAVAAILLLPRKSYWQRNLSSRKKQICWNLPYLMNLSVIYPAWPLSTINPHTPLLKVLMKLMEMLPGEGDFVSTLTKKLAPPLVTLLSSEPEVQYVALRNINLIVQKRPDILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLSELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKYAERIDNADELLESFLEGFHDENTQVQLQLLTAIVKLFLKRPTDTQELVQQVLSLA********LRDRGFIYWRLLSTGNTFYILLHLTRLVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSHPDMAIMAVNTFVKDCEDSNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLYDINAQLVEDQGFLDQLKDLLSDSNPMVVANAVAALSEMNEASTSGVALIEMNAQTINKLLTALNECTEWGQVFILDSLSNY*********SICERITPRLAHANAAVVLSAVKVLMKLMEMLPGEGDFVSTLTKKLAPPLVTLLSSEPEVQYVALRNINLIVQKRPDILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVNYVVQEAIVVIKDIFRKYPNKYETIISTLCENLDTLDEPEARASMIWIIGEYAERIDN**********
***SKYF*TTKKG**************EKKREAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSHPDMAIMAFSTFFYQKSSSSFQCMIDIRSIPLFDLCSSVGVFVKDCEDSNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLYDINAQLVEDQGFLDQLKDLLSDSNPMVVANAVAAILLLPRKSYWQRNLSSRKKQICWNLPYLMNLSVIYPAWPLSTINPHTPLLKVLMKLMEMLPGEGDFVSTLTKKLAPPLVTLLSSEPEVQYVALRNINLIVQKRPDILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLSELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKYAERIDNADELLESFLEGFHDENTQVQLQLLTAIVKLFLKRPTDTQELVQQVLSLATQDSDNPDLRDRGFIYWRLLSTGNTFYILLHLTRLVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSHPDMAIMAVNTFVKDCEDSNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLYDINAQLVEDQGFLDQLKDLLSDSNPMVVANAVAALSEMNEASTSGVALIEMNAQTINKLLTALNECTEWGQVFILDSLSNYSPKDDREAQSICERITPRLAHANAAVVLSAVKVLMKLMEMLPGEGDFVSTLTKKLAPPLVTLLSSEPEVQYVALRNINLIVQKRPDILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVNYVVQEAIVVIKDIFRKYPNKYETIISTLCENLDTLDEPEARASMIWIIGEYAERIDNADELLESFLE
********TTKKGEIFELKGELNSDKKEKKREAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSHPDMAIMAFSTFFYQKSSSSFQCMIDIRSIPLFDLCSSVGVFVKDCEDSNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLYDINAQLVEDQGFLDQLKDLLSDSNPMVVANAVAAILLLPRKSYWQRNLSSRKKQICWNLPYLMNLSVIYPAWPLSTINPHTPLLKVLMKLMEMLPGEGDFVSTLTKKLAPPLVTLLSSEPEVQYVALRNINLIVQKRPDILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLSELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKYAERIDNADELLESFLEGFHDENTQVQLQLLTAIVKLFLKRPTDTQELVQQVLSLATQDSDNPDLRDRGFIYWRLLSTGNTFYILLHLTRLVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSHPDMAIMAVNTFVKDCEDSNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLYDINAQLVEDQGFLDQLKDLLSDSNPMVVANAVAALSEMNEASTSGVALIEMNAQTINKLLTALNECTEWGQVFILDSLSNYSPKDDREAQSICERITPRLAHANAAVVLSAVKVLMKLMEMLPGEGDFVSTLTKKLAPPLVTLLSSEPEVQYVALRNINLIVQKRPDILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVNYVVQEAIVVIKDIFRKYPNKYETIISTLCENLDTLDEPEARASMIWIIGEYAERIDNADELLESFLE
************GEIFELKGELNSDKKEKKREAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSHPDMAIMAFSTFFYQKSSSSFQCMIDIRSIPLFDLCSSVGVFVKDCEDSNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLYDINAQLVEDQGFLDQLKDLLSDSNPMVVANAVAAILLLPRKSYWQRNLSSRKKQICWNLPYLMNLSVIYPAWPLSTINPHTPLLKVLMKLMEMLPGEGDFVSTLTKKLAPPLVTLLSSEPEVQYVALRNINLIVQKRPDILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLSELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKYAERIDNADELLESFLEGFHDENTQVQLQLLTAIVKLFLKRPTDTQELVQQVLSLATQDSDNPDLRDRGFIYWRLLSTGNTFYILLHLTRLVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSHPDMAIMAVNTFVKDCEDSNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLYDINAQLVEDQGFLDQLKDLLSDSNPMVVANAVAALSEMNEASTSGVALIEMNAQTINKLLTALNECTEWGQVFILDSLSNYSPKDDREAQSICERITPRLAHANAAVVLSAVKVLMKLMEMLPGEGDFVSTLTKKLAPPLVTLLSSEPEVQYVALRNINLIVQKRPDILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVNYVVQEAIVVIKDIFRKYPNKYETIISTLCENLDTLDEPEARASMIWIIGEYAERIDNADELLESFLE
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTDSKYFTTTKKGEIFELKGELNSDKKEKKREAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSHPDMAIMAFSTFFYQKSSSSFQCMIDIRSIPLFDLCSSVGVFVKDCEDSNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLYDINAQLVEDQGFLDQLKDLLSDSNPMVVANAVAAILLLPRKSYWQRNLSSRKKQICWNLPYLMNLSVIYPAWPLSTINPHTPLLKVLMKLMEMLPGEGDFVSTLTKKLAPPLVTLLSSEPEVQYVALRNINLIVQKRPDILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLSELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKYAERIDNADELLESFLEGFHDENTQVQLQLLTAIVKLFLKRPTDTQELVQQVLSLATQDSDNPDLRDRGFIYWRLLSTGNTFYILLHLTRLVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSHPDMAIMAVNTFVKDCEDSNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLYDINAQLVEDQGFLDQLKDLLSDSNPMVVANAVAALSEMNEASTSGVALIEMNAQTINKLLTALNECTEWGQVFILDSLSNYSPKDDREAQSICERITPRLAHANAAVVLSAVKVLMKLMEMLPGEGDFVSTLTKKLAPPLVTLLSSEPEVQYVALRNINLIVQKRPDILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVNYVVQEAIVVIKDIFRKYPNKYETIISTLCENLDTLDEPEARASMIWIIGEYAERIDNADELLESFLE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query883 2.2.26 [Sep-21-2011]
P63009937 AP-2 complex subunit beta yes N/A 0.511 0.482 0.671 0.0
Q08DS7951 AP-1 complex subunit beta yes N/A 0.511 0.475 0.671 0.0
P62944937 AP-2 complex subunit beta yes N/A 0.511 0.482 0.669 0.0
P63010937 AP-2 complex subunit beta yes N/A 0.511 0.482 0.669 0.0
Q9DBG3937 AP-2 complex subunit beta yes N/A 0.511 0.482 0.669 0.0
Q10567 949 AP-1 complex subunit beta no N/A 0.436 0.405 0.788 0.0
O35643 943 AP-1 complex subunit beta no N/A 0.436 0.408 0.788 0.0
P52303949 AP-1 complex subunit beta no N/A 0.511 0.476 0.685 0.0
O81742 893 Beta-adaptin-like protein yes N/A 0.434 0.430 0.692 1e-166
Q54X82942 AP-1 complex subunit beta yes N/A 0.511 0.479 0.561 1e-164
>sp|P63009|AP2B1_BOVIN AP-2 complex subunit beta OS=Bos taurus GN=AP2B1 PE=1 SV=2 Back     alignment and function desciption
 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/563 (67%), Positives = 407/563 (72%), Gaps = 111/563 (19%)

Query: 1   MTDSKYFTTTKKGEIFELKGELNSDKKEKKREAVKKVIASMTVGKDVSALFPDVVNCMQT 60
           MTDSKYFTT KKGEIFELK ELN++KKEK++EAVKKVIA+MTVGKDVS+LFPDVVNCMQT
Sbjct: 1   MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT 60

Query: 61  DNLELKKLVYLYLMNYAKSHPDMAIMAFSTFFYQKSSSSFQCMIDIRSIPLFDLCSSVGV 120
           DNLELKKLVYLYLMNYAKS PDMAIMA                              V  
Sbjct: 61  DNLELKKLVYLYLMNYAKSQPDMAIMA------------------------------VNS 90

Query: 121 FVKDCEDSNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLYD 180
           FVKDCED NPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKL+D
Sbjct: 91  FVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHD 150

Query: 181 INAQLVEDQGFLDQLKDLLSDSNPMVVANAVAAILLLPRKSYWQRNLSSRKKQICWNLPY 240
           INAQ+VEDQGFLD L+DL++DSNPMVVANAVAA+  +  +S+   NL     Q    L  
Sbjct: 151 INAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEI-SESHPNSNLLDLNPQNINKLLT 209

Query: 241 LMN----LSVIYPAWPLSTINPH------------TPLL------------KVLMKLMEM 272
            +N       I+    LS  NP             TP L            KVLMK +E+
Sbjct: 210 ALNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLEL 269

Query: 273 LPGEGDFVSTLTKKLAPPLVTLLSSEPEVQYVALRNINLIVQKRPDILKHEMKVFFVKYN 332
           LP E D+ + L KKLAPPLVTLLS EPEVQYVALRNINLIVQKRP+ILK E+KVFFVKYN
Sbjct: 270 LPKESDYYNMLLKKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYN 329

Query: 333 DPIYVKLEKLDIMIRLASQANIAQVLSELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAE 392
           DPIYVKLEKLDIMIRLASQANIAQVL+ELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAE
Sbjct: 330 DPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAE 389

Query: 393 RCVSTLLDLIQTK----------------------------------------------- 405
           RCVSTLLDLIQTK                                               
Sbjct: 390 RCVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARAAMI 449

Query: 406 -----YAERIDNADELLESFLEGFHDENTQVQLQLLTAIVKLFLKRPTDTQELVQQVLSL 460
                YAERIDNADELLESFLEGFHDE+TQVQL LLTAIVKLFLK+P++TQELVQQVLSL
Sbjct: 450 WIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSL 509

Query: 461 ATQDSDNPDLRDRGFIYWRLLST 483
           ATQDSDNPDLRDRG+IYWRLLST
Sbjct: 510 ATQDSDNPDLRDRGYIYWRLLST 532
Component of the adaptor protein complex 2 (AP-2). Adaptor protein complexes function in protein transport via transport vesicles in different membrane traffic pathways. Adaptor protein complexes are vesicle coat components and appear to be involved in cargo selection and vesicle formation. AP-2 is involved in clathrin-dependent endocytosis in which cargo proteins are incorporated into vesicles surrrounded by clathrin (clathrin-coated vesicles, CCVs) which are destined for fusion with the early endosome. The clathrin lattice serves as a mechanical scaffold but is itself unable to bind directly to membrane components. Clathrin-associated adaptor protein (AP) complexes which can bind directly to both the clathrin lattice and to the lipid and protein components of membranes are considered to be the major clathrin adaptors contributing the CCV formation. AP-2 also serves as a cargo receptor to selectively sort the membrane proteins involved in receptor-mediated endocytosis. AP-2 seems to play a role in the recycling of synaptic vesicle membranes from the presynaptic surface. AP-2 recognizes Y-X-X-[FILMV] (Y-X-X-Phi) and [ED]-X-X-X-L-[LI] endocytosis signal motifs within the cytosolic tails of transmembrane cargo molecules. AP-2 may also play a role in maintaining normal post-endocytic trafficking through the ARF6-regulated, non-clathrin pathway. The AP-2 beta subunit acts via its C-terminal appendage domain as a scaffolding platform for endocytic accessory proteins; at least some clathrin-associated sorting proteins (CLASPs) are recognized by their [DE]-X(1,2)-F-X-X-[FL]-X-X-X-R motif. The AP-2 beta subunit binds to clathrin heavy chain, promoting clathrin lattice assembly; clathrin displaces at least some CLASPs from AP2B1 which probably then can be positioned for further coat assembly.
Bos taurus (taxid: 9913)
>sp|Q08DS7|AP1B1_BOVIN AP-1 complex subunit beta-1 OS=Bos taurus GN=AP2B1 PE=2 SV=1 Back     alignment and function description
>sp|P62944|AP2B1_RAT AP-2 complex subunit beta OS=Rattus norvegicus GN=Ap2b1 PE=1 SV=1 Back     alignment and function description
>sp|P63010|AP2B1_HUMAN AP-2 complex subunit beta OS=Homo sapiens GN=AP2B1 PE=1 SV=1 Back     alignment and function description
>sp|Q9DBG3|AP2B1_MOUSE AP-2 complex subunit beta OS=Mus musculus GN=Ap2b1 PE=1 SV=1 Back     alignment and function description
>sp|Q10567|AP1B1_HUMAN AP-1 complex subunit beta-1 OS=Homo sapiens GN=AP1B1 PE=1 SV=2 Back     alignment and function description
>sp|O35643|AP1B1_MOUSE AP-1 complex subunit beta-1 OS=Mus musculus GN=Ap1b1 PE=1 SV=2 Back     alignment and function description
>sp|P52303|AP1B1_RAT AP-1 complex subunit beta-1 OS=Rattus norvegicus GN=Ap1b1 PE=1 SV=1 Back     alignment and function description
>sp|O81742|APBLC_ARATH Beta-adaptin-like protein C OS=Arabidopsis thaliana GN=BETAC-AD PE=1 SV=2 Back     alignment and function description
>sp|Q54X82|AP1B_DICDI AP-1 complex subunit beta OS=Dictyostelium discoideum GN=ap1b1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query883
156544522921 PREDICTED: AP-1 complex subunit beta-1-l 0.437 0.419 0.852 0.0
322783279922 hypothetical protein SINV_11497 [Solenop 0.437 0.418 0.850 0.0
350415874923 PREDICTED: AP-2 complex subunit beta-lik 0.437 0.418 0.852 0.0
193683802912 PREDICTED: AP-2 complex subunit beta-lik 0.513 0.496 0.706 0.0
332016250881 AP-1 complex subunit beta-1 [Acromyrmex 0.433 0.434 0.854 0.0
242011463911 conserved hypothetical protein [Pediculu 0.437 0.423 0.843 0.0
427788633940 Putative beta adaptin [Rhipicephalus pul 0.513 0.481 0.703 0.0
241709928938 AP-2 complex subunit beta-1, putative [I 0.513 0.482 0.703 0.0
380014710932 PREDICTED: AP-2 complex subunit beta-lik 0.437 0.414 0.835 0.0
307181133944 AP-1 complex subunit beta-1 [Camponotus 0.437 0.408 0.821 0.0
>gi|156544522|ref|XP_001607195.1| PREDICTED: AP-1 complex subunit beta-1-like isoform 1 [Nasonia vitripennis] gi|345480849|ref|XP_003424226.1| PREDICTED: AP-1 complex subunit beta-1-like isoform 2 [Nasonia vitripennis] gi|345480851|ref|XP_003424227.1| PREDICTED: AP-1 complex subunit beta-1-like isoform 3 [Nasonia vitripennis] gi|345480853|ref|XP_003424228.1| PREDICTED: AP-1 complex subunit beta-1-like isoform 4 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  736 bits (1900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/435 (85%), Positives = 376/435 (86%), Gaps = 49/435 (11%)

Query: 498 IASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSHPDMAIMAVNTFVKDCED 557
           IASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKS PDMAIMAVNTFVKDCED
Sbjct: 38  IASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCED 97

Query: 558 SNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLYDINAQLVE 617
            NPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLYDINA LVE
Sbjct: 98  PNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLYDINAGLVE 157

Query: 618 DQGFLDQLKDLLSDSNPMVVANAVAALSEMNEASTSGVALIEMNAQTINKLLTALNECTE 677
           DQGFLDQLKDLLSDSNPMVVANAVAALSE+NE+S SG  L+EMNAQTINKLLTALNECTE
Sbjct: 158 DQGFLDQLKDLLSDSNPMVVANAVAALSEINESSPSGQPLVEMNAQTINKLLTALNECTE 217

Query: 678 WGQVFILDSLSNYSPKDDREAQSICERITPRLAHANAAVVLSAVKVLMKLMEMLPGEGDF 737
           WGQVFILDSL+NYSPKDDREAQSICERITPRLAHANAAVVLSAVKVLMKLMEML  E DF
Sbjct: 218 WGQVFILDSLANYSPKDDREAQSICERITPRLAHANAAVVLSAVKVLMKLMEMLQSESDF 277

Query: 738 VSTLTKKLAPPLVTLLSSEPEVQYVALRNINLIVQKRPDILKHEMKVFFVKYNDPIYVKL 797
           V TLTKKLAPPLVTLLSSEPEVQYVALRNINLIVQKRPDILKHEMKVFFVKYNDPIYVKL
Sbjct: 278 VGTLTKKLAPPLVTLLSSEPEVQYVALRNINLIVQKRPDILKHEMKVFFVKYNDPIYVKL 337

Query: 798 EKLDIMIRLASQANIAQ------------------------------------------- 814
           EKLDIMIRLASQANIAQ                                           
Sbjct: 338 EKLDIMIRLASQANIAQVLSELKEYATEVDVDFVRKAVRAIGRCAIKVEPSAERCVSTLL 397

Query: 815 ------VNYVVQEAIVVIKDIFRKYPNKYETIISTLCENLDTLDEPEARASMIWIIGEYA 868
                 VNYVVQEAIVVIKDIFRKYPNKYE+IISTLCENLDTLDEPEARASMIWIIGEYA
Sbjct: 398 DLIQTKVNYVVQEAIVVIKDIFRKYPNKYESIISTLCENLDTLDEPEARASMIWIIGEYA 457

Query: 869 ERIDNADELLESFLE 883
           ERIDNADELLESFLE
Sbjct: 458 ERIDNADELLESFLE 472

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|322783279|gb|EFZ10863.1| hypothetical protein SINV_11497 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|350415874|ref|XP_003490775.1| PREDICTED: AP-2 complex subunit beta-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|193683802|ref|XP_001945401.1| PREDICTED: AP-2 complex subunit beta-like isoform 1 [Acyrthosiphon pisum] gi|328712609|ref|XP_003244859.1| PREDICTED: AP-2 complex subunit beta-like isoform 2 [Acyrthosiphon pisum] gi|328712611|ref|XP_003244860.1| PREDICTED: AP-2 complex subunit beta-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|332016250|gb|EGI57163.1| AP-1 complex subunit beta-1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|242011463|ref|XP_002426469.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212510581|gb|EEB13731.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|427788633|gb|JAA59768.1| Putative beta adaptin [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|241709928|ref|XP_002412040.1| AP-2 complex subunit beta-1, putative [Ixodes scapularis] gi|215505087|gb|EEC14581.1| AP-2 complex subunit beta-1, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|380014710|ref|XP_003691363.1| PREDICTED: AP-2 complex subunit beta-like [Apis florea] Back     alignment and taxonomy information
>gi|307181133|gb|EFN68864.1| AP-1 complex subunit beta-1 [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query883
UNIPROTKB|E2RRJ6 939 AP1B1 "Uncharacterized protein 0.379 0.356 0.854 2.1e-180
UNIPROTKB|F1RFI2 947 AP1B1 "Uncharacterized protein 0.379 0.353 0.854 2.1e-180
UNIPROTKB|I3LV02 949 AP1B1 "Uncharacterized protein 0.379 0.353 0.854 2.1e-180
UNIPROTKB|F1MIF2 946 AP1B1 "Uncharacterized protein 0.379 0.354 0.851 2.7e-180
MGI|MGI:1096368 943 Ap1b1 "adaptor protein complex 0.379 0.355 0.854 2.7e-180
UNIPROTKB|C9J1E7 578 AP1B1 "AP-1 complex subunit be 0.379 0.579 0.854 3.4e-180
UNIPROTKB|Q10567 949 AP1B1 "AP-1 complex subunit be 0.379 0.353 0.854 3.4e-180
UNIPROTKB|F1NCI1 922 AP1B1 "Uncharacterized protein 0.379 0.363 0.854 3.4e-180
UNIPROTKB|F1NCR9 881 AP1B1 "Uncharacterized protein 0.379 0.380 0.854 3.4e-180
RGD|2064 949 Ap1b1 "adaptor-related protein 0.379 0.353 0.845 9.2e-178
UNIPROTKB|E2RRJ6 AP1B1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 1437 (510.9 bits), Expect = 2.1e-180, Sum P(2) = 2.1e-180
 Identities = 288/337 (85%), Positives = 309/337 (91%)

Query:   497 VIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSHPDMAIMAVNTFVKDCE 556
             VIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKS PDMAIMAVNTFVKDCE
Sbjct:    37 VIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCE 96

Query:   557 DSNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLYDINAQLV 616
             D NPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKL+DINAQLV
Sbjct:    97 DPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLV 156

Query:   617 EDQGFLDQLKDLLSDSNPMVVANAVAALSEMNEASTSGVALIEMNAQTINKLLTALNECT 676
             EDQGFLD LKDL+SDSNPMVVANAVAALSE+ E+  S   L+++N Q+INKLLTALNECT
Sbjct:   157 EDQGFLDTLKDLISDSNPMVVANAVAALSEIAESHPSS-NLLDLNPQSINKLLTALNECT 215

Query:   677 EWGQVFILDSLSNYSPKDDREAQSICERITPRLAHANAAVVLSAVKVLMKLMEMLPGEGD 736
             EWGQ+FILD L+NY+PKDDREAQSICER+TPRL+HAN+AVVLSAVKVLMK MEML  + D
Sbjct:   216 EWGQIFILDCLANYTPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFMEMLSKDLD 275

Query:   737 FVSTLTKKLAPPLVTLLSSEPEVQYVALRNINLIVQKRPDILKHEMKVFFVKYNDPIYVK 796
             +  TL KKLAPPLVTLLS+EPE+QYVALRNINLIVQKRP+ILKHEMKVFFVKYNDPIYVK
Sbjct:   276 YYGTLLKKLAPPLVTLLSAEPELQYVALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVK 335

Query:   797 LEKLDIMIRLASQANIAQVNYVVQE-AIVVIKDIFRK 832
             LEKLDIMIRLASQANIAQV   ++E A  V  D  RK
Sbjct:   336 LEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRK 372
GO:0030131 "clathrin adaptor complex" evidence=IEA
GO:0016192 "vesicle-mediated transport" evidence=IEA
GO:0008565 "protein transporter activity" evidence=IEA
GO:0006886 "intracellular protein transport" evidence=IEA
UNIPROTKB|F1RFI2 AP1B1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LV02 AP1B1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MIF2 AP1B1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1096368 Ap1b1 "adaptor protein complex AP-1, beta 1 subunit" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|C9J1E7 AP1B1 "AP-1 complex subunit beta-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q10567 AP1B1 "AP-1 complex subunit beta-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NCI1 AP1B1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NCR9 AP1B1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|2064 Ap1b1 "adaptor-related protein complex 1, beta 1 subunit" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9DBG3AP2B1_MOUSENo assigned EC number0.66960.51180.4823yesN/A
P63010AP2B1_HUMANNo assigned EC number0.66960.51180.4823yesN/A
O81742APBLC_ARATHNo assigned EC number0.69260.43480.4300yesN/A
P62944AP2B1_RATNo assigned EC number0.66960.51180.4823yesN/A
P63009AP2B1_BOVINNo assigned EC number0.67140.51180.4823yesN/A
Q54X82AP1B_DICDINo assigned EC number0.56140.51180.4798yesN/A
Q08DS7AP1B1_BOVINNo assigned EC number0.67140.51180.4752yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query883
pfam01602522 pfam01602, Adaptin_N, Adaptin N terminal region 1e-120
pfam01602522 pfam01602, Adaptin_N, Adaptin N terminal region 1e-117
PTZ00429746 PTZ00429, PTZ00429, beta-adaptin; Provisional 1e-104
PTZ00429 746 PTZ00429, PTZ00429, beta-adaptin; Provisional 1e-100
COG5096 757 COG5096, COG5096, Vesicle coat complex, various su 1e-89
COG5096757 COG5096, COG5096, Vesicle coat complex, various su 1e-78
pfam12717171 pfam12717, Cnd1, non-SMC mitotic condensation comp 5e-41
pfam12717171 pfam12717, Cnd1, non-SMC mitotic condensation comp 2e-24
COG5096757 COG5096, COG5096, Vesicle coat complex, various su 3e-10
pfam1364688 pfam13646, HEAT_2, HEAT repeats 4e-09
pfam1364688 pfam13646, HEAT_2, HEAT repeats 7e-09
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 2e-06
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 2e-06
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 6e-05
COG1413335 COG1413, COG1413, FOG: HEAT repeat [Energy product 7e-05
pfam1364688 pfam13646, HEAT_2, HEAT repeats 9e-05
pfam1364688 pfam13646, HEAT_2, HEAT repeats 0.004
>gnl|CDD|216598 pfam01602, Adaptin_N, Adaptin N terminal region Back     alignment and domain information 
 Score =  375 bits (965), Expect = e-120
 Identities = 180/558 (32%), Positives = 271/558 (48%), Gaps = 119/558 (21%)

Query: 11  KKGEIFELKGELNS--DKKEKKREAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKL 68
           +K    EL   LNS  D   KK+EAVKK+I  + +G+D+S LF +VV  + +++  LK+L
Sbjct: 1   RKRIQQELARILNSFRDDPRKKKEAVKKLIYLIMLGEDISFLFFEVVKLVASNDFTLKRL 60

Query: 69  VYLYLMNYAKSHPDMAIMAFSTFFYQKSSSSFQCMIDIRSIPLFDLCSSVGVFVKDCEDS 128
            YLYL   A+  PD+AI+  ++                                KD +  
Sbjct: 61  GYLYLKLLAEESPDLAILVTNS------------------------------IKKDLQSP 90

Query: 129 NPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLYDINAQLVED 188
           NPLIR LA+RT+ CIRV ++   L   ++K L D DPYVRK AA+ + KLY  +  LV D
Sbjct: 91  NPLIRGLALRTLSCIRVPELARDLAPDIKKLLVDRDPYVRKKAALAILKLYRKDPDLVRD 150

Query: 189 QGFLDQLKDLLSDSNPMVVANAVAAI--LLLPRKSYWQRNLSSRKKQIC--------WNL 238
              + +LK+LLSD +P VV+ AVA +  +    + Y  + L    +++C        W  
Sbjct: 151 F-LVPELKELLSDKDPGVVSAAVALLYEIRKNDRLYLNKLLPLLVRRLCNLLTVCNPWLQ 209

Query: 239 PYLMNLSVIY----PAWPLSTINPHTPLLK-----VLMK----LMEMLPGEGDFVSTLTK 285
             ++ L   Y    P  P   +     LL+     VL +    ++ + P        L  
Sbjct: 210 VKILRLLTRYAPQDPREPKELLEDILNLLQNSNNAVLYEAVKTIIHLDP-----EPELIV 264

Query: 286 KLAPPLVTLLSSEPE-VQYVALRNINLIVQKRPDILKH-EMKVFFVKYNDPIYVKLEKLD 343
                L  LLSS  E ++YVALRN+N I++K P  ++H ++ +F +K +D I ++L  LD
Sbjct: 265 LAVNALGRLLSSPDENLRYVALRNLNKILEKHPPAVQHLDLIIFCLKTDDDISIRLRALD 324

Query: 344 IMIRLASQANIAQVLSELKEYATEV-DVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLI 402
           ++ +L  ++N+ +++ EL +Y +E+ D +F  K V+AIGR A K    AE C+  LL+L+
Sbjct: 325 LLYKLVDESNVKEIVKELLKYVSEIADPEFKIKLVKAIGRLAEKFPTDAEWCIDVLLELL 384

Query: 403 QTK----------------------------------------------------YAERI 410
                                                                  Y E I
Sbjct: 385 SLAGSYVVDEIVEVIRDIIRKYPELREYILEHLCELLEDIESPEARAAALWILGEYGELI 444

Query: 411 -DNADELLESFLEGFHDENTQVQLQLLTAIVKLFLKRPTDT--QELVQQVLSLATQDSDN 467
            ++  +LL S LE F  E+ +V+L LLTA+VKL L  P +     +VQ VLSLATQDS +
Sbjct: 445 PNSPSDLLRSILEVFVLESLKVRLALLTALVKLSLTFPDEEVQNLIVQVVLSLATQDSSD 504

Query: 468 PDLRDRGFIYWRLLSTGN 485
            +LRDR   Y RLLS  +
Sbjct: 505 LELRDRAVEYLRLLSLAD 522

This family consists of the N terminal region of various alpha, beta and gamma subunits of the AP-1, AP-2 and AP-3 adaptor protein complexes. The adaptor protein (AP) complexes are involved in the formation of clathrin-coated pits and vesicles. The N-terminal region of the various adaptor proteins (APs) is constant by comparison to the C-terminal which is variable within members of the AP-2 family; and it has been proposed that this constant region interacts with another uniform component of the coated vesicles. Length = 522
>gnl|CDD|216598 pfam01602, Adaptin_N, Adaptin N terminal region Back     alignment and domain information
>gnl|CDD|240415 PTZ00429, PTZ00429, beta-adaptin; Provisional Back     alignment and domain information
>gnl|CDD|240415 PTZ00429, PTZ00429, beta-adaptin; Provisional Back     alignment and domain information
>gnl|CDD|227427 COG5096, COG5096, Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|227427 COG5096, COG5096, Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|221731 pfam12717, Cnd1, non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>gnl|CDD|221731 pfam12717, Cnd1, non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>gnl|CDD|227427 COG5096, COG5096, Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|222285 pfam13646, HEAT_2, HEAT repeats Back     alignment and domain information
>gnl|CDD|222285 pfam13646, HEAT_2, HEAT repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|224331 COG1413, COG1413, FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|222285 pfam13646, HEAT_2, HEAT repeats Back     alignment and domain information
>gnl|CDD|222285 pfam13646, HEAT_2, HEAT repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 883
PTZ00429746 beta-adaptin; Provisional 100.0
KOG1061|consensus734 100.0
PTZ00429 746 beta-adaptin; Provisional 100.0
KOG1060|consensus968 100.0
KOG1062|consensus866 100.0
KOG1061|consensus 734 100.0
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 100.0
KOG1077|consensus938 100.0
KOG1062|consensus 866 100.0
KOG1060|consensus 968 100.0
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 100.0
KOG1059|consensus 877 100.0
COG5096757 Vesicle coat complex, various subunits [Intracellu 100.0
KOG1077|consensus 938 100.0
KOG1059|consensus877 100.0
KOG1058|consensus948 100.0
COG5096 757 Vesicle coat complex, various subunits [Intracellu 100.0
KOG1058|consensus 948 100.0
KOG1078|consensus865 99.95
COG5240898 SEC21 Vesicle coat complex COPI, gamma subunit [In 99.93
KOG1078|consensus 865 99.92
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 99.85
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.8
KOG2023|consensus 885 99.76
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.74
KOG1824|consensus1233 99.7
KOG2171|consensus 1075 99.62
KOG2171|consensus1075 99.59
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.56
KOG2023|consensus885 99.48
PRK09687280 putative lyase; Provisional 99.45
PRK09687280 putative lyase; Provisional 99.42
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.37
KOG1241|consensus859 99.34
KOG1824|consensus 1233 99.23
COG5215858 KAP95 Karyopherin (importin) beta [Intracellular t 98.98
KOG0213|consensus1172 98.96
KOG0414|consensus1251 98.91
KOG1241|consensus 859 98.9
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 98.88
KOG0213|consensus1172 98.87
KOG0211|consensus759 98.85
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 98.78
KOG0211|consensus 759 98.78
KOG1020|consensus 1692 98.68
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 98.67
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 98.67
KOG0166|consensus514 98.63
TIGR02270410 conserved hypothetical protein. Members are found 98.6
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 98.59
COG50981128 Chromosome condensation complex Condensin, subunit 98.53
KOG1242|consensus569 98.5
KOG0166|consensus514 98.5
KOG1242|consensus569 98.48
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 98.43
KOG2062|consensus929 98.42
KOG0212|consensus 675 98.41
KOG0212|consensus675 98.37
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 98.37
KOG1020|consensus1692 98.35
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 98.34
COG1413335 FOG: HEAT repeat [Energy production and conversion 98.25
KOG0915|consensus 1702 98.21
KOG1943|consensus1133 98.2
COG1413335 FOG: HEAT repeat [Energy production and conversion 98.19
KOG0915|consensus 1702 98.18
KOG4224|consensus550 98.16
TIGR02270410 conserved hypothetical protein. Members are found 98.14
KOG2259|consensus 823 98.11
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 98.09
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 98.03
KOG1248|consensus 1176 97.99
KOG0567|consensus289 97.99
KOG2025|consensus 892 97.92
KOG1991|consensus 1010 97.89
KOG0414|consensus 1251 97.89
KOG4224|consensus550 97.86
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 97.7
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 97.67
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 97.64
KOG2259|consensus 823 97.62
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 97.62
KOG1240|consensus 1431 97.6
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 97.59
KOG1240|consensus 1431 97.58
KOG2062|consensus929 97.52
COG5098 1128 Chromosome condensation complex Condensin, subunit 97.5
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 97.44
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 97.36
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 97.35
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 97.34
KOG1943|consensus 1133 97.34
KOG0946|consensus 970 97.33
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 97.33
smart00638574 LPD_N Lipoprotein N-terminal Domain. 97.28
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 97.27
KOG1992|consensus 960 97.2
KOG2025|consensus 892 97.17
KOG4535|consensus728 97.12
KOG0168|consensus 1051 96.99
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 96.95
KOG1248|consensus 1176 96.95
KOG0413|consensus 1529 96.92
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 96.89
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 96.86
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 96.8
PF05804708 KAP: Kinesin-associated protein (KAP) 96.76
PF05918556 API5: Apoptosis inhibitory protein 5 (API5); Inter 96.69
KOG1949|consensus 1005 96.69
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 96.68
KOG2274|consensus 1005 96.52
COG5116926 RPN2 26S proteasome regulatory complex component [ 96.48
KOG0567|consensus289 96.43
KOG0168|consensus 1051 96.4
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 96.34
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 96.19
KOG2274|consensus 1005 96.19
KOG4413|consensus524 96.03
KOG1293|consensus678 96.03
KOG4653|consensus982 95.84
KOG4413|consensus524 95.73
COG5218885 YCG1 Chromosome condensation complex Condensin, su 95.48
KOG1820|consensus 815 95.31
KOG1525|consensus 1266 95.31
KOG0946|consensus 970 95.19
KOG1949|consensus 1005 95.18
KOG0891|consensus 2341 95.15
PF13251182 DUF4042: Domain of unknown function (DUF4042) 95.12
PF05804708 KAP: Kinesin-associated protein (KAP) 95.08
PF14764 459 SPG48: AP-5 complex subunit, vesicle trafficking 95.06
KOG1525|consensus 1266 94.92
PF08167165 RIX1: rRNA processing/ribosome biogenesis 94.78
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 94.47
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 94.44
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 94.38
smart00638574 LPD_N Lipoprotein N-terminal Domain. 94.36
PF1036392 DUF2435: Protein of unknown function (DUF2435) 94.26
KOG1517|consensus 1387 94.11
KOG0413|consensus 1529 94.07
PF12231372 Rif1_N: Rap1-interacting factor 1 N terminal; Inte 94.03
KOG2005|consensus878 93.97
COG5116926 RPN2 26S proteasome regulatory complex component [ 93.51
PF1036392 DUF2435: Protein of unknown function (DUF2435) 93.3
KOG2956|consensus516 93.3
KOG2032|consensus533 93.3
PF05004309 IFRD: Interferon-related developmental regulator ( 93.12
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 93.12
KOG1992|consensus 960 93.11
KOG1517|consensus 1387 93.06
PLN03076 1780 ARF guanine nucleotide exchange factor (ARF-GEF); 92.88
KOG1822|consensus 2067 92.69
KOG4653|consensus982 92.59
KOG2160|consensus342 92.58
PF14500262 MMS19_N: Dos2-interacting transcription regulator 92.46
KOG2032|consensus533 92.44
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 92.06
KOG4500|consensus604 91.8
KOG4535|consensus728 91.75
KOG1293|consensus678 91.69
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 91.64
PF1276542 Cohesin_HEAT: HEAT repeat associated with sister c 91.62
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 91.44
KOG2005|consensus878 91.35
PF08713213 DNA_alkylation: DNA alkylation repair enzyme; Inte 91.27
KOG2956|consensus516 91.07
PF1276542 Cohesin_HEAT: HEAT repeat associated with sister c 90.79
KOG1820|consensus815 90.77
PF11935239 DUF3453: Domain of unknown function (DUF3453); Int 90.76
KOG1822|consensus 2067 90.71
KOG2759|consensus442 90.58
PF14500262 MMS19_N: Dos2-interacting transcription regulator 90.54
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 90.43
KOG2160|consensus342 89.92
PF13001501 Ecm29: Proteasome stabiliser; InterPro: IPR024372 89.72
PF08713213 DNA_alkylation: DNA alkylation repair enzyme; Inte 89.63
COG5110881 RPN1 26S proteasome regulatory complex component [ 89.42
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 89.35
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 89.25
PF05004309 IFRD: Interferon-related developmental regulator ( 88.77
KOG1243|consensus690 88.7
KOG2933|consensus334 88.59
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 88.34
KOG1967|consensus1030 88.28
PF11864464 DUF3384: Domain of unknown function (DUF3384); Int 88.2
PF13251182 DUF4042: Domain of unknown function (DUF4042) 88.08
PF12074339 DUF3554: Domain of unknown function (DUF3554); Int 87.91
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 87.86
KOG1967|consensus1030 87.11
PF05536 543 Neurochondrin: Neurochondrin 86.61
KOG4500|consensus604 84.5
COG5656 970 SXM1 Importin, protein involved in nuclear import 84.25
KOG1243|consensus690 84.19
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 83.67
PF08167165 RIX1: rRNA processing/ribosome biogenesis 83.35
PF12074339 DUF3554: Domain of unknown function (DUF3554); Int 83.11
KOG2213|consensus460 82.65
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 82.11
KOG0392|consensus 1549 81.83
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 81.58
KOG2759|consensus442 81.33
KOG4524|consensus1014 80.69
KOG2933|consensus334 80.15
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information 
Probab=100.00  E-value=5.1e-73  Score=661.85  Aligned_cols=452  Identities=40%  Similarity=0.681  Sum_probs=419.1

Q ss_pred             CCCccccccCcCcHHHHHHHhcCCChHHHHHHHHHHHHHHhCCCCcccchHHHHhhccCCChhHHHHHHHHHHHhhccCC
Q psy2915           2 TDSKYFTTTKKGEIFELKGELNSDKKEKKREAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSHP   81 (883)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~l~kli~~~~~G~~~~~~~~~v~~~~~~~~~~~k~~~y~~~~~~~~~~~   81 (883)
                      ++++||+++++||++|||+.|++++.++|+++++|+|+.|++|+|++++||+|+++++++|+++|||+|+|+++|++.+|
T Consensus        21 ~~~~~f~~~~kge~~ELr~~L~s~~~~~kk~alKkvIa~mt~G~DvS~LF~dVvk~~~S~d~elKKLvYLYL~~ya~~~p  100 (746)
T PTZ00429         21 TGSKYFAQTRRGEGAELQNDLNGTDSYRKKAAVKRIIANMTMGRDVSYLFVDVVKLAPSTDLELKKLVYLYVLSTARLQP  100 (746)
T ss_pred             CccccccccccchHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCchHHHHHHHHHhCCCCHHHHHHHHHHHHHHcccCh
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cchhhhcccccccccCccchhhhccccccccccccchhhhchhcCCCCHHHHHHHHHHhccCCchhhhHHHHHHHHhhcC
Q psy2915          82 DMAIMAFSTFFYQKSSSSFQCMIDIRSIPLFDLCSSVGVFVKDCEDSNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLK  161 (883)
Q Consensus        82 ~~~~~~~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~kDL~~~n~~vr~lALr~L~~i~~~~~~~~l~~~v~~~l~  161 (883)
                      |+++|++|+                              ++||++|+||.+|++|||+||+|+.+++++++.+.|++++.
T Consensus       101 elalLaINt------------------------------l~KDl~d~Np~IRaLALRtLs~Ir~~~i~e~l~~~lkk~L~  150 (746)
T PTZ00429        101 EKALLAVNT------------------------------FLQDTTNSSPVVRALAVRTMMCIRVSSVLEYTLEPLRRAVA  150 (746)
T ss_pred             HHHHHHHHH------------------------------HHHHcCCCCHHHHHHHHHHHHcCCcHHHHHHHHHHHHHHhc
Confidence            999999999                              99999999999999999999999999999999999999999


Q ss_pred             CCChhHHHHHHHHHHHHhhhCccccccccHHHHHHHHhcCCChhHHHHHHHHHHhccccCCccc--------cccccccC
Q psy2915         162 DEDPYVRKTAAVCVAKLYDINAQLVEDQGFLDQLKDLLSDSNPMVVANAVAAILLLPRKSYWQR--------NLSSRKKQ  233 (883)
Q Consensus       162 d~~~~VRk~A~~al~kl~~~~p~~~~~~~~~~~L~~lL~D~d~~V~~~a~~~L~ei~~~~~~~~--------~l~~~~~~  233 (883)
                      |++|||||+|++|+.|+|+.+|+.+.+.+|.+.|.++|+|+||+|+.+|+.+|.++.+..|...        .++..++.
T Consensus       151 D~~pYVRKtAalai~Kly~~~pelv~~~~~~~~L~~LL~D~dp~Vv~nAl~aL~eI~~~~~~~l~l~~~~~~~Ll~~L~e  230 (746)
T PTZ00429        151 DPDPYVRKTAAMGLGKLFHDDMQLFYQQDFKKDLVELLNDNNPVVASNAAAIVCEVNDYGSEKIESSNEWVNRLVYHLPE  230 (746)
T ss_pred             CCCHHHHHHHHHHHHHHHhhCcccccccchHHHHHHHhcCCCccHHHHHHHHHHHHHHhCchhhHHHHHHHHHHHHHhhc
Confidence            9999999999999999999999998878899999999999999999999999999987765432        23333332


Q ss_pred             -CCCcHHHHHh-hccccccC-------------CCCCCCchH--HHHHHHHHHhhcCCCChhhHHHHHHHHhHHHHHhhc
Q psy2915         234 -ICWNLPYLMN-LSVIYPAW-------------PLSTINPHT--PLLKVLMKLMEMLPGEGDFVSTLTKKLAPPLVTLLS  296 (883)
Q Consensus       234 -~~w~q~~~l~-l~~~~~~~-------------~l~~~n~~v--~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~L~~lL~  296 (883)
                       .+|+|+.+|+ +.+|.|.+             ++++.|++|  +++++++.+....+  ....+++..++..+++++++
T Consensus       231 ~~EW~Qi~IL~lL~~y~P~~~~e~~~il~~l~~~Lq~~N~AVVl~Aik~il~l~~~~~--~~~~~~~~~rl~~pLv~L~s  308 (746)
T PTZ00429        231 CNEWGQLYILELLAAQRPSDKESAETLLTRVLPRMSHQNPAVVMGAIKVVANLASRCS--QELIERCTVRVNTALLTLSR  308 (746)
T ss_pred             CChHHHHHHHHHHHhcCCCCcHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHhcCcCC--HHHHHHHHHHHHHHHHHhhC
Confidence             3799999999 99999876             678999999  99999998876543  24566777888899999988


Q ss_pred             CChhHHHHHHHHHHHHHhhCchhHHhcccceeeccCCCHHHHHHHHHHHHHhcChhhHHHHHHHHHHhhhhcCHHHHHHH
Q psy2915         297 SEPEVQYVALRNINLIVQKRPDILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLSELKEYATEVDVDFVRKA  376 (883)
Q Consensus       297 ~~~~vr~~aL~~l~~l~~~~~~~~~~~~~~~~~l~~~~~~Ir~~aL~iL~~l~~~~nv~~Il~eL~~~~~~~d~~~r~~a  376 (883)
                      +++|+||++|++|..+++.+|.+|.+|++.|+|+.+||.+||+.||++|+.+||++|++.|++||.+|+++.|.+|++++
T Consensus       309 s~~eiqyvaLr~I~~i~~~~P~lf~~~~~~Ff~~~~Dp~yIK~~KLeIL~~Lane~Nv~~IL~EL~eYa~d~D~ef~r~a  388 (746)
T PTZ00429        309 RDAETQYIVCKNIHALLVIFPNLLRTNLDSFYVRYSDPPFVKLEKLRLLLKLVTPSVAPEILKELAEYASGVDMVFVVEV  388 (746)
T ss_pred             CCccHHHHHHHHHHHHHHHCHHHHHHHHHhhhcccCCcHHHHHHHHHHHHHHcCcccHHHHHHHHHHHhhcCCHHHHHHH
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhchhhHHHHHHHHHHHHHhH---------------------------------------------------
Q psy2915         377 VRAIGRCAIKVEQSAERCVSTLLDLIQTK---------------------------------------------------  405 (883)
Q Consensus       377 i~aI~~la~k~~~~~~~~v~~Ll~lL~~~---------------------------------------------------  405 (883)
                      |++||.||.++|...+||++.|++++.+.                                                   
T Consensus       389 IrAIg~lA~k~~~~a~~cV~~Ll~ll~~~~~~v~e~i~vik~IlrkyP~~~il~~L~~~~~~~~i~e~~AKaaiiWILGE  468 (746)
T PTZ00429        389 VRAIASLAIKVDSVAPDCANLLLQIVDRRPELLPQVVTAAKDIVRKYPELLMLDTLVTDYGADEVVEEEAKVSLLWMLGE  468 (746)
T ss_pred             HHHHHHHHHhChHHHHHHHHHHHHHhcCCchhHHHHHHHHHHHHHHCccHHHHHHHHHhhcccccccHHHHHHHHHHHHh
Confidence            99999999999999999999999877642                                                   


Q ss_pred             hhhhhCCHHHHHHHHhhhhcCCCHHHHHHHHHHHHHHhhcCCchHHHHHHHHHHHhhcCCCChhhhhhhHHHHHhhcCCc
Q psy2915         406 YAERIDNADELLESFLEGFHDENTQVQLQLLTAIVKLFLKRPTDTQELVQQVLSLATQDSDNPDLRDRGFIYWRLLSTGN  485 (883)
Q Consensus       406 ~~~~i~~~~~il~~l~~~~~~~~~~vr~~~L~al~Kl~~~~~~~~~~~l~~ll~~~~~d~~~~evrdrA~~y~~ll~~~~  485 (883)
                      |++.+++++++++.+++.|.+|+.+||.++|++++|+|..+|++.++.+..+++++..+.+|+||||||.+||++++.++
T Consensus       469 y~~~I~~a~~~L~~~i~~f~~E~~~VqlqlLta~vKlfl~~p~~~~~~l~~vL~~~t~~~~d~DVRDRA~~Y~rLLs~~~  548 (746)
T PTZ00429        469 YCDFIENGKDIIQRFIDTIMEHEQRVQLAILSAAVKMFLRDPQGMEPQLNRVLETVTTHSDDPDVRDRAFAYWRLLSKGI  548 (746)
T ss_pred             hHhhHhhHHHHHHHHHhhhccCCHHHHHHHHHHHHHHHhcCcHHHHHHHHHHHHHHHhcCCChhHHHHHHHHHHHHcCCC
Confidence            55667778899999999999999999999999999999999988999999999998776679999999999999998874

>KOG1061|consensus Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG1060|consensus Back     alignment and domain information
>KOG1062|consensus Back     alignment and domain information
>KOG1061|consensus Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1077|consensus Back     alignment and domain information
>KOG1062|consensus Back     alignment and domain information
>KOG1060|consensus Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1059|consensus Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1077|consensus Back     alignment and domain information
>KOG1059|consensus Back     alignment and domain information
>KOG1058|consensus Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1058|consensus Back     alignment and domain information
>KOG1078|consensus Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1078|consensus Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG2023|consensus Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG1824|consensus Back     alignment and domain information
>KOG2171|consensus Back     alignment and domain information
>KOG2171|consensus Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG2023|consensus Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG1241|consensus Back     alignment and domain information
>KOG1824|consensus Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0213|consensus Back     alignment and domain information
>KOG0414|consensus Back     alignment and domain information
>KOG1241|consensus Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG0213|consensus Back     alignment and domain information
>KOG0211|consensus Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG0211|consensus Back     alignment and domain information
>KOG1020|consensus Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG0166|consensus Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1242|consensus Back     alignment and domain information
>KOG0166|consensus Back     alignment and domain information
>KOG1242|consensus Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2062|consensus Back     alignment and domain information
>KOG0212|consensus Back     alignment and domain information
>KOG0212|consensus Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG1020|consensus Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG0915|consensus Back     alignment and domain information
>KOG1943|consensus Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG0915|consensus Back     alignment and domain information
>KOG4224|consensus Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG2259|consensus Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1248|consensus Back     alignment and domain information
>KOG0567|consensus Back     alignment and domain information
>KOG2025|consensus Back     alignment and domain information
>KOG1991|consensus Back     alignment and domain information
>KOG0414|consensus Back     alignment and domain information
>KOG4224|consensus Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG2259|consensus Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG2062|consensus Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1943|consensus Back     alignment and domain information
>KOG0946|consensus Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1992|consensus Back     alignment and domain information
>KOG2025|consensus Back     alignment and domain information
>KOG4535|consensus Back     alignment and domain information
>KOG0168|consensus Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG1248|consensus Back     alignment and domain information
>KOG0413|consensus Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG1949|consensus Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG2274|consensus Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0567|consensus Back     alignment and domain information
>KOG0168|consensus Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>KOG2274|consensus Back     alignment and domain information
>KOG4413|consensus Back     alignment and domain information
>KOG1293|consensus Back     alignment and domain information
>KOG4653|consensus Back     alignment and domain information
>KOG4413|consensus Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1820|consensus Back     alignment and domain information
>KOG1525|consensus Back     alignment and domain information
>KOG0946|consensus Back     alignment and domain information
>KOG1949|consensus Back     alignment and domain information
>KOG0891|consensus Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PF14764 SPG48: AP-5 complex subunit, vesicle trafficking Back     alignment and domain information
>KOG1525|consensus Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG0413|consensus Back     alignment and domain information
>PF12231 Rif1_N: Rap1-interacting factor 1 N terminal; InterPro: IPR022031 This domain family is found in eukaryotes, and is typically between 135 and 146 amino acids in length Back     alignment and domain information
>KOG2005|consensus Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>KOG2956|consensus Back     alignment and domain information
>KOG2032|consensus Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG1992|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>PLN03076 ARF guanine nucleotide exchange factor (ARF-GEF); Provisional Back     alignment and domain information
>KOG1822|consensus Back     alignment and domain information
>KOG4653|consensus Back     alignment and domain information
>KOG2160|consensus Back     alignment and domain information
>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II Back     alignment and domain information
>KOG2032|consensus Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG4500|consensus Back     alignment and domain information
>KOG4535|consensus Back     alignment and domain information
>KOG1293|consensus Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>PF12765 Cohesin_HEAT: HEAT repeat associated with sister chromatid cohesion Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>KOG2005|consensus Back     alignment and domain information
>PF08713 DNA_alkylation: DNA alkylation repair enzyme; InterPro: IPR014825 These proteins are predicted to be DNA alkylation repair enzymes Back     alignment and domain information
>KOG2956|consensus Back     alignment and domain information
>PF12765 Cohesin_HEAT: HEAT repeat associated with sister chromatid cohesion Back     alignment and domain information
>KOG1820|consensus Back     alignment and domain information
>PF11935 DUF3453: Domain of unknown function (DUF3453); InterPro: IPR021850 This presumed domain is functionally uncharacterised Back     alignment and domain information
>KOG1822|consensus Back     alignment and domain information
>KOG2759|consensus Back     alignment and domain information
>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>KOG2160|consensus Back     alignment and domain information
>PF13001 Ecm29: Proteasome stabiliser; InterPro: IPR024372 The proteasome (or macropain) (3 Back     alignment and domain information
>PF08713 DNA_alkylation: DNA alkylation repair enzyme; InterPro: IPR014825 These proteins are predicted to be DNA alkylation repair enzymes Back     alignment and domain information
>COG5110 RPN1 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG1243|consensus Back     alignment and domain information
>KOG2933|consensus Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>KOG1967|consensus Back     alignment and domain information
>PF11864 DUF3384: Domain of unknown function (DUF3384); InterPro: IPR024584 This entry represents the N-terminal domain of tuberin which is functionally uncharacterised Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>PF12074 DUF3554: Domain of unknown function (DUF3554); InterPro: IPR022716 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>KOG1967|consensus Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG4500|consensus Back     alignment and domain information
>COG5656 SXM1 Importin, protein involved in nuclear import [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1243|consensus Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>PF12074 DUF3554: Domain of unknown function (DUF3554); InterPro: IPR022716 This presumed domain is functionally uncharacterised Back     alignment and domain information
>KOG2213|consensus Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>KOG2759|consensus Back     alignment and domain information
>KOG4524|consensus Back     alignment and domain information
>KOG2933|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query883
2vgl_B 591 Ap2 Clathrin Adaptor Core Length = 591 0.0
2xa7_B 592 Ap2 Clathrin Adaptor Core In Active Complex With Ca 0.0
1w63_B 584 Ap1 Clathrin Adaptor Core Length = 584 0.0
1w63_A 618 Ap1 Clathrin Adaptor Core Length = 618 1e-08
2vgl_A 621 Ap2 Clathrin Adaptor Core Length = 621 5e-05
2jkr_A 623 Ap2 Clathrin Adaptor Core With Dileucine Peptide Rm 6e-05
3ltm_A211 Structure Of A New Family Of Artificial Alpha Helic 9e-04
>pdb|2VGL|B Chain B, Ap2 Clathrin Adaptor Core Length = 591 Back     alignment and structure 
Iteration: 1

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/436 (76%), Positives = 368/436 (84%), Gaps = 50/436 (11%)
Query: 497 VIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSHPDMAIMAVNTFVKDCE 556
           VIA+MTVGKDVS+LFPDVVNCMQTDNLELKKLVYLYLMNYAKS PDMAIMAVN+FVKDCE
Sbjct: 37  VIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCE 96
Query: 557 DSNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLYDINAQLV 616
           D NPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKL+DINAQ+V
Sbjct: 97  DPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMV 156
Query: 617 EDQGFLDQLKDLLSDSNPMVVANAVAALSEMNEASTSGVALIEMNAQTINKLLTALNECT 676
           EDQGFLD L+DL++DSNPMVVANAVAALSE++E+  +   L+++N Q INKLLTALNECT
Sbjct: 157 EDQGFLDSLRDLIADSNPMVVANAVAALSEISESHPNS-NLLDLNPQNINKLLTALNECT 215
Query: 677 EWGQVFILDSLSNYSPKDDREAQSICERITPRLAHANAAVVLSAVKVLMKLMEMLPGEGD 736
           EWGQ+FILD LSNY+PKDDREAQSICER+TPRL+HAN+AVVLSAVKVLMK +E+LP + D
Sbjct: 216 EWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSD 275
Query: 737 FVSTLTKKLAPPLVTLLSSEPEVQYVALRNINLIVQKRPDILKHEMKVFFVKYNDPIYVK 796
           + + L KKLAPPLVTLLS EPEVQYVALRNINLIVQKRP+ILK E+KVFFVKYNDPIYVK
Sbjct: 276 YYNMLLKKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVK 335
Query: 797 LEKLDIMIRLASQANIAQ------------------------------------------ 814
           LEKLDIMIRLASQANIAQ                                          
Sbjct: 336 LEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTL 395
Query: 815 -------VNYVVQEAIVVIKDIFRKYPNKYETIISTLCENLDTLDEPEARASMIWIIGEY 867
                  VNYVVQEAIVVI+DIFRKYPNKYE+II+TLCENLD+LDEP+ARA+MIWI+GEY
Sbjct: 396 LDLIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARAAMIWIVGEY 455
Query: 868 AERIDNADELLESFLE 883
           AERIDNADELLESFLE
Sbjct: 456 AERIDNADELLESFLE 471
>pdb|2XA7|B Chain B, Ap2 Clathrin Adaptor Core In Active Complex With Cargo Peptides Length = 592 Back     alignment and structure
>pdb|1W63|B Chain B, Ap1 Clathrin Adaptor Core Length = 584 Back     alignment and structure
>pdb|1W63|A Chain A, Ap1 Clathrin Adaptor Core Length = 618 Back     alignment and structure
>pdb|2VGL|A Chain A, Ap2 Clathrin Adaptor Core Length = 621 Back     alignment and structure
>pdb|2JKR|A Chain A, Ap2 Clathrin Adaptor Core With Dileucine Peptide Rm( Phosphos)qikrllse Length = 623 Back     alignment and structure
>pdb|3LTM|A Chain A, Structure Of A New Family Of Artificial Alpha Helicoidal Repeat Proteins (Alpha-Rep) Based On Thermostable Heat-Like Repeats Length = 211 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query883
2vgl_B591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 1e-167
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 1e-154
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 1e-104
1w63_A618 Adapter-related protein complex 1 gamma 1 subunit; 2e-99
2vgl_A621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 2e-98
2vgl_A621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 5e-93
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 3e-62
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 6e-47
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
3u0r_A507 Apoptosis inhibitor 5; heat repeat, armadillo repe 5e-16
3u0r_A507 Apoptosis inhibitor 5; heat repeat, armadillo repe 2e-09
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 4e-15
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 4e-14
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 3e-13
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 6e-13
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 2e-12
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 5e-15
4fdd_A852 Transportin-1; heat repeats, karyopherin, nuclear 4e-09
4fdd_A852 Transportin-1; heat repeats, karyopherin, nuclear 5e-04
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 4e-14
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 1e-11
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 1e-09
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 5e-09
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 6e-09
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 6e-08
2db0_A253 253AA long hypothetical protein; heat repeats, hel 7e-14
2db0_A253 253AA long hypothetical protein; heat repeats, hel 3e-11
2db0_A253 253AA long hypothetical protein; heat repeats, hel 6e-07
2db0_A253 253AA long hypothetical protein; heat repeats, hel 8e-05
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 8e-14
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 2e-09
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 5e-09
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 5e-09
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 1e-08
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 6e-08
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-13
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 5e-06
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-05
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-04
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 2e-12
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 1e-10
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 4e-10
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 2e-09
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 9e-07
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 4e-04
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 6e-04
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 5e-12
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 1e-06
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 2e-05
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 1e-04
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 9e-12
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-05
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-05
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 1e-11
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 2e-08
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 8e-08
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 9e-08
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 2e-07
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 2e-06
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 2e-06
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 1e-05
1qgr_A 876 Protein (importin beta subunit); transport recepto 2e-09
1qgr_A876 Protein (importin beta subunit); transport recepto 1e-04
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 3e-08
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 5e-06
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 6e-04
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 2e-07
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 2e-05
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 6e-07
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 3e-05
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 6e-07
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 2e-05
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 4e-04
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 7e-07
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 2e-04
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 9e-07
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 3e-05
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 3e-04
1u6g_C1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 9e-06
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 1e-05
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 3e-05
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 1e-05
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 5e-05
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 8e-05
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 3e-04
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 6e-04
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Length = 591 Back     alignment and structure
 Score =  498 bits (1284), Expect = e-167
 Identities = 368/563 (65%), Positives = 402/563 (71%), Gaps = 109/563 (19%)

Query: 1   MTDSKYFTTTKKGEIFELKGELNSDKKEKKREAVKKVIASMTVGKDVSALFPDVVNCMQT 60
           MTDSKYFTT KKGEIFELK ELN++KKEK++EAVKKVIA+MTVGKDVS+LFPDVVNCMQT
Sbjct: 1   MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT 60

Query: 61  DNLELKKLVYLYLMNYAKSHPDMAIMAFSTFFYQKSSSSFQCMIDIRSIPLFDLCSSVGV 120
           DNLELKKLVYLYLMNYAKS PDMAIMA ++                              
Sbjct: 61  DNLELKKLVYLYLMNYAKSQPDMAIMAVNS------------------------------ 90

Query: 121 FVKDCEDSNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLYD 180
           FVKDCED NPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKL+D
Sbjct: 91  FVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHD 150

Query: 181 INAQLVEDQGFLDQLKDLLSDSNPMVVANAVAAILLLPRKS---YWQRNLSSRKKQIC-- 235
           INAQ+VEDQGFLD L+DL++DSNPMVVANAVAA+  +                  ++   
Sbjct: 151 INAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTA 210

Query: 236 ------WNLPYLMNLSVIY----PAWPLSTINPHTPLL------------KVLMKLMEML 273
                 W   ++++    Y         S     TP L            KVLMK +E+L
Sbjct: 211 LNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELL 270

Query: 274 PGEGDFVSTLTKKLAPPLVTLLSSEPEVQYVALRNINLIVQKRPDILKHEMKVFFVKYND 333
           P + D+ + L KKLAPPLVTLLS EPEVQYVALRNINLIVQKRP+ILK E+KVFFVKYND
Sbjct: 271 PKDSDYYNMLLKKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYND 330

Query: 334 PIYVKLEKLDIMIRLASQANIAQVLSELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAER 393
           PIYVKLEKLDIMIRLASQANIAQVL+ELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAER
Sbjct: 331 PIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAER 390

Query: 394 CVSTLLDLIQTK------------------------------------------------ 405
           CVSTLLDLIQTK                                                
Sbjct: 391 CVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARAAMIW 450

Query: 406 ----YAERIDNADELLESFLEGFHDENTQVQLQLLTAIVKLFLKRPTDTQELVQQVLSLA 461
               YAERIDNADELLESFLEGFHDE+TQVQL LLTAIVKLFLK+P++TQELVQQVLSLA
Sbjct: 451 IVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLA 510

Query: 462 TQDSDNPDLRDRGFIYWRLLSTG 484
           TQDSDNPDLRDRG+IYWRLLST 
Sbjct: 511 TQDSDNPDLRDRGYIYWRLLSTD 533
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Length = 591 Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Length = 618 Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Length = 618 Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Length = 621 Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Length = 621 Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Length = 355 Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Length = 355 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Length = 507 Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Length = 507 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Length = 876 Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Length = 876 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Length = 242 Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Length = 242 Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Length = 861 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Length = 960 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query883
2vgl_B591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 100.0
2vgl_A621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 100.0
1w63_A618 Adapter-related protein complex 1 gamma 1 subunit; 100.0
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 100.0
2vgl_A621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 100.0
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 100.0
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 100.0
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 100.0
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 99.93
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 99.91
4fdd_A852 Transportin-1; heat repeats, karyopherin, nuclear 99.88
4fdd_A852 Transportin-1; heat repeats, karyopherin, nuclear 99.88
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 99.86
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.84
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.83
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 99.82
1qgr_A876 Protein (importin beta subunit); transport recepto 99.79
1qgr_A876 Protein (importin beta subunit); transport recepto 99.75
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.65
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.6
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 99.6
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.58
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.55
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.54
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 99.53
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.51
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 99.49
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.48
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.48
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.48
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 99.47
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 99.43
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.38
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.38
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 99.38
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.37
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 99.35
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 99.3
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 99.29
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.27
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 99.27
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.26
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.26
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.24
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 99.1
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 99.05
2x19_B 963 Importin-13; nuclear transport, protein transport; 99.05
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.02
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 98.94
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 98.92
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 98.89
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 98.79
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 98.75
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 98.75
2db0_A253 253AA long hypothetical protein; heat repeats, hel 98.73
2x1g_F 971 Cadmus; transport protein, developmental protein, 98.72
3nmz_A458 APC variant protein; protein-protein complex, arma 98.69
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 98.67
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 98.66
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 98.65
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.64
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 98.63
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 98.63
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 98.63
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.62
2x1g_F 971 Cadmus; transport protein, developmental protein, 98.61
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 98.6
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 98.58
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.57
2db0_A253 253AA long hypothetical protein; heat repeats, hel 98.52
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.52
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 98.48
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 98.46
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 98.4
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.36
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 98.27
3nmz_A458 APC variant protein; protein-protein complex, arma 98.2
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 98.17
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 98.15
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 98.13
2x19_B963 Importin-13; nuclear transport, protein transport; 98.05
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 98.0
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 97.92
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 97.76
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 97.75
3grl_A651 General vesicular transport factor P115; vesicle t 97.69
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 97.59
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 97.51
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 97.5
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 97.5
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 97.38
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 97.35
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 97.33
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 97.3
3u0r_A507 Apoptosis inhibitor 5; heat repeat, armadillo repe 97.27
3grl_A 651 General vesicular transport factor P115; vesicle t 97.19
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 97.18
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.16
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.11
3gs3_A257 Symplekin, LD45768P; helix-turn-helix heat repeat 96.92
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 96.7
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 96.68
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 96.64
3gs3_A257 Symplekin, LD45768P; helix-turn-helix heat repeat 96.61
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 96.59
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 96.48
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 96.32
3o2t_A386 Symplekin; heat repeat, scaffold, protein binding; 96.25
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 96.09
3o2t_A386 Symplekin; heat repeat, scaffold, protein binding; 96.08
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 95.64
4hat_C1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 95.29
1vsy_5997 Proteasome activator BLM10; 20S proteasome BLM10, 95.03
1vsy_5997 Proteasome activator BLM10; 20S proteasome BLM10, 93.63
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 93.01
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 92.48
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 90.99
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 90.82
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 87.24
2b6c_A220 Hypothetical protein EF3068; structural genomis, D 81.1
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
Probab=100.00  E-value=1.3e-61  Score=575.93  Aligned_cols=455  Identities=81%  Similarity=1.175  Sum_probs=412.2

Q ss_pred             CCCCccccccCcCcHHHHHHHhcCCChHHHHHHHHHHHHHHhCCCCcccchHHHHhhccCCChhHHHHHHHHHHHhhccC
Q psy2915           1 MTDSKYFTTTKKGEIFELKGELNSDKKEKKREAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSH   80 (883)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~l~kli~~~~~G~~~~~~~~~v~~~~~~~~~~~k~~~y~~~~~~~~~~   80 (883)
                      |||++||++++++|++|||+.|++++.++|+++++|++|++++|+|++++||+++++++++|+++||+||+|++.+++.+
T Consensus         1 ~~~~~~f~~~~~~e~~~i~~~L~~~~~~~k~~~~~kli~~~~~G~d~~~~~~~vi~l~~s~~~~~Krl~yl~l~~~~~~~   80 (591)
T 2vgl_B            1 MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQ   80 (591)
T ss_dssp             ---CCTTCCCSSSHHHHHHHHTTSSCHHHHHHHHHHHHHHHHTTCCCGGGHHHHHHTTSSSCHHHHHHHHHHHHHHHHHS
T ss_pred             CCcchhcccccCChHHHHHHHHcCCCHHHHHHHHHHHHHHHHCCCChHHHHHHHHHHhCCCCHHHHHHHHHHHHHHcccC
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcchhhhcccccccccCccchhhhccccccccccccchhhhchhcCCCCHHHHHHHHHHhccCCchhhhHHHHHHHHhhc
Q psy2915          81 PDMAIMAFSTFFYQKSSSSFQCMIDIRSIPLFDLCSSVGVFVKDCEDSNPLIRALAVRTMGCIRVDKITEYLCEPLRKCL  160 (883)
Q Consensus        81 ~~~~~~~~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~kDL~~~n~~vr~lALr~L~~i~~~~~~~~l~~~v~~~l  160 (883)
                      ||++++++|+                              +++||+|+||.+|++|+++||+++.+++.+.+.+.+.+++
T Consensus        81 ~e~~~l~~n~------------------------------l~kdL~~~n~~ir~~AL~~L~~i~~~~~~~~l~~~l~~~L  130 (591)
T 2vgl_B           81 PDMAIMAVNS------------------------------FVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCL  130 (591)
T ss_dssp             HHHHHTTHHH------------------------------HGGGSSSSSHHHHHHHHHHHHTCCSGGGHHHHHHHHHHHS
T ss_pred             chHHHHHHHH------------------------------HHHHcCCCCHHHHHHHHHHHHcCChHHHHHHHHHHHHHHc
Confidence            9999999999                              9999999999999999999999999999999999999999


Q ss_pred             CCCChhHHHHHHHHHHHHhhhCccccccccHHHHHHHHhcCCChhHHHHHHHHHHhccccCCcc--c--------ccccc
Q psy2915         161 KDEDPYVRKTAAVCVAKLYDINAQLVEDQGFLDQLKDLLSDSNPMVVANAVAAILLLPRKSYWQ--R--------NLSSR  230 (883)
Q Consensus       161 ~d~~~~VRk~A~~al~kl~~~~p~~~~~~~~~~~L~~lL~D~d~~V~~~a~~~L~ei~~~~~~~--~--------~l~~~  230 (883)
                      .|++|+|||+|+.|++++++.+|+.+++++|++.+.++|+|+|++|+.+|+.+|.++++..|..  .        .++..
T Consensus       131 ~d~~~~VRk~A~~al~~i~~~~p~~~~~~~~~~~l~~lL~d~d~~V~~~A~~aL~~i~~~~~~~~~~~l~~~~~~~Ll~~  210 (591)
T 2vgl_B          131 KDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTA  210 (591)
T ss_dssp             SCSCHHHHHHHHHHHHHHHHSSCCCHHHHHHHHHHHHTTSCSCHHHHHHHHHHHHHHTTSCCSCCSCCCHHHHHHHHHHH
T ss_pred             CCCChHHHHHHHHHHHHHHhhChhhcccccHHHHHHHHhCCCChhHHHHHHHHHHHHHhhCCCccchhccHHHHHHHHHc
Confidence            9999999999999999999999999977789999999999999999999999999999887744  1        12221


Q ss_pred             c-cCCCCcHHHHHh-hccccccC-------------CCCCCCchH--HHHHHHHHHhhcCCCChhhHHHHHHHHhHHHHH
Q psy2915         231 K-KQICWNLPYLMN-LSVIYPAW-------------PLSTINPHT--PLLKVLMKLMEMLPGEGDFVSTLTKKLAPPLVT  293 (883)
Q Consensus       231 ~-~~~~w~q~~~l~-l~~~~~~~-------------~l~~~n~~v--~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~L~~  293 (883)
                      + ...+|+|+.+++ +..|.|.+             .+++.|++|  +|+++++.+...++++.+..+.....+.++|+.
T Consensus       211 l~~~~~~~q~~il~~l~~l~~~~~~~~~~~l~~l~~~l~~~~~~V~~ea~~~i~~l~~~~~~~~~~~~~~~~~~~~~L~~  290 (591)
T 2vgl_B          211 LNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVT  290 (591)
T ss_dssp             HHHCCHHHHHHHHHHHHTSCCCSHHHHHHHHHHHTTCSCSSTTHHHHHHHHHHHHSCCSCCBTTBSHHHHHHHTHHHHHH
T ss_pred             CCCCCchHHHHHHHHHHHhCCCChHHHHHHHHHHHHHHcCCChHHHHHHHHHHHHHhhccCCCHHHHHHHHHHHHHHHHH
Confidence            1 234799999999 88888764             578899999  999999987765532334445566778888888


Q ss_pred             hhcCChhHHHHHHHHHHHHHhhCchhHHhcccceeeccCCCHHHHHHHHHHHHHhcChhhHHHHHHHHHHhhhhcCHHHH
Q psy2915         294 LLSSEPEVQYVALRNINLIVQKRPDILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLSELKEYATEVDVDFV  373 (883)
Q Consensus       294 lL~~~~~vr~~aL~~l~~l~~~~~~~~~~~~~~~~~l~~~~~~Ir~~aL~iL~~l~~~~nv~~Il~eL~~~~~~~d~~~r  373 (883)
                      ++++++|+||+||.++..++..+|+.+.+|+..|+|+.+||.+||++|+++|+.+++++|++.|+++|.+|+++.|.++|
T Consensus       291 L~~~d~~vr~~aL~~l~~i~~~~p~~~~~~~~~~~~~~~d~~~Ir~~al~~L~~l~~~~nv~~iv~~L~~~l~~~d~~~r  370 (591)
T 2vgl_B          291 LLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFV  370 (591)
T ss_dssp             HTTSCHHHHHHHHHHHHHHHHHCCSTTTTCTTTTSCCTTSCHHHHHHHHHHHHHTCCSSTHHHHHHHHHHHTTSSCHHHH
T ss_pred             HhcCCccHHHHHHHHHHHHHHhChHHHHHHHHhheeccCChHHHHHHHHHHHHHHCChhhHHHHHHHHHHHHhcCCHHHH
Confidence            87888999999999999999999999999998899998888999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhhchhhHHHHHHHHHHHHHhH------------------------------------------------
Q psy2915         374 RKAVRAIGRCAIKVEQSAERCVSTLLDLIQTK------------------------------------------------  405 (883)
Q Consensus       374 ~~ai~aI~~la~k~~~~~~~~v~~Ll~lL~~~------------------------------------------------  405 (883)
                      ++++.+||.++.+||+...|+++.|++++++.                                                
T Consensus       371 ~~~v~aI~~la~~~~~~~~~~v~~Ll~ll~~~~~~v~~e~i~~l~~ii~~~p~~~~~~v~~L~~~l~~~~~~~~~~~~~w  450 (591)
T 2vgl_B          371 RKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARAAMIW  450 (591)
T ss_dssp             HHHHHHHHHHHTTCHHHHHHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHSCSSCCTTHHHHHHTTTTCCSHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhChhHHHHHHHHHHHHHcccchHHHHHHHHHHHHHHHHCcchHHHHHHHHHHHHHhccCHHHHHHHHH
Confidence            99999999999999999999999999988764                                                


Q ss_pred             ----hhhhhCCHHHHHHHHhhhhcCCCHHHHHHHHHHHHHHhhcCCchHHHHHHHHHHHhhcCCCChhhhhhhHHHHHhh
Q psy2915         406 ----YAERIDNADELLESFLEGFHDENTQVQLQLLTAIVKLFLKRPTDTQELVQQVLSLATQDSDNPDLRDRGFIYWRLL  481 (883)
Q Consensus       406 ----~~~~i~~~~~il~~l~~~~~~~~~~vr~~~L~al~Kl~~~~~~~~~~~l~~ll~~~~~d~~~~evrdrA~~y~~ll  481 (883)
                          |++.+++.+++++.+.+.+.+++..||.++++|++|++.+.|+..++.+..+++.+..|+.|+||||||++|++++
T Consensus       451 ilGey~~~~~~~~~~l~~l~~~~~~~~~~vr~~~l~a~~Kl~~~~p~~~~~~i~~ll~~~~~d~~d~evrdRA~~y~~ll  530 (591)
T 2vgl_B          451 IVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLL  530 (591)
T ss_dssp             HHHTTCTTCTTHHHHHHHHSTTCSSSCHHHHHHHHHHHHHHHTTCCSTTHHHHHHHHHHHHTTCCCHHHHHHHHHHHTTT
T ss_pred             HHHcccccccCHHHHHHHHHHhhccCCHHHHHHHHHHHHHHHhcCchHHHHHHHHHHHHhhhcCCChHHHHHHHHHHHHH
Confidence                4445556788999999999999999999999999999999998777899999999877666899999999999999


Q ss_pred             cCCc
Q psy2915         482 STGN  485 (883)
Q Consensus       482 ~~~~  485 (883)
                      +.++
T Consensus       531 ~~~~  534 (591)
T 2vgl_B          531 STDP  534 (591)
T ss_dssp             TTCT
T ss_pred             CcCH
Confidence            8764
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>1vsy_5 Proteasome activator BLM10; 20S proteasome BLM10, hydrolase, nucleus, phosphoprotein, PR proteasome, threonine protease; 3.00A {Saccharomyces cerevisiae} PDB: 3l5q_6 Back     alignment and structure
>1vsy_5 Proteasome activator BLM10; 20S proteasome BLM10, hydrolase, nucleus, phosphoprotein, PR proteasome, threonine protease; 3.00A {Saccharomyces cerevisiae} PDB: 3l5q_6 Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>2b6c_A Hypothetical protein EF3068; structural genomis, DNA repair enzyme, structural genomics, protein structure initiative; HET: SO4; 2.10A {Enterococcus faecalis} SCOP: a.118.1.17 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 883
d2vglb_579 a.118.1.10 (B:) Adaptin beta subunit N-terminal fr 1e-110
d2vglb_ 579 a.118.1.10 (B:) Adaptin beta subunit N-terminal fr 1e-108
d2vgla_584 a.118.1.10 (A:) Adaptin alpha C subunit N-terminal 4e-79
d2vgla_584 a.118.1.10 (A:) Adaptin alpha C subunit N-terminal 5e-78
d1qbkb_ 888 a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapi 6e-14
d1qgra_ 876 a.118.1.1 (A:) Importin beta {Human (Homo sapiens) 5e-12
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 2e-11
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 4e-06
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 5e-06
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 1e-09
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 9e-06
d1u6gc_1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 2e-09
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 6e-08
d1u6gc_1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 3e-06
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 1e-05
d2bpta1861 a.118.1.1 (A:1-861) Importin beta {Baker's yeast ( 8e-09
d1te4a_111 a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium 1e-06
d1te4a_111 a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium 5e-06
d1oyza_276 a.118.1.16 (A:) Hypothetical protein YibA {Escheri 2e-06
d1oyza_276 a.118.1.16 (A:) Hypothetical protein YibA {Escheri 4e-06
d1oyza_276 a.118.1.16 (A:) Hypothetical protein YibA {Escheri 8e-06
d1ibrb_458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 3e-06
d1ibrb_458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 0.001
d1wa5c_ 959 a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Sacc 5e-06
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 0.001
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 876 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 861 Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 111 Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 111 Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Length = 276 Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Length = 276 Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Length = 276 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 959 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query883
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 100.0
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 100.0
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 100.0
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 100.0
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.91
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.87
d1u6gc_1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 99.73
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 99.7
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 99.59
d2bpta1861 Importin beta {Baker's yeast (Saccharomyces cerevi 99.57
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 99.54
d2bpta1861 Importin beta {Baker's yeast (Saccharomyces cerevi 99.51
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1qgra_876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.35
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.28
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.23
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.21
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 99.17
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.14
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 99.12
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.09
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.08
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.06
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 98.93
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.82
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.77
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 98.68
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.53
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 98.1
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 98.07
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 97.95
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 97.92
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 97.69
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 97.06
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 96.86
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 96.47
d2b6ca1213 Hypothetical protein EF3068 {Enterococcus faecalis 86.85
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 81.24
d2b6ca1213 Hypothetical protein EF3068 {Enterococcus faecalis 80.28
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d2b6ca1 a.118.1.17 (A:3-215) Hypothetical protein EF3068 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b6ca1 a.118.1.17 (A:3-215) Hypothetical protein EF3068 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure