Psyllid ID: psy3005

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------8
MGQPVRCAHQVSCRPDQVKLWITINEPLEAMQGYDFKTYAPYLSMTGVGGEYLAAHNMLRSHAKAYRLYEKKYKPSQKG
ccccccHHHHccccccccccccccHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccc
ccccEEEEEEEEEccccEEEEEEEcccHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHcc
mgqpvrcahqvscrpdqVKLWITINepleamqgydfktyapylsmtgvggEYLAAHNMLRSHAKAYRLYekkykpsqkg
mgqpvrcahqvscrpdqvKLWITINEPLEAMQGYDFKTYAPYLSMTGVGGEYLAAHNMLRSHAKAYRlyekkykpsqkg
MGQPVRCAHQVSCRPDQVKLWITINEPLEAMQGYDFKTYAPYLSMTGVGGEYLAAHNMLRSHAKAYRLYEKKYKPSQKG
******CAHQVSCRPDQVKLWITINEPLEAMQGYDFKTYAPYLSMTGVGGEYLAAHNMLRSHAKAYRLY**********
*GQPVRCAHQVSCRPDQVKLWITINEPLEAMQGYDFKTYAPYLSMTGVGGEYLAAHNMLRSHAKAYRLYEKKYK*****
**********VSCRPDQVKLWITINEPLEAMQGYDFKTYAPYLSMTGVGGEYLAAHNMLRSHAKAYRLYEK********
**QPVRCAHQVSCRPDQVKLWITINEPLEAMQGYDFKTYAPYLSMTGVGGEYLAAHNMLRSHAKAYRLYEKKYKPS***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGQPVRCAHQVSCRPDQVKLWITINEPLEAMQGYDFKTYAPYLSMTGVGGEYLAAHNMLRSHAKAYRLYEKKYKPSQKG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query79 2.2.26 [Sep-21-2011]
Q95X01 464 Myrosinase 1 OS=Brevicory N/A N/A 0.797 0.135 0.531 1e-13
P97265 469 Cytosolic beta-glucosidas yes N/A 0.784 0.132 0.5 2e-10
P09848 1927 Lactase-phlorizin hydrola yes N/A 0.810 0.033 0.446 1e-09
Q02401 1928 Lactase-phlorizin hydrola yes N/A 0.810 0.033 0.430 9e-09
P09849 1926 Lactase-phlorizin hydrola yes N/A 0.810 0.033 0.415 2e-08
A3C053 494 Beta-glucosidase 29 OS=Or yes N/A 0.810 0.129 0.426 3e-08
Q339X2 510 Beta-glucosidase 34 OS=Or no N/A 0.810 0.125 0.453 4e-08
Q75W17 538 Furcatin hydrolase OS=Vib N/A N/A 0.810 0.118 0.442 6e-08
Q9H227 469 Cytosolic beta-glucosidas no N/A 0.797 0.134 0.4 1e-07
A2SY66 509 Vicianin hydrolase (Fragm N/A N/A 0.810 0.125 0.405 2e-07
>sp|Q95X01|MYRO1_BREBR Myrosinase 1 OS=Brevicoryne brassicae PE=1 SV=1 Back     alignment and function desciption
 Score = 74.7 bits (182), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 16  DQVKLWITINEPLEAMQGYDFKTYAPYLSMTGVGGEYLAAHNMLRSHAKAYRLYEKKYKP 75
           D+VK WIT NEP+   +GY  K YAP L++   G  YLA H  L +H KAYRLYE+ +KP
Sbjct: 157 DRVKWWITFNEPIAVCKGYSIKAYAPNLNLKTTG-HYLAGHTQLIAHGKAYRLYEEMFKP 215

Query: 76  SQKG 79
           +Q G
Sbjct: 216 TQNG 219
Hydrolyzes glucosinolates to a labile aglcone. This rapidly undergoes spontaneous rearrangement, eliminating sulfur to yield a number of toxic metabolites. Thereby developing a chemical defense system that exploits and mimics the host plant.
Brevicoryne brassicae (taxid: 69196)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 4EC: 7
>sp|P97265|GBA3_CAVPO Cytosolic beta-glucosidase OS=Cavia porcellus GN=Gba3 PE=1 SV=1 Back     alignment and function description
>sp|P09848|LPH_HUMAN Lactase-phlorizin hydrolase OS=Homo sapiens GN=LCT PE=1 SV=3 Back     alignment and function description
>sp|Q02401|LPH_RAT Lactase-phlorizin hydrolase OS=Rattus norvegicus GN=Lct PE=2 SV=2 Back     alignment and function description
>sp|P09849|LPH_RABIT Lactase-phlorizin hydrolase OS=Oryctolagus cuniculus GN=LCT PE=1 SV=1 Back     alignment and function description
>sp|A3C053|BGL29_ORYSJ Beta-glucosidase 29 OS=Oryza sativa subsp. japonica GN=BGLU29 PE=2 SV=2 Back     alignment and function description
>sp|Q339X2|BGL34_ORYSJ Beta-glucosidase 34 OS=Oryza sativa subsp. japonica GN=BGLU34 PE=2 SV=1 Back     alignment and function description
>sp|Q75W17|FURH_VIBFR Furcatin hydrolase OS=Viburnum furcatum PE=1 SV=1 Back     alignment and function description
>sp|Q9H227|GBA3_HUMAN Cytosolic beta-glucosidase OS=Homo sapiens GN=GBA3 PE=1 SV=2 Back     alignment and function description
>sp|A2SY66|VICHY_VICSN Vicianin hydrolase (Fragment) OS=Vicia sativa subsp. nigra PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query79
193625083 477 PREDICTED: myrosinase 1-like [Acyrthosip 0.797 0.132 0.578 2e-14
328713979 491 PREDICTED: myrosinase 1-like isoform 1 [ 0.797 0.128 0.562 8e-13
328713981 382 PREDICTED: myrosinase 1-like isoform 2 [ 0.797 0.164 0.562 2e-12
74938515 464 RecName: Full=Myrosinase 1; AltName: Ful 0.797 0.135 0.531 6e-12
364806919 539 beta-glucosidase [Coptotermes formosanus 0.797 0.116 0.529 7e-11
364023613 513 seminal fluid protein CSSFP031 [Chilo su 0.797 0.122 0.538 9e-11
124358334 532 female neotenic-specific protein 2 [Cryp 0.797 0.118 0.5 2e-10
300432455 495 beta-glucosidase [Reticulitermes flavipe 0.797 0.127 0.492 4e-10
198415997 364 PREDICTED: similar to lactase-like b, pa 0.797 0.173 0.484 7e-10
444512945 1919 Lactase-phlorizin hydrolase [Tupaia chin 0.810 0.033 0.461 2e-09
>gi|193625083|ref|XP_001946492.1| PREDICTED: myrosinase 1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 83.2 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 37/64 (57%), Positives = 48/64 (75%), Gaps = 1/64 (1%)

Query: 16  DQVKLWITINEPLEAMQGYDFKTYAPYLSMTGVGGEYLAAHNMLRSHAKAYRLYEKKYKP 75
           D+VK WIT+NEP+E  +GY  K YAPYL++    G YLAAH  L +H KAYRLYE+ +KP
Sbjct: 157 DRVKWWITLNEPMEVCKGYAIKGYAPYLNLNNT-GLYLAAHTQLIAHGKAYRLYEEMFKP 215

Query: 76  SQKG 79
           +Q+G
Sbjct: 216 TQQG 219

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328713979|ref|XP_001952406.2| PREDICTED: myrosinase 1-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328713981|ref|XP_003245229.1| PREDICTED: myrosinase 1-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|74938515|sp|Q95X01.1|MYRO1_BREBR RecName: Full=Myrosinase 1; AltName: Full=Beta-glucosidase 1; AltName: Full=Beta-thioglucosidase 1; AltName: Full=Beta-thioglucosidase glucohydrolase 1; AltName: Full=Sinigrinase 1; AltName: Full=Thioglucosidase 1 gi|83753522|pdb|1WCG|A Chain A, Aphid Myrosinase gi|83753523|pdb|1WCG|B Chain B, Aphid Myrosinase gi|16564883|gb|AAL25999.1|AF203780_1 thioglucosidase [Brevicoryne brassicae] Back     alignment and taxonomy information
>gi|364806919|gb|AEW67360.1| beta-glucosidase [Coptotermes formosanus] Back     alignment and taxonomy information
>gi|364023613|gb|AEW46881.1| seminal fluid protein CSSFP031 [Chilo suppressalis] Back     alignment and taxonomy information
>gi|124358334|gb|ABN05620.1| female neotenic-specific protein 2 [Cryptotermes secundus] Back     alignment and taxonomy information
>gi|300432455|gb|ADK12988.1| beta-glucosidase [Reticulitermes flavipes] Back     alignment and taxonomy information
>gi|198415997|ref|XP_002122714.1| PREDICTED: similar to lactase-like b, partial [Ciona intestinalis] Back     alignment and taxonomy information
>gi|444512945|gb|ELV10219.1| Lactase-phlorizin hydrolase [Tupaia chinensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query79
ZFIN|ZDB-GENE-050522-351 475 zgc:112375 "zgc:112375" [Danio 0.797 0.132 0.507 3.8e-11
UNIPROTKB|P97265 469 Gba3 "Cytosolic beta-glucosida 0.784 0.132 0.5 1e-10
UNIPROTKB|E2QYW6 469 GBA3 "Uncharacterized protein" 0.797 0.134 0.430 2e-09
UNIPROTKB|F6XBY5 497 GBA3 "Uncharacterized protein" 0.797 0.126 0.430 2.2e-09
UNIPROTKB|I3L7V1 1930 LOC100625897 "Uncharacterized 0.810 0.033 0.446 2.3e-09
UNIPROTKB|F1PDK6 1360 LCT "Uncharacterized protein" 0.810 0.047 0.446 2.5e-09
UNIPROTKB|F1MNT6 476 GBA3 "Uncharacterized protein" 0.797 0.132 0.415 3.4e-09
ZFIN|ZDB-GENE-060503-93 585 lctlb "lactase-like b" [Danio 0.797 0.107 0.415 3.7e-09
ZFIN|ZDB-GENE-040718-233 552 lctla "lactase-like a" [Danio 0.784 0.112 0.437 5.6e-09
UNIPROTKB|P09848 1927 LCT "Lactase-phlorizin hydrola 0.810 0.033 0.446 6.2e-09
ZFIN|ZDB-GENE-050522-351 zgc:112375 "zgc:112375" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 162 (62.1 bits), Expect = 3.8e-11, P = 3.8e-11
 Identities = 33/65 (50%), Positives = 44/65 (67%)

Query:    16 DQVKLWITINEPLE-AMQGYDFKTYAPYLSMTGVGGEYLAAHNMLRSHAKAYRLYEKKYK 74
             D+VKLWIT+NEP   AM GY+   +AP +   G+   Y+A HNMLR+HAKA+  Y   ++
Sbjct:   160 DRVKLWITLNEPYVCAMLGYEDGIFAPGIKDPGLS-VYVAGHNMLRAHAKAWHAYNTHFR 218

Query:    75 PSQKG 79
             PSQ G
Sbjct:   219 PSQGG 223
GO:0004553 "hydrolase activity, hydrolyzing O-glycosyl compounds" evidence=IEA
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0016787 "hydrolase activity" evidence=IEA
GO:0016798 "hydrolase activity, acting on glycosyl bonds" evidence=IEA
UNIPROTKB|P97265 Gba3 "Cytosolic beta-glucosidase" [Cavia porcellus (taxid:10141)] Back     alignment and assigned GO terms
UNIPROTKB|E2QYW6 GBA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6XBY5 GBA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3L7V1 LOC100625897 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PDK6 LCT "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MNT6 GBA3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-93 lctlb "lactase-like b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-233 lctla "lactase-like a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P09848 LCT "Lactase-phlorizin hydrolase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query79
PLN02814 504 PLN02814, PLN02814, beta-glucosidase 6e-09
pfam00232 454 pfam00232, Glyco_hydro_1, Glycosyl hydrolase famil 3e-07
COG2723 460 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glu 2e-06
PLN02849 503 PLN02849, PLN02849, beta-glucosidase 1e-05
TIGR03356 426 TIGR03356, BGL, beta-galactosidase 2e-05
PLN02998 497 PLN02998, PLN02998, beta-glucosidase 1e-04
PRK13511 469 PRK13511, PRK13511, 6-phospho-beta-galactosidase; 4e-04
TIGR01233 467 TIGR01233, lacG, 6-phospho-beta-galactosidase 5e-04
>gnl|CDD|215435 PLN02814, PLN02814, beta-glucosidase Back     alignment and domain information 
 Score = 50.3 bits (120), Expect = 6e-09
 Identities = 28/74 (37%), Positives = 38/74 (51%), Gaps = 10/74 (13%)

Query: 16  DQVKLWITINEP-LEAMQGYD----FKTYAPYLSMTGVGGE-----YLAAHNMLRSHAKA 65
           + VKLW TINE  + A+  Y     +   +P   +    G      Y+A HNML +HA A
Sbjct: 175 EDVKLWTTINEATIFAIGSYGQGIRYGHCSPNKFINCSTGNSCTETYIAGHNMLLAHASA 234

Query: 66  YRLYEKKYKPSQKG 79
             LY+ KYK  Q+G
Sbjct: 235 SNLYKLKYKSKQRG 248

Length = 504
>gnl|CDD|215809 pfam00232, Glyco_hydro_1, Glycosyl hydrolase family 1 Back     alignment and domain information
>gnl|CDD|225343 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glucosidase/beta- galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|215455 PLN02849, PLN02849, beta-glucosidase Back     alignment and domain information
>gnl|CDD|234180 TIGR03356, BGL, beta-galactosidase Back     alignment and domain information
>gnl|CDD|215539 PLN02998, PLN02998, beta-glucosidase Back     alignment and domain information
>gnl|CDD|184102 PRK13511, PRK13511, 6-phospho-beta-galactosidase; Provisional Back     alignment and domain information
>gnl|CDD|130300 TIGR01233, lacG, 6-phospho-beta-galactosidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 79
COG2723 460 BglB Beta-glucosidase/6-phospho-beta-glucosidase/b 99.91
KOG0626|consensus 524 99.9
PRK13511 469 6-phospho-beta-galactosidase; Provisional 99.9
TIGR01233 467 lacG 6-phospho-beta-galactosidase. This enzyme is 99.89
PF00232 455 Glyco_hydro_1: Glycosyl hydrolase family 1; InterP 99.89
PLN02998 497 beta-glucosidase 99.89
PRK09593 478 arb 6-phospho-beta-glucosidase; Reviewed 99.88
PRK09852 474 cryptic 6-phospho-beta-glucosidase; Provisional 99.88
PLN02849 503 beta-glucosidase 99.88
PRK09589 476 celA 6-phospho-beta-glucosidase; Reviewed 99.88
PLN02814 504 beta-glucosidase 99.86
PRK15014 477 6-phospho-beta-glucosidase BglA; Provisional 99.86
TIGR03356 427 BGL beta-galactosidase. 99.86
smart00633 254 Glyco_10 Glycosyl hydrolase family 10. 94.66
PF11790 239 Glyco_hydro_cc: Glycosyl hydrolase catalytic core; 84.23
PF1365330 GDPD_2: Glycerophosphoryl diester phosphodiesteras 84.13
>COG2723 BglB Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information 
Probab=99.91  E-value=9.5e-26  Score=162.48  Aligned_cols=73  Identities=30%  Similarity=0.381  Sum_probs=68.1

Q ss_pred             eeecccceeCCCceeEEEEechhhhhh-cCCccccccceeeeeccchhhHHHhHHHHHHHHHHHHHHhhcCCCCCC
Q psy3005           5 VRCAHQVSCRPDQVKLWITINEPLEAM-QGYDFKTYAPYLSMTGVGGEYLAAHNMLRSHAKAYRLYEKKYKPSQKG   79 (79)
Q Consensus         5 ~ya~~v~~~fgd~V~~W~TfNEpn~~~-~~y~~g~~~p~~~~~~~~~~~~~~h~~~~Aha~a~~~~k~~~~~~~~g   79 (79)
                      .||++||++|||+||||+||||||+++ .+|+.+.+||+..+.+.  .+|+.||+++|||+|++++|++.|+.|||
T Consensus       147 ~ya~~vf~~f~dkVk~W~TFNE~n~~~~~~y~~~~~~p~~~~~~~--~~qa~hh~~lA~A~avk~~~~~~~~~kIG  220 (460)
T COG2723         147 RYAATVFERFGDKVKYWFTFNEPNVVVELGYLYGGHPPGIVDPKA--AYQVAHHMLLAHALAVKAIKKINPKGKVG  220 (460)
T ss_pred             HHHHHHHHHhcCcceEEEEecchhhhhcccccccccCCCccCHHH--HHHHHHHHHHHHHHHHHHHHhhCCcCceE
Confidence            599999999999999999999999999 99999999988777666  89999999999999999999999886776

>KOG0626|consensus Back     alignment and domain information
>PRK13511 6-phospho-beta-galactosidase; Provisional Back     alignment and domain information
>TIGR01233 lacG 6-phospho-beta-galactosidase Back     alignment and domain information
>PF00232 Glyco_hydro_1: Glycosyl hydrolase family 1; InterPro: IPR001360 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN02998 beta-glucosidase Back     alignment and domain information
>PRK09593 arb 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PRK09852 cryptic 6-phospho-beta-glucosidase; Provisional Back     alignment and domain information
>PLN02849 beta-glucosidase Back     alignment and domain information
>PRK09589 celA 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PLN02814 beta-glucosidase Back     alignment and domain information
>PRK15014 6-phospho-beta-glucosidase BglA; Provisional Back     alignment and domain information
>TIGR03356 BGL beta-galactosidase Back     alignment and domain information
>smart00633 Glyco_10 Glycosyl hydrolase family 10 Back     alignment and domain information
>PF11790 Glyco_hydro_cc: Glycosyl hydrolase catalytic core; InterPro: IPR024655 This entry represents the glycosyl hydrolase catalytic core of a group of uncharacterised proteins Back     alignment and domain information
>PF13653 GDPD_2: Glycerophosphoryl diester phosphodiesterase family; PDB: 3RLG_A 2F9R_B 1XX1_A 3RLH_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query79
1wcg_A 464 Aphid Myrosinase Length = 464 1e-14
3ahz_A 487 Crystal Structure Of Beta-Glucosidase From Termite 3e-11
3ai0_A 487 Crystal Structure Of Beta-Glucosidase From Termite 9e-11
3vik_A 487 Crystal Structure Of Beta-Glucosidase From Termite 1e-10
3vij_A 487 Crystal Structure Of Beta-Glucosidase From Termite 2e-10
2e9l_A 469 Crystal Structure Of Human Cytosolic Neutral Beta-G 1e-08
2jfe_X 469 The Crystal Structure Of Human Cytosolic Beta-Gluco 1e-08
2zox_A 469 Crystal Structure Of The Covalent Intermediate Of H 3e-08
3gno_A 488 Crystal Structure Of A Rice Os3bglu6 Beta-glucosida 2e-07
1od0_A 468 Family 1 B-Glucosidase From Thermotoga Maritima Len 4e-06
3scw_A 481 Crystal Structure Of Rice Bglu1 E386gY341A MUTANT C 8e-06
3scr_A 481 Crystal Structure Of Rice Bglu1 E386s Mutant Length 8e-06
3scp_A 481 Crystal Structure Of Rice Bglu1 E386a Mutant Length 8e-06
2rgl_A 481 Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBE 8e-06
3scn_A 481 Crystal Structure Of Rice Bglu1 E386g Mutant Length 8e-06
3scv_A 481 Crystal Structure Of Rice Bglu1 E386gS334A MUTANT C 8e-06
1cbg_A 490 The Crystal Structure Of A Cyanogenic Beta-Glucosid 8e-06
3f4v_A 481 Semi-Active E176q Mutant Of Rice Bglu1, A Plant Exo 2e-05
3ptk_A 505 The Crystal Structure Of Rice (Oryza Sativa L.) Os4 2e-05
3ahy_A 473 Crystal Structure Of Beta-Glucosidase 2 From Fungus 2e-05
4gxp_A 467 Chimeric Family 1 Beta-Glucosidase Made With Non-Co 2e-05
2jf6_A 532 Structure Of Inactive Mutant Of Strictosidine Gluco 4e-05
3ahx_A 453 Crystal Structure Of Beta-Glucosidase A From Bacter 7e-05
3cmj_A 465 Crystal Structure Of Engineered Beta-Glucosidase Fr 3e-04
1e1e_A 512 Crystal Structure Of A Monocot (Maize Zmglu1) Beta- 4e-04
1hxj_A 507 Crystal Structure Of The Maize Zm-P60.1 Beta-Glucos 4e-04
2e3z_A 465 Crystal Structure Of Intracellular Family 1 Beta- G 5e-04
4hz6_A 444 Crystal Structure Of Bglb Length = 444 5e-04
1e4l_A 512 Crystal Structure Of The Inactive Mutant Monocot (M 9e-04
>pdb|1WCG|A Chain A, Aphid Myrosinase Length = 464 Back     alignment and structure 
Iteration: 1

 Score = 74.7 bits (182), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 43/64 (67%), Gaps = 1/64 (1%)
Query: 16  DQVKLWITINEPLEAMQGYDFKTYAPYLSMTGVGGEYLAAHNMLRSHAKAYRLYEKKYKP 75
           D+VK WIT NEP+   +GY  K YAP L++   G  YLA H  L +H KAYRLYE+ +KP
Sbjct: 157 DRVKWWITFNEPIAVCKGYSIKAYAPNLNLKTTG-HYLAGHTQLIAHGKAYRLYEEMFKP 215
Query: 76  SQKG 79
           +Q G
Sbjct: 216 TQNG 219
>pdb|3AHZ|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Tris Length = 487 Back     alignment and structure
>pdb|3AI0|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Para-Nitrophenyl-Beta-D-Glucopyranoside Length = 487 Back     alignment and structure
>pdb|3VIK|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Cellobiose Length = 487 Back     alignment and structure
>pdb|3VIJ|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Glucose Length = 487 Back     alignment and structure
>pdb|2E9L|A Chain A, Crystal Structure Of Human Cytosolic Neutral Beta-Glycosylceramidase (Klotho-Related Prote:klrp) Complex With Glucose And Fatty Acids Length = 469 Back     alignment and structure
>pdb|2JFE|X Chain X, The Crystal Structure Of Human Cytosolic Beta-Glucosidase Length = 469 Back     alignment and structure
>pdb|2ZOX|A Chain A, Crystal Structure Of The Covalent Intermediate Of Human Cytosolic Beta-Glucosidase Length = 469 Back     alignment and structure
>pdb|3GNO|A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase Length = 488 Back     alignment and structure
>pdb|1OD0|A Chain A, Family 1 B-Glucosidase From Thermotoga Maritima Length = 468 Back     alignment and structure
>pdb|3SCW|A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED WITH Cellotetraose Length = 481 Back     alignment and structure
>pdb|3SCR|A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant Length = 481 Back     alignment and structure
>pdb|3SCP|A Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant Length = 481 Back     alignment and structure
>pdb|2RGL|A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase Length = 481 Back     alignment and structure
>pdb|3SCN|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant Length = 481 Back     alignment and structure
>pdb|3SCV|A Chain A, Crystal Structure Of Rice Bglu1 E386gS334A MUTANT COMPLEXED WITH Cellotetraose Length = 481 Back     alignment and structure
>pdb|1CBG|A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase Length = 490 Back     alignment and structure
>pdb|3F4V|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- Glucosidase Length = 481 Back     alignment and structure
>pdb|3PTK|A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 Length = 505 Back     alignment and structure
>pdb|3AHY|A Chain A, Crystal Structure Of Beta-Glucosidase 2 From Fungus Trichoderma Reesei In Complex With Tris Length = 473 Back     alignment and structure
>pdb|4GXP|A Chain A, Chimeric Family 1 Beta-Glucosidase Made With Non-Contiguous Schema Length = 467 Back     alignment and structure
>pdb|2JF6|A Chain A, Structure Of Inactive Mutant Of Strictosidine Glucosidase In Complex With Strictosidine Length = 532 Back     alignment and structure
>pdb|3AHX|A Chain A, Crystal Structure Of Beta-Glucosidase A From Bacterium Clostridium Cellulovorans Length = 453 Back     alignment and structure
>pdb|3CMJ|A Chain A, Crystal Structure Of Engineered Beta-Glucosidase From Soil Metagenome Length = 465 Back     alignment and structure
>pdb|1E1E|A Chain A, Crystal Structure Of A Monocot (Maize Zmglu1) Beta-Glucosidase Length = 512 Back     alignment and structure
>pdb|1HXJ|A Chain A, Crystal Structure Of The Maize Zm-P60.1 Beta-Glucosidase Length = 507 Back     alignment and structure
>pdb|2E3Z|A Chain A, Crystal Structure Of Intracellular Family 1 Beta- Glucosidase Bgl1a From The Basidiomycete Phanerochaete Chrysosporium In Substrate-Free Form Length = 465 Back     alignment and structure
>pdb|4HZ6|A Chain A, Crystal Structure Of Bglb Length = 444 Back     alignment and structure
>pdb|1E4L|A Chain A, Crystal Structure Of The Inactive Mutant Monocot (Maize Zmglu1) Beta-Glucosidase Zm Glu191asp Length = 512 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query79
1wcg_A 464 Thioglucosidase, myrosinase; aphid, beta-glucosida 6e-23
3vii_A 487 Beta-glucosidase; cellulases, glycosyl hydrolase, 3e-22
2e9l_A 469 Cytosolic beta-glucosidase; novel cytosolic neutra 1e-21
2jf7_A 532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 3e-21
2dga_A 565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 3e-20
2e3z_A 465 Beta-glucosidase; TIM barrel, glycoside hydrolase 4e-20
3f5l_A 481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 7e-20
1cbg_A 490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 7e-20
3ptm_A 505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 9e-20
3gnp_A 488 OS03G0212800 protein; beta-alpha barrel, glycosida 1e-19
1v02_A 565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 3e-19
3ahy_A 473 Beta-glucosidase; cellulases, glycosyl hydrolase, 1e-18
1v08_A 512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 2e-18
1e4m_M 501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 7e-18
4a3y_A 540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 1e-17
2j78_A 468 Beta-glucosidase A; family 1, hydrolase, inhibitor 6e-15
1gnx_A 479 Beta-glucosidase; hydrolase, glycosyltransferase, 8e-15
3fj0_A 465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 4e-14
2o9p_A 454 Beta-glucosidase B; family 1 glycoside hydrolase; 8e-14
1qox_A 449 Beta-glucosidase; hydrolase, cellulose degradation 8e-14
3ahx_A 453 Beta-glucosidase A; cellulases, glycosyl hydrolase 2e-13
1e4i_A 447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 2e-13
1qvb_A 481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 3e-13
1vff_A 423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 6e-13
3ta9_A 458 Glycoside hydrolase family 1; TIM barrel, glucosid 7e-13
4eam_A 489 Lactase, beta-galactosidase; glycoside hydrolase, 2e-12
3apg_A 473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 2e-12
1ug6_A 431 Beta-glycosidase; glucosidase, atomic resolution, 4e-12
1pbg_A 468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 5e-12
2xhy_A 479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 4e-04
4dde_A 480 6-phospho-beta-glucosidase; structural genomics, P 8e-04
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Length = 464 Back     alignment and structure
 Score = 89.1 bits (222), Expect = 6e-23
 Identities = 34/64 (53%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 16  DQVKLWITINEPLEAMQGYDFKTYAPYLSMTGVGGEYLAAHNMLRSHAKAYRLYEKKYKP 75
           D+VK WIT NEP+   +GY  K YAP L++   G  YLA H  L +H KAYRLYE+ +KP
Sbjct: 157 DRVKWWITFNEPIAVCKGYSIKAYAPNLNLKTTG-HYLAGHTQLIAHGKAYRLYEEMFKP 215

Query: 76  SQKG 79
           +Q G
Sbjct: 216 TQNG 219
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Length = 487 Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Length = 469 Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Length = 532 Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Length = 565 Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Length = 465 Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Length = 481 Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Length = 490 Back     alignment and structure
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Length = 505 Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Length = 488 Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Length = 565 Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Length = 473 Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Length = 512 Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Length = 501 Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Length = 540 Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Length = 468 Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Length = 479 Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Length = 454 Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Length = 449 Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Length = 453 Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Length = 447 Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Length = 481 Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Length = 423 Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Length = 458 Back     alignment and structure
>4eam_A Lactase, beta-galactosidase; glycoside hydrolase, chemical biology, allosteric activation switchable enzyme, chemical rescue; 1.70A {Sulfolobus solfataricus P2} PDB: 4ean_A 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 1gow_A 1uwi_A Length = 489 Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Length = 473 Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Length = 431 Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Length = 468 Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Length = 479 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query79
3ta9_A 458 Glycoside hydrolase family 1; TIM barrel, glucosid 99.91
4b3l_A 479 Beta-glucosidase; hydrolase, glycosidase, carbohyd 99.9
4hz8_A 444 Beta-glucosidase; BGLB,BGL, hydrolase, glycosid ba 99.9
3ptm_A 505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 99.89
4atd_A 513 Raucaffricine-O-beta-D-glucosidase; alkaloid, hydr 99.89
3gnp_A 488 OS03G0212800 protein; beta-alpha barrel, glycosida 99.88
3vii_A 487 Beta-glucosidase; cellulases, glycosyl hydrolase, 99.88
4a3y_A 540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 99.88
3qom_A 481 6-phospho-beta-glucosidase; structural genomics, P 99.88
3f5l_A 481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 99.88
1gnx_A 479 Beta-glucosidase; hydrolase, glycosyltransferase, 99.88
4dde_A 480 6-phospho-beta-glucosidase; structural genomics, P 99.88
1e4i_A 447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 99.87
1uwi_A 489 Beta-galactosidase; hydrolase, beta-glycosidase, g 99.87
3fj0_A 465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 99.87
2e3z_A 465 Beta-glucosidase; TIM barrel, glycoside hydrolase 99.87
1qox_A 449 Beta-glucosidase; hydrolase, cellulose degradation 99.87
2o9p_A 454 Beta-glucosidase B; family 1 glycoside hydrolase; 99.86
2e9l_A 469 Cytosolic beta-glucosidase; novel cytosolic neutra 99.86
1pbg_A 468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 99.86
3ahx_A 453 Beta-glucosidase A; cellulases, glycosyl hydrolase 99.86
4ha4_A 489 Beta-galactosidase; TIM barrel, beta-glycosidase, 99.86
1e4m_M 501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 99.85
1cbg_A 490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 99.85
1ug6_A 431 Beta-glycosidase; glucosidase, atomic resolution, 99.85
2jf7_A 532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 99.85
2j78_A 468 Beta-glucosidase A; family 1, hydrolase, inhibitor 99.85
2dga_A 565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 99.85
1v08_A 512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 99.85
1qvb_A 481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 99.84
1v02_A 565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 99.84
3ahy_A 473 Beta-glucosidase; cellulases, glycosyl hydrolase, 99.84
1wcg_A 464 Thioglucosidase, myrosinase; aphid, beta-glucosida 99.83
3apg_A 473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 99.82
2xhy_A 479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 99.81
1vff_A 423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 99.78
1uhv_A 500 Beta-xylosidase; family 39 glycoside hydrolase, xy 97.7
1w91_A 503 Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 97.43
1fob_A 334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 96.92
3niy_A 341 Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.5 96.74
1nq6_A 302 XYS1; glycoside hydrolase family 10, xylanase, xyl 96.43
2c0h_A 353 Mannan endo-1,4-beta-mannosidase; hydrolase, signa 94.47
1ur1_A 378 Endoxylanase; hydrolase, family 10, glycoside hydr 93.2
1xyz_A 347 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrola 92.77
1h1n_A 305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 92.64
1ta3_B 303 Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), 92.5
3u7b_A 327 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 91.95
4ekj_A 500 Beta-xylosidase; TIM-barrel fold, hemicellulase, h 91.93
3cui_A 315 EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine 91.04
3emz_A 331 Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 ba 86.79
1n82_A 331 Xylanase, intra-cellular xylanase; hydrolase; 1.45 85.74
1i1w_A 303 Endo-1,4-beta-xylanase; xylan degradation, hydrola 85.72
3icg_A 515 Endoglucanase D; cellulase, xylanase, carbohydrate 85.55
3l55_A 353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 85.18
1w32_A 348 Endo-1,4-beta-xylanase A precursor; mutant, calciu 84.56
1rh9_A 373 Endo-beta-mannanase; endo-beta-mannase, retaining, 83.56
3aof_A 317 Endoglucanase; glycosyl hydrolase family 5, cellul 83.49
2dep_A 356 Xylanase B, thermostable celloxylanase; glycosidas 83.37
1vjz_A 341 Endoglucanase; TM1752, structural genomics, JCSG, 83.03
1ece_A 358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 82.86
3tty_A 675 Beta-GAL, beta-galactosidase; TIM barrel, glycosid 82.23
2d1z_A 436 Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en 82.12
1r85_A 379 Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A 80.81
4f8x_A 335 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 80.61
2yih_A 524 CEL44C, xyloglucanase; hydrolase, GH44, endo-gluca 80.48
3ayr_A 376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 80.27
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Back     alignment and structure
Probab=99.91  E-value=7.5e-26  Score=162.60  Aligned_cols=73  Identities=26%  Similarity=0.329  Sum_probs=68.3

Q ss_pred             eeecccceeCCCceeEEEEechhhhhh-cCCccccccceeeeeccchhhHHHhHHHHHHHHHHHHHHhhcCCCCCC
Q psy3005           5 VRCAHQVSCRPDQVKLWITINEPLEAM-QGYDFKTYAPYLSMTGVGGEYLAAHNMLRSHAKAYRLYEKKYKPSQKG   79 (79)
Q Consensus         5 ~ya~~v~~~fgd~V~~W~TfNEpn~~~-~~y~~g~~~p~~~~~~~~~~~~~~h~~~~Aha~a~~~~k~~~~~~~~g   79 (79)
                      .||++||++|||+||||+||||||+++ .||..|.+||+..+...  .+++.||+++||++|++++|+..|++|+|
T Consensus       152 ~YA~~~f~~fgdrVk~W~T~NEP~~~~~~gy~~G~~~Pg~~~~~~--~~~~~h~~llAha~Av~~~r~~~~~~~IG  225 (458)
T 3ta9_A          152 EYARLMFEEFNGLVDLWVTHNEPWVVAFEGHAFGNHAPGTKDFKT--ALQVAHHLLLSHGMAVDIFREEDLPGEIG  225 (458)
T ss_dssp             HHHHHHHHHTTTTCCEEEEEECHHHHHHHHHTSCCSTTCCCCHHH--HHHHHHHHHHHHHHHHHHHHHHTCSSEEE
T ss_pred             HHHHHHHHHhcCcCCEEEEecCcchhhcccccccccCCCcCCHHH--HHHHHHHHHHHHHHHHHHHHHhCCCCeEE
Confidence            589999999999999999999999999 99999999999777666  89999999999999999999999998886
>4b3l_A Beta-glucosidase; hydrolase, glycosidase, carbohydrate-active enzyme; 2.51A {Streptococcus pyogenes} PDB: 4b3k_A Back     alignment and structure
>4hz8_A Beta-glucosidase; BGLB,BGL, hydrolase, glycosid barrel, carbohydrate/sugar binding; HET: BGC; 1.14A {Uncultured bacterium} PDB: 4hz7_A* 4hz6_A* 3fj0_A* 3cmj_A 3fiz_A* 3fiy_A* Back     alignment and structure
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Back     alignment and structure
>4atd_A Raucaffricine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.10A {Rauvolfia serpentina} PDB: 4a3y_A 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Back     alignment and structure
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} SCOP: c.1.8.0 PDB: 4gze_A Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scr_A* 3scs_A* 3scp_A* 3scq_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Back     alignment and structure
>1uwi_A Beta-galactosidase; hydrolase, beta-glycosidase, glycosidase; 2.55A {Sulfolobus solfataricus} SCOP: c.1.8.4 PDB: 1gow_A Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Back     alignment and structure
>4ha4_A Beta-galactosidase; TIM barrel, beta-glycosidase, hydrolase; HET: GOL PG6; 1.37A {Acidilobus saccharovorans} PDB: 4ha3_A* 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 4eam_A 4ean_A Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Back     alignment and structure
>1uhv_A Beta-xylosidase; family 39 glycoside hydrolase, xylan, xylose, covalent glycosyl-enzyme intermediate; 2.10A {Thermoanaerobacterium saccharolyticum} SCOP: b.71.1.2 c.1.8.3 PDB: 1px8_A Back     alignment and structure
>1w91_A Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 2.2A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 2bs9_A 2bfg_A* Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>3niy_A Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.58A {Thermotoga petrophila rku-1} SCOP: c.1.8.3 PDB: 3nj3_A* 1vbr_A* 1vbu_A Back     alignment and structure
>1nq6_A XYS1; glycoside hydrolase family 10, xylanase, xylan degradation,, hydrolase; 1.78A {Streptomyces halstedii} SCOP: c.1.8.3 Back     alignment and structure
>2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 Back     alignment and structure
>1ur1_A Endoxylanase; hydrolase, family 10, glycoside hydrolase, hemicellulose, xylan degradation; HET: XYS AHR; 1.43A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uqy_A* 1uqz_A* 1ur2_A* 2cnc_A* Back     alignment and structure
>1xyz_A 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrolase, xylanase, family F/10 of glycosyl hydrolases, glycosyltransferase; 1.40A {Clostridium thermocellum} SCOP: c.1.8.3 Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Back     alignment and structure
>1ta3_B Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Emericella nidulans} SCOP: c.1.8.3 Back     alignment and structure
>3u7b_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA MAN; 1.94A {Fusarium oxysporum} Back     alignment and structure
>4ekj_A Beta-xylosidase; TIM-barrel fold, hemicellulase, hydrolase; 2.50A {Caulobacter vibrioides} Back     alignment and structure
>3cui_A EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine inhibitor, TIM barrel, cellulose degradation, glycosidase, hydrolase; HET: X4S; 1.50A {Cellulomonas fimi} PDB: 3cug_A* 3cuh_A* 3cuf_A* 3cuj_A* 1fh9_A* 1fh7_A 1fh8_A 1exp_A* 1fhd_A* 1j01_A* 2exo_A 2xyl_A 2his_A* Back     alignment and structure
>3emz_A Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 barrel, GH10 enzyme complex, hydrolase; HET: HXH; 2.08A {Bacillus SP} SCOP: c.1.8.3 PDB: 3emq_A* 3emc_A* Back     alignment and structure
>1n82_A Xylanase, intra-cellular xylanase; hydrolase; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 3mua_A* 2q8x_A* 3msd_A* 3msg_A* 3mui_A* 3ms8_A Back     alignment and structure
>1i1w_A Endo-1,4-beta-xylanase; xylan degradation, hydrolase, glycosidase, enzyme, ultra HIG resolution, cryo temperature, 1; HET: PCA; 0.89A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1i1x_A* 2bnj_A* 1gok_A 1gom_A 1goo_A 1goq_A* 1gor_A* 1k6a_A 3o2l_A 3nyd_A* 1tux_A 1b31_A 1b30_A 1b3v_A* 1b3w_A* 1b3x_A* 1b3y_A* 1b3z_A* 1bg4_A Back     alignment and structure
>1w32_A Endo-1,4-beta-xylanase A precursor; mutant, calcium ION, thermostable, glycosyle hydrolase, family 10, error prone PCR, hydrolase; 1.2A {Cellvibrio japonicus} SCOP: c.1.8.3 PDB: 1w2p_A 1w2v_A 1w3h_A 1clx_A 1e5n_A* 1xys_A Back     alignment and structure
>1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Back     alignment and structure
>2dep_A Xylanase B, thermostable celloxylanase; glycosidase, xylan degradation, family 10, structural genomics, NPPSFA; 1.80A {Clostridium stercorarium} Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Back     alignment and structure
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Back     alignment and structure
>3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* Back     alignment and structure
>2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A Back     alignment and structure
>1r85_A Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 1hiz_A* 1r87_A* 3mmd_A* 1r86_A Back     alignment and structure
>4f8x_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA; 1.47A {Penicillium canescens} Back     alignment and structure
>2yih_A CEL44C, xyloglucanase; hydrolase, GH44, endo-glucanase, carbohydrate-binding protei; HET: BGC; 1.70A {Paenibacillus polymyxa} PDB: 2yjq_A* 2ykk_A* 3zq9_A* Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 79
d1cbga_ 490 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 3e-06
d1wcga1 462 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid ( 3e-05
d1pbga_ 468 c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL 3e-05
d2j78a1 443 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga m 7e-05
d1vffa1 423 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyr 2e-04
d1e4mm_ 499 c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) { 2e-04
d1v02a_ 484 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 3e-04
d1e4ia_ 447 c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa 3e-04
d1ug6a_ 426 c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophi 8e-04
d1uwsa_ 489 c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus 0.001
d1gnxa_ 464 c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. 0.001
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Length = 490 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Family 1 of glycosyl hydrolase
domain: Plant beta-glucosidase (myrosinase)
species: Creeping white clover (Trifolium repens) [TaxId: 3899]

 Score = 40.6 bits (94), Expect = 3e-06
 Identities = 31/84 (36%), Positives = 40/84 (47%), Gaps = 11/84 (13%)

Query: 7   CAHQVSCRPDQVKLWITINEP-LEAMQGYDFKTYAPYLSMTGVGGE----------YLAA 55
                    D+VK WIT+NEP   +M  Y + T+AP      +             YLAA
Sbjct: 164 AELCFKEFGDRVKHWITLNEPWGVSMNAYAYGTFAPGRCSDWLKLNCTGGDSGREPYLAA 223

Query: 56  HNMLRSHAKAYRLYEKKYKPSQKG 79
           H  L +HA A RLY+ KY+ SQ G
Sbjct: 224 HYQLLAHAAAARLYKTKYQASQNG 247
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Length = 462 Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Length = 468 Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Length = 443 Back     information, alignment and structure
>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 423 Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Length = 499 Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Length = 484 Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Length = 447 Back     information, alignment and structure
>d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Length = 426 Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 489 Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Length = 464 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query79
d2j78a1 443 Beta-glucosidase A {Thermotoga maritima [TaxId: 23 99.89
d1e4ia_ 447 Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406 99.89
d1qoxa_ 449 Beta-glucosidase A {Bacillus circulans, subsp. alk 99.88
d1gnxa_ 464 Beta-glucosidase A {Streptomyces sp. [TaxId: 1931] 99.87
d1pbga_ 468 6-phospho-beta-D-galactosidase, PGAL {Lactococcus 99.87
d1e4mm_ 499 Plant beta-glucosidase (myrosinase) {White mustard 99.84
d1qvba_ 481 beta-Glycosidase {Archaeon Thermosphaera aggregans 99.84
d1v02a_ 484 Plant beta-glucosidase (myrosinase) {Sorghum bicol 99.84
d1uwsa_ 489 beta-Glycosidase {Archaeon Sulfolobus solfataricus 99.84
d1ug6a_ 426 Beta-glucosidase A {Thermus thermophilus [TaxId: 2 99.83
d1wcga1 462 Thioglucosidase {Cabbage aphid (Brevicoryne brassi 99.83
d1cbga_ 490 Plant beta-glucosidase (myrosinase) {Creeping whit 99.82
d1vffa1 423 Beta-glucosidase A {Archaeon Pyrococcus horikoshii 99.8
d1n82a_ 330 Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId 96.6
d1nq6a_ 302 Xylanase A, catalytic core {Streptomyces halstedii 96.51
d1vbua1 324 Xylanase {Thermotoga maritima [TaxId: 2336]} 96.26
d1v0la_ 302 Xylanase A, catalytic core {Streptomyces lividans 95.54
d1xyza_ 320 Xylanase {Clostridium thermocellum, XynZ [TaxId: 1 95.53
d1i1wa_ 303 Xylanase A, catalytic core {Thermoascus aurantiacu 94.47
d1fh9a_ 312 Xylanase A, catalytic core {Cellulomonas fimi [Tax 93.88
d1us3a2 364 Xylanase 10c {Cellvibrio japonicus [TaxId: 155077] 92.58
d1w32a_ 346 Xylanase A, catalytic core {Pseudomonas fluorescen 92.22
d1uhva2 346 Beta-D-xylosidase, catalytic domain {Thermoanaerob 91.83
d1ta3b_ 301 Xylanase A, catalytic core {Emericella nidulans (A 91.69
d1r85a_ 371 Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 86.18
d1ur1a_ 350 Xylanase {Cellvibrio mixtus [TaxId: 39650]} 81.85
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Family 1 of glycosyl hydrolase
domain: Beta-glucosidase A
species: Thermotoga maritima [TaxId: 2336]

Probab=99.89  E-value=3.7e-25  Score=155.31  Aligned_cols=73  Identities=32%  Similarity=0.437  Sum_probs=68.8

Q ss_pred             eeecccceeCCCceeEEEEechhhhhh-cCCccccccceeeeeccchhhHHHhHHHHHHHHHHHHHHhhcCCCCCC
Q psy3005           5 VRCAHQVSCRPDQVKLWITINEPLEAM-QGYDFKTYAPYLSMTGVGGEYLAAHNMLRSHAKAYRLYEKKYKPSQKG   79 (79)
Q Consensus         5 ~ya~~v~~~fgd~V~~W~TfNEpn~~~-~~y~~g~~~p~~~~~~~~~~~~~~h~~~~Aha~a~~~~k~~~~~~~~g   79 (79)
                      .||++|+++|||+|++|+||||||+++ .+|+.|.+||+..+...  .++++||+++||++|++++|+..++.|+|
T Consensus       143 ~Ya~~v~~~~gd~V~~w~TiNEP~~~~~~gy~~G~~pPg~~~~~~--~~~~~~n~l~AHa~A~~~~~~~~~~~~vG  216 (443)
T d2j78a1         143 EYSRVLFENFGDRVKNWITLNEPWVVAIVGHLYGVHAPGMRDIYV--AFRAVHNLLRAHARAVKVFRETVKDGKIG  216 (443)
T ss_dssp             HHHHHHHHHHTTTCCEEEEEECHHHHHHHHHTSCSSTTCCCCHHH--HHHHHHHHHHHHHHHHHHHHHHCTTCEEE
T ss_pred             HHHHHHHHHhCccccceEeccCceeEeecccccCcccccccchHH--HHHHHHHHHHHHHHHHHHhhhcccCCcee
Confidence            599999999999999999999999999 99999999999877777  89999999999999999999999988876
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Back     information, alignment and structure
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Back     information, alignment and structure
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Back     information, alignment and structure
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Back     information, alignment and structure
>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1n82a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]} Back     information, alignment and structure
>d1nq6a_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces halstedii [TaxId: 1944]} Back     information, alignment and structure
>d1vbua1 c.1.8.3 (A:517-840) Xylanase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v0la_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1xyza_ c.1.8.3 (A:) Xylanase {Clostridium thermocellum, XynZ [TaxId: 1515]} Back     information, alignment and structure
>d1i1wa_ c.1.8.3 (A:) Xylanase A, catalytic core {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d1fh9a_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi [TaxId: 1708]} Back     information, alignment and structure
>d1us3a2 c.1.8.3 (A:243-606) Xylanase 10c {Cellvibrio japonicus [TaxId: 155077]} Back     information, alignment and structure
>d1w32a_ c.1.8.3 (A:) Xylanase A, catalytic core {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1uhva2 c.1.8.3 (A:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]} Back     information, alignment and structure
>d1ta3b_ c.1.8.3 (B:) Xylanase A, catalytic core {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]} Back     information, alignment and structure
>d1r85a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]} Back     information, alignment and structure
>d1ur1a_ c.1.8.3 (A:) Xylanase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure