Psyllid ID: psy2980

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90--
MLRGWHASTENTNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSIECYDVDNDSWEIMSHLPSARSWLGCVPLQ
cEEEcccccccccEEEEEEccccEEEEEccccccccccEEEEEccEEEEEcccccccccccEEEEEEcccccEEEEcccccccccEEEEEEc
cEEccccccccccEEEEEccccccEEEEccccccccccEEEEEccEEEEEEccccccccccEEEEEccccccEEEEcccccccccEEEEEEc
mlrgwhastentnrveCYHIAEntweykspmkekryrpgiavidgkiyvlggeegwdgyhdsiecydvdndsweIMSHlpsarswlgcvplq
mlrgwhastentnrvecyhiaentweykspmkekRYRPGIAVIDGKIYVLGGEEGWDGYHDSIECYDVDNDSWEIMSHlpsarswlgcvplq
MLRGWHASTENTNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSIECYDVDNDSWEIMSHLPSARSWLGCVPLQ
************NRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSIECYDVDNDSWEIMSHLPSARSWLGCV***
MLRGWH*STENTNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSIECYDVDNDSWEIMSHLPSARSWLGCVPLQ
********TENTNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSIECYDVDNDSWEIMSHLPSARSWLGCVPLQ
MLRGWHASTENTNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSIECYDVDNDSWEIMSHLPSARSWLGCVPLQ
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRGWHASTENTNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSIECYDVDNDSWEIMSHLPSARSWLGCVPLQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query92 2.2.26 [Sep-21-2011]
Q5R774624 Kelch-like ECH-associated yes N/A 0.902 0.133 0.416 5e-13
Q14145624 Kelch-like ECH-associated yes N/A 0.902 0.133 0.416 5e-13
Q684M4624 Kelch-like ECH-associated yes N/A 0.902 0.133 0.416 6e-13
P57790624 Kelch-like ECH-associated yes N/A 0.902 0.133 0.428 1e-12
Q9Z2X8624 Kelch-like ECH-associated yes N/A 0.902 0.133 0.416 1e-12
Q6GQU2558 Kelch-like protein 23 OS= no N/A 0.858 0.141 0.437 6e-10
Q8NBE8558 Kelch-like protein 23 OS= no N/A 0.858 0.141 0.437 1e-09
Q5RCQ9558 Kelch-like protein 23 OS= no N/A 0.858 0.141 0.437 1e-09
Q9NR64 748 Kelch-like protein 1 OS=H no N/A 0.847 0.104 0.354 2e-09
Q9JI74 751 Kelch-like protein 1 OS=M no N/A 0.847 0.103 0.354 2e-09
>sp|Q5R774|KEAP1_PONAB Kelch-like ECH-associated protein 1 OS=Pongo abelii GN=KEAP1 PE=2 SV=1 Back     alignment and function desciption
 Score = 72.8 bits (177), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 35/84 (41%), Positives = 50/84 (59%), Gaps = 1/84 (1%)

Query: 4   GWHASTENTNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSI 63
           G +   +  N VE Y +   TW + +PMK +R   GI V  G+IYVLGG +G   + DS+
Sbjct: 523 GGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDG-HTFLDSV 581

Query: 64  ECYDVDNDSWEIMSHLPSARSWLG 87
           ECYD D D+W  ++ + S RS +G
Sbjct: 582 ECYDPDTDTWSEVTRMTSGRSGVG 605
Retains NFE2L2/NRF2 in the cytosol. Functions as substrate adapter protein for the E3 ubiquitin ligase complex formed by CUL3 and RBX1. Targets NFE2L2/NRF2 for ubiquitination and degradation by the proteasome, thus resulting in the suppression of its transcriptional activity and the repression of antioxidant response element-mediated detoxifying enzyme gene expression. May also retain BPTF in the cytosol. Targets PGAM5 for ubiquitination and degradation by the proteasome.
Pongo abelii (taxid: 9601)
>sp|Q14145|KEAP1_HUMAN Kelch-like ECH-associated protein 1 OS=Homo sapiens GN=KEAP1 PE=1 SV=2 Back     alignment and function description
>sp|Q684M4|KEAP1_PIG Kelch-like ECH-associated protein 1 OS=Sus scrofa GN=KEAP1 PE=3 SV=1 Back     alignment and function description
>sp|P57790|KEAP1_RAT Kelch-like ECH-associated protein 1 OS=Rattus norvegicus GN=Keap1 PE=2 SV=1 Back     alignment and function description
>sp|Q9Z2X8|KEAP1_MOUSE Kelch-like ECH-associated protein 1 OS=Mus musculus GN=Keap1 PE=1 SV=1 Back     alignment and function description
>sp|Q6GQU2|KLH23_MOUSE Kelch-like protein 23 OS=Mus musculus GN=Klhl23 PE=2 SV=1 Back     alignment and function description
>sp|Q8NBE8|KLH23_HUMAN Kelch-like protein 23 OS=Homo sapiens GN=KLHL23 PE=2 SV=1 Back     alignment and function description
>sp|Q5RCQ9|KLH23_PONAB Kelch-like protein 23 OS=Pongo abelii GN=KLHL23 PE=2 SV=1 Back     alignment and function description
>sp|Q9NR64|KLHL1_HUMAN Kelch-like protein 1 OS=Homo sapiens GN=KLHL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9JI74|KLHL1_MOUSE Kelch-like protein 1 OS=Mus musculus GN=Klhl1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query92
291221953 604 PREDICTED: kelch-like protein 17-like [S 0.956 0.145 0.673 6e-32
326666291 627 PREDICTED: kelch-like protein 20-like [D 0.978 0.143 0.659 2e-30
410902394 571 PREDICTED: kelch-like protein 20-like [T 0.956 0.154 0.674 1e-29
405974080 569 Kelch-like protein 20 [Crassostrea gigas 0.945 0.152 0.615 2e-29
432869386 635 PREDICTED: kelch-like protein 20-like [O 0.978 0.141 0.641 2e-29
348537842127 PREDICTED: kelch-like ECH-associated pro 1.0 0.724 0.630 8e-29
443689046112 hypothetical protein CAPTEDRAFT_199582, 0.956 0.785 0.636 7e-28
47218014 629 unnamed protein product [Tetraodon nigro 0.869 0.127 0.670 4e-26
241605980 627 conserved hypothetical protein [Ixodes s 0.978 0.143 0.510 3e-21
432099560 593 Kelch-like ECH-associated protein 1 [Myo 0.902 0.139 0.428 1e-12
>gi|291221953|ref|XP_002730985.1| PREDICTED: kelch-like protein 17-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
 Score =  140 bits (354), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 75/92 (81%)

Query: 1   MLRGWHASTENTNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYH 60
           ++ GWHASTENTN+VE Y   +N WE K+PM E+RYRPG+AVIDGKIYVLGGEEGWD +H
Sbjct: 496 IIGGWHASTENTNKVERYDPKKNEWEIKAPMHERRYRPGVAVIDGKIYVLGGEEGWDRHH 555

Query: 61  DSIECYDVDNDSWEIMSHLPSARSWLGCVPLQ 92
           D+IECYD   D WEI+  +PS+RSWL CV +Q
Sbjct: 556 DTIECYDESKDCWEIVGEMPSSRSWLSCVAMQ 587

Source: Saccoglossus kowalevskii

Species: Saccoglossus kowalevskii

Genus: Saccoglossus

Family: Harrimaniidae

Order:

Class: Enteropneusta

Phylum: Hemichordata

Superkingdom: Eukaryota
>gi|326666291|ref|XP_003198234.1| PREDICTED: kelch-like protein 20-like [Danio rerio] Back     alignment and taxonomy information
>gi|410902394|ref|XP_003964679.1| PREDICTED: kelch-like protein 20-like [Takifugu rubripes] Back     alignment and taxonomy information
>gi|405974080|gb|EKC38750.1| Kelch-like protein 20 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|432869386|ref|XP_004071721.1| PREDICTED: kelch-like protein 20-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|348537842|ref|XP_003456402.1| PREDICTED: kelch-like ECH-associated protein 1-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|443689046|gb|ELT91550.1| hypothetical protein CAPTEDRAFT_199582, partial [Capitella teleta] Back     alignment and taxonomy information
>gi|47218014|emb|CAG11419.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information
>gi|241605980|ref|XP_002405604.1| conserved hypothetical protein [Ixodes scapularis] gi|215500654|gb|EEC10148.1| conserved hypothetical protein [Ixodes scapularis] Back     alignment and taxonomy information
>gi|432099560|gb|ELK28701.1| Kelch-like ECH-associated protein 1 [Myotis davidii] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query92
UNIPROTKB|F1PDU2624 KEAP1 "Uncharacterized protein 0.902 0.133 0.428 7.6e-14
UNIPROTKB|Q684M4624 KEAP1 "Kelch-like ECH-associat 0.902 0.133 0.416 5.5e-13
UNIPROTKB|Q14145624 KEAP1 "Kelch-like ECH-associat 0.902 0.133 0.416 5.5e-13
UNIPROTKB|Q5R774624 KEAP1 "Kelch-like ECH-associat 0.902 0.133 0.416 5.5e-13
UNIPROTKB|A7MBG4624 KEAP1 "Uncharacterized protein 0.902 0.133 0.416 5.5e-13
MGI|MGI:1858732624 Keap1 "kelch-like ECH-associat 0.902 0.133 0.416 9.1e-13
RGD|621619624 Keap1 "Kelch-like ECH-associat 0.902 0.133 0.428 9.1e-13
ZFIN|ZDB-GENE-080508-1593 keap1b "kelch-like ECH-associa 0.902 0.139 0.369 2.9e-12
UNIPROTKB|E1BS99 638 KLHL22 "Uncharacterized protei 0.923 0.133 0.382 5.3e-12
MGI|MGI:2683536558 Klhl23 "kelch-like 23" [Mus mu 0.847 0.139 0.443 6.5e-11
UNIPROTKB|F1PDU2 KEAP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 189 (71.6 bits), Expect = 7.6e-14, P = 7.6e-14
 Identities = 36/84 (42%), Positives = 51/84 (60%)

Query:     4 GWHASTENTNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSI 63
             G +   +  N VE Y +   TW + +PMK +R   GI V  G+IYVLGG +G   + DS+
Sbjct:   523 GGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHT-FLDSV 581

Query:    64 ECYDVDNDSWEIMSHLPSARSWLG 87
             ECYD D D+W  ++H+ S RS +G
Sbjct:   582 ECYDPDTDTWSEVTHMTSGRSGVG 605
GO:0045604 "regulation of epidermal cell differentiation" evidence=IEA
GO:0030496 "midbody" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0005813 "centrosome" evidence=IEA
GO:0005783 "endoplasmic reticulum" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0001701 "in utero embryonic development" evidence=IEA
UNIPROTKB|Q684M4 KEAP1 "Kelch-like ECH-associated protein 1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q14145 KEAP1 "Kelch-like ECH-associated protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R774 KEAP1 "Kelch-like ECH-associated protein 1" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|A7MBG4 KEAP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1858732 Keap1 "kelch-like ECH-associated protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621619 Keap1 "Kelch-like ECH-associated protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080508-1 keap1b "kelch-like ECH-associated protein 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BS99 KLHL22 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:2683536 Klhl23 "kelch-like 23" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query92
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 9e-13
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 5e-10
pfam0134446 pfam01344, Kelch_1, Kelch motif 5e-09
PHA02713 557 PHA02713, PHA02713, hypothetical protein; Provisio 2e-08
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 5e-08
smart0061247 smart00612, Kelch, Kelch domain 1e-06
pfam1396450 pfam13964, Kelch_6, Kelch motif 3e-06
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 6e-06
PHA03098 534 PHA03098, PHA03098, kelch-like protein; Provisiona 2e-05
smart0061247 smart00612, Kelch, Kelch domain 3e-05
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 4e-04
pfam0764648 pfam07646, Kelch_2, Kelch motif 0.001
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information 
 Score = 61.7 bits (150), Expect = 9e-13
 Identities = 21/75 (28%), Positives = 37/75 (49%)

Query: 10  ENTNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSIECYDVD 69
            + N VE +   E+ W  + P+   RY P +  ++  IYV+GG    D    ++EC+ ++
Sbjct: 355 ISLNTVESWKPGESKWREEPPLIFPRYNPCVVNVNNLIYVIGGISKNDELLKTVECFSLN 414

Query: 70  NDSWEIMSHLPSARS 84
            + W   S LP +  
Sbjct: 415 TNKWSKGSPLPISHY 429

Length = 534
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|165086 PHA02713, PHA02713, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|116261 pfam07646, Kelch_2, Kelch motif Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 92
KOG4441|consensus571 99.88
KOG4441|consensus 571 99.88
PHA02713 557 hypothetical protein; Provisional 99.88
PHA02713557 hypothetical protein; Provisional 99.85
PHA03098 534 kelch-like protein; Provisional 99.83
PHA03098534 kelch-like protein; Provisional 99.82
PHA02790480 Kelch-like protein; Provisional 99.82
PHA02790 480 Kelch-like protein; Provisional 99.81
PLN02153 341 epithiospecifier protein 99.79
TIGR03548 323 mutarot_permut cyclically-permuted mutatrotase fam 99.79
PLN02153 341 epithiospecifier protein 99.78
PLN02193 470 nitrile-specifier protein 99.77
TIGR03547 346 muta_rot_YjhT mutatrotase, YjhT family. Members of 99.77
PF1396450 Kelch_6: Kelch motif 99.74
PLN02193 470 nitrile-specifier protein 99.74
PRK14131 376 N-acetylneuraminic acid mutarotase; Provisional 99.73
KOG0379|consensus 482 99.73
TIGR03548 323 mutarot_permut cyclically-permuted mutatrotase fam 99.72
TIGR03547 346 muta_rot_YjhT mutatrotase, YjhT family. Members of 99.69
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.63
KOG0379|consensus 482 99.6
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 99.59
KOG4693|consensus 392 99.57
PF1341549 Kelch_3: Galactose oxidase, central domain 99.57
KOG4693|consensus392 99.56
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 99.51
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 99.5
smart0061247 Kelch Kelch domain. 99.48
KOG1230|consensus 521 99.43
KOG1230|consensus 521 99.42
smart0061247 Kelch Kelch domain. 99.23
PF1341549 Kelch_3: Galactose oxidase, central domain 99.23
KOG4152|consensus 830 99.18
PF1396450 Kelch_6: Kelch motif 99.16
PF1385442 Kelch_5: Kelch motif 99.13
PLN02772 398 guanylate kinase 98.96
COG3055 381 Uncharacterized protein conserved in bacteria [Fun 98.92
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.85
KOG4152|consensus 830 98.84
COG3055 381 Uncharacterized protein conserved in bacteria [Fun 98.74
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.69
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.46
PLN02772 398 guanylate kinase 98.43
KOG2437|consensus 723 98.28
KOG2437|consensus 723 97.74
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 97.34
PF12768 281 Rax2: Cortical protein marker for cell polarity 97.05
PF07250 243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 96.15
PF07893 342 DUF1668: Protein of unknown function (DUF1668); In 95.85
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 95.62
TIGR01640 230 F_box_assoc_1 F-box protein interaction domain. Th 95.09
PF03089 337 RAG2: Recombination activating protein 2; InterPro 93.09
PF07893 342 DUF1668: Protein of unknown function (DUF1668); In 93.02
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 91.77
PF05096 264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 88.64
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 88.34
smart00284 255 OLF Olfactomedin-like domains. 80.79
>KOG4441|consensus Back     alignment and domain information 
Probab=99.88  E-value=1.5e-22  Score=129.56  Aligned_cols=90  Identities=33%  Similarity=0.760  Sum_probs=81.2

Q ss_pred             CccccCC-CCCCcceEEEeeCCCCeEEeeCCCCCCcccceEEEECCEEEEEcCcCCCCCccceEEEEeCCCCceEEcCCC
Q psy2980           1 MLRGWHA-STENTNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSIECYDVDNDSWEIMSHL   79 (92)
Q Consensus         1 v~GG~~~-~~~~~~~v~~yd~~~~~W~~~~~~~~~~~~~~~~~~~~~iy~~GG~~~~~~~~~~~~~y~~~~~~W~~~~~~   79 (92)
                      ++||.++ ..+++  +++|||.+++|..+++|+.+|.++++++++++||++||.++....++++++|||.+++|+.+++|
T Consensus       385 avGG~dg~~~l~s--vE~YDp~~~~W~~va~m~~~r~~~gv~~~~g~iYi~GG~~~~~~~l~sve~YDP~t~~W~~~~~M  462 (571)
T KOG4441|consen  385 AVGGFDGEKSLNS--VECYDPVTNKWTPVAPMLTRRSGHGVAVLGGKLYIIGGGDGSSNCLNSVECYDPETNTWTLIAPM  462 (571)
T ss_pred             EEecccccccccc--EEEecCCCCcccccCCCCcceeeeEEEEECCEEEEEcCcCCCccccceEEEEcCCCCceeecCCc
Confidence            4799883 34555  99999999999999999999999999999999999999987444899999999999999999999


Q ss_pred             CCCccceeeEEcC
Q psy2980          80 PSARSWLGCVPLQ   92 (92)
Q Consensus        80 ~~~~~~~~~~~~~   92 (92)
                      +.+|..+++++++
T Consensus       463 ~~~R~~~g~a~~~  475 (571)
T KOG4441|consen  463 NTRRSGFGVAVLN  475 (571)
T ss_pred             ccccccceEEEEC
Confidence            9999999998764

>KOG4441|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG0379|consensus Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>KOG0379|consensus Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG4693|consensus Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>KOG4693|consensus Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>KOG1230|consensus Back     alignment and domain information
>KOG1230|consensus Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>KOG2437|consensus Back     alignment and domain information
>KOG2437|consensus Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query92
3vng_A309 Crystal Structure Of Keap1 In Complex With Syntheti 2e-13
1u6d_X308 Crystal Structure Of The Kelch Domain Of Human Keap 2e-13
2dyh_A318 Crystal Structure Of The Keap1 Protein In Complexed 5e-13
1x2j_A316 Structural Basis For The Defects Of Human Lung Canc 5e-13
1zgk_A308 1.35 Angstrom Structure Of The Kelch Domain Of Keap 4e-12
2woz_A318 The Novel Beta-Propeller Of The Btb-Kelch Protein K 1e-09
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 5e-08
3ii7_A306 Crystal Structure Of The Kelch Domain Of Human Klhl 3e-07
2xn4_A302 Crystal Structure Of The Kelch Domain Of Human Klhl 2e-06
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure 
Iteration: 1

 Score = 70.5 bits (171), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 50/84 (59%), Gaps = 1/84 (1%)
Query: 4   GWHASTENTNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSI 63
           G +   +  N VE Y +   TW + +PMK +R   GI V  G+IYVLGG +G   + DS+
Sbjct: 223 GGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHT-FLDSV 281
Query: 64  ECYDVDNDSWEIMSHLPSARSWLG 87
           ECYD D D+W  ++ + S RS +G
Sbjct: 282 ECYDPDTDTWSEVTRMTSGRSGVG 305
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure
>pdb|2DYH|A Chain A, Crystal Structure Of The Keap1 Protein In Complexed With The N-Terminal Region Of The Nrf2 Transcription Factor Length = 318 Back     alignment and structure
>pdb|1X2J|A Chain A, Structural Basis For The Defects Of Human Lung Cancer Somatic Mutations In The Repression Activity Of Keap1 On Nrf2 Length = 316 Back     alignment and structure
>pdb|1ZGK|A Chain A, 1.35 Angstrom Structure Of The Kelch Domain Of Keap1 Length = 308 Back     alignment and structure
>pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 Back     alignment and structure
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure
>pdb|3II7|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl7 Length = 306 Back     alignment and structure
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query92
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-26
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 5e-25
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 3e-24
2vpj_A 301 Kelch-like protein 12; adaptor protein, WNT signal 6e-20
2vpj_A 301 Kelch-like protein 12; adaptor protein, WNT signal 6e-20
2vpj_A 301 Kelch-like protein 12; adaptor protein, WNT signal 3e-11
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-26
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 3e-24
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 5e-20
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-19
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 7e-16
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 3e-07
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-25
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 4e-24
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-23
1zgk_A 308 Kelch-like ECH-associated protein 1; beta-propelle 4e-22
1zgk_A 308 Kelch-like ECH-associated protein 1; beta-propelle 2e-19
1zgk_A 308 Kelch-like ECH-associated protein 1; beta-propelle 1e-10
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-04
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-25
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 3e-23
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-21
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 4e-21
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 2e-15
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 6e-09
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 2e-25
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 3e-24
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-23
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 4e-22
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 2e-20
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 3e-08
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 4e-04
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 8e-24
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 8e-24
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 1e-23
2xn4_A 302 Kelch-like protein 2; structural protein, cytoskel 8e-22
2xn4_A 302 Kelch-like protein 2; structural protein, cytoskel 8e-21
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 9e-06
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 7e-12
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 1e-11
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 2e-11
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 5e-11
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 7e-09
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 5e-07
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 1e-04
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 6e-08
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 4e-07
2zwa_A 695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 3e-07
2zwa_A 695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 2e-06
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
 Score = 98.1 bits (245), Expect = 1e-26
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query: 6   HASTENTNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSIEC 65
              T + + VE Y+I  ++W   + M   R   G  V+ G++Y + G    +    SIEC
Sbjct: 215 FDGTAHLSSVEAYNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIAG-YDGNSLLSSIEC 273

Query: 66  YDVDNDSWEIMSHLPSARSWLGCVPLQ 92
           YD   DSWE+++ + + R   G   L+
Sbjct: 274 YDPIIDSWEVVTSMGTQRCDAGVCVLR 300
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query92
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 99.88
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 99.87
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 99.86
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 99.86
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 99.86
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 99.86
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 99.86
2xn4_A 302 Kelch-like protein 2; structural protein, cytoskel 99.85
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 99.85
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 99.85
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 99.84
2vpj_A 301 Kelch-like protein 12; adaptor protein, WNT signal 99.84
2zwa_A 695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.81
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 99.79
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 99.79
2zwa_A 695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.77
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.62
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.61
3mbr_X 243 Glutamine cyclotransferase; beta-propeller; 1.44A 94.25
3nol_A 262 Glutamine cyclotransferase; beta-propeller, glutam 93.53
3mbr_X 243 Glutamine cyclotransferase; beta-propeller; 1.44A 89.46
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 88.94
3nol_A 262 Glutamine cyclotransferase; beta-propeller, glutam 86.35
3nok_A 268 Glutaminyl cyclase; beta-propeller, cyclotransfera 84.0
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 83.65
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
Probab=99.88  E-value=1.7e-21  Score=115.98  Aligned_cols=92  Identities=20%  Similarity=0.365  Sum_probs=80.9

Q ss_pred             CccccCC--CCCCcceEEEeeCCCCeEEeeCCCCCCcccceEEEECCEEEEEcCcCCCCCccceEEEEeCCCCceEEcCC
Q psy2980           1 MLRGWHA--STENTNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSIECYDVDNDSWEIMSH   78 (92)
Q Consensus         1 v~GG~~~--~~~~~~~v~~yd~~~~~W~~~~~~~~~~~~~~~~~~~~~iy~~GG~~~~~~~~~~~~~y~~~~~~W~~~~~   78 (92)
                      |+||.+.  .....+++++||+.+++|..++++|.+|..+++++++++||++||........+++++||+.+++|+.+++
T Consensus       103 v~GG~~~~~~~~~~~~~~~~d~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~yd~~~~~W~~~~~  182 (315)
T 4asc_A          103 VVGGREIKDGERCLDSVMCYDRLSFKWGESDPLPYVVYGHTVLSHMDLVYVIGGKGSDRKCLNKMCVYDPKKFEWKELAP  182 (315)
T ss_dssp             EECCEESSTTCCBCCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCTTSCBCCCEEEEETTTTEEEECCC
T ss_pred             EEeCCcCCCCCcccceEEEECCCCCcEeECCCCCCcccceeEEEECCEEEEEeCCCCCCcccceEEEEeCCCCeEEECCC
Confidence            5788652  24455679999999999999999999999999999999999999985546779999999999999999999


Q ss_pred             CCCCccceeeEEcC
Q psy2980          79 LPSARSWLGCVPLQ   92 (92)
Q Consensus        79 ~~~~~~~~~~~~~~   92 (92)
                      +|.+|..|++++++
T Consensus       183 ~p~~r~~~~~~~~~  196 (315)
T 4asc_A          183 MQTARSLFGATVHD  196 (315)
T ss_dssp             CSSCCBSCEEEEET
T ss_pred             CCCchhceEEEEEC
Confidence            99999999988753
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 92
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 3e-12
d1zgka1 288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 5e-06
d1zgka1 288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 0.003
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-08
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 4e-05
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 4e-05
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 58.0 bits (138), Expect = 3e-12
 Identities = 35/86 (40%), Positives = 50/86 (58%), Gaps = 1/86 (1%)

Query: 4   GWHASTENTNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEGWDGYHDSI 63
           G +   +  N VE Y +   TW + +PMK +R   GI V  G+IYVLGG +G   + DS+
Sbjct: 202 GGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHT-FLDSV 260

Query: 64  ECYDVDNDSWEIMSHLPSARSWLGCV 89
           ECYD D D+W  ++ + S RS +G  
Sbjct: 261 ECYDPDTDTWSEVTRMTSGRSGVGVA 286
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query92
d1zgka1 288 Kelch-like ECH-associated protein 1, KEAP1 {Human 99.88
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 99.85
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.53
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 99.48
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.88  E-value=1.8e-22  Score=116.92  Aligned_cols=90  Identities=18%  Similarity=0.419  Sum_probs=78.6

Q ss_pred             CccccCCCCCCcceEEEeeCCCCeEEeeCCCCCCcccceEEEECCEEEEEcCcCC---CCCccceEEEEeCCCCceEEcC
Q psy2980           1 MLRGWHASTENTNRVECYHIAENTWEYKSPMKEKRYRPGIAVIDGKIYVLGGEEG---WDGYHDSIECYDVDNDSWEIMS   77 (92)
Q Consensus         1 v~GG~~~~~~~~~~v~~yd~~~~~W~~~~~~~~~~~~~~~~~~~~~iy~~GG~~~---~~~~~~~~~~y~~~~~~W~~~~   77 (92)
                      |+||.+....  +.+++||+++++|.+++++|.+|..|++++++++||++||...   .....+++++||+.+++|++++
T Consensus         9 v~GG~~~~~~--~~~~~yd~~t~~W~~~~~~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~yd~~~~~w~~~~   86 (288)
T d1zgka1           9 TAGGYFRQSL--SYLEAYNPSNGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCA   86 (288)
T ss_dssp             EECCBSSSBC--CCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCEEEETTEEEECCCEEEEETTTTEEEECC
T ss_pred             EECCcCCCCC--ceEEEEECCCCeEEECCCCCCccceeEEEEECCEEEEEeCcccCCCCccccchhhhcccccccccccc
Confidence            5899875444  4599999999999999999999999999999999999999742   1345789999999999999999


Q ss_pred             CCCCCccceeeEEcC
Q psy2980          78 HLPSARSWLGCVPLQ   92 (92)
Q Consensus        78 ~~~~~~~~~~~~~~~   92 (92)
                      +||.+|..|++++++
T Consensus        87 ~~p~~r~~~~~~~~~  101 (288)
T d1zgka1          87 PMSVPRNRIGVGVID  101 (288)
T ss_dssp             CCSSCCBTCEEEEET
T ss_pred             cccceecceeccccc
Confidence            999999999988763
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure