Psyllid ID: psy310
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 240 | ||||||
| 193636433 | 707 | PREDICTED: ATP-binding cassette sub-fami | 0.437 | 0.148 | 0.819 | 3e-43 | |
| 328718019 | 684 | PREDICTED: ATP-binding cassette sub-fami | 0.437 | 0.153 | 0.819 | 3e-43 | |
| 350403093 | 703 | PREDICTED: ATP-binding cassette sub-fami | 0.445 | 0.152 | 0.785 | 1e-41 | |
| 383861366 | 704 | PREDICTED: ATP-binding cassette sub-fami | 0.445 | 0.151 | 0.794 | 1e-41 | |
| 340728249 | 703 | PREDICTED: ATP-binding cassette sub-fami | 0.445 | 0.152 | 0.785 | 1e-41 | |
| 66506366 | 703 | PREDICTED: ATP-binding cassette sub-fami | 0.445 | 0.152 | 0.775 | 5e-41 | |
| 307197262 | 643 | ATP-binding cassette sub-family G member | 0.437 | 0.163 | 0.790 | 1e-40 | |
| 307184774 | 704 | ATP-binding cassette sub-family G member | 0.445 | 0.151 | 0.785 | 1e-40 | |
| 156550522 | 698 | PREDICTED: ATP-binding cassette sub-fami | 0.445 | 0.153 | 0.766 | 3e-40 | |
| 326371147 | 689 | ATP-binding cassette transporter subfami | 0.454 | 0.158 | 0.779 | 5e-40 |
| >gi|193636433|ref|XP_001950956.1| PREDICTED: ATP-binding cassette sub-family G member 4-like isoform 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 181 bits (459), Expect = 3e-43, Method: Compositional matrix adjust.
Identities = 86/105 (81%), Positives = 96/105 (91%)
Query: 42 KTILKSVSGRLRSGELTAIMGPSGAGKSTLLNILTGYKTSGTEGSITINGHERNLSQFRK 101
K ILKSVSGRLRSGELTAIMGPSGAGKSTLLNILTGYK SG +GSITINGHERNLSQFRK
Sbjct: 79 KNILKSVSGRLRSGELTAIMGPSGAGKSTLLNILTGYKCSGVKGSITINGHERNLSQFRK 138
Query: 102 LSCYIMQDNQLHANLTVEEAMNVATALKLGKDLTKAARKDVVRTL 146
LSCYIMQDNQLHANL+VEEAM VAT+LKLG D++K ++ V++ +
Sbjct: 139 LSCYIMQDNQLHANLSVEEAMQVATSLKLGSDISKDSKYQVIQEI 183
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328718019|ref|XP_003246360.1| PREDICTED: ATP-binding cassette sub-family G member 4-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|350403093|ref|XP_003486698.1| PREDICTED: ATP-binding cassette sub-family G member 4-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|383861366|ref|XP_003706157.1| PREDICTED: ATP-binding cassette sub-family G member 1-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|340728249|ref|XP_003402440.1| PREDICTED: ATP-binding cassette sub-family G member 4-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|66506366|ref|XP_397486.2| PREDICTED: ATP-binding cassette sub-family G member 4-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|307197262|gb|EFN78567.1| ATP-binding cassette sub-family G member 1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|307184774|gb|EFN71088.1| ATP-binding cassette sub-family G member 1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|156550522|ref|XP_001602320.1| PREDICTED: ATP-binding cassette sub-family G member 4-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|326371147|gb|ADZ56942.1| ATP-binding cassette transporter subfamily G [Bombyx mori] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 240 | ||||||
| FB|FBgn0025683 | 699 | CG3164 [Drosophila melanogaste | 0.433 | 0.148 | 0.759 | 3.3e-37 | |
| FB|FBgn0020762 | 832 | Atet "ABC transporter expresse | 0.5 | 0.144 | 0.6 | 5e-31 | |
| UNIPROTKB|I3LVB3 | 664 | ABCG1 "Uncharacterized protein | 0.425 | 0.153 | 0.575 | 1.5e-25 | |
| UNIPROTKB|E1BYW4 | 644 | ABCG1 "Uncharacterized protein | 0.425 | 0.158 | 0.575 | 4.9e-25 | |
| ZFIN|ZDB-GENE-070424-84 | 673 | abcg1 "ATP-binding cassette, s | 0.425 | 0.151 | 0.575 | 7e-25 | |
| MGI|MGI:107704 | 666 | Abcg1 "ATP-binding cassette, s | 0.425 | 0.153 | 0.566 | 1.4e-24 | |
| UNIPROTKB|G3V642 | 666 | Abcg1 "ATP-binding cassette, s | 0.425 | 0.153 | 0.566 | 1.4e-24 | |
| UNIPROTKB|E7ERE5 | 786 | ABCG1 "ATP-binding cassette su | 0.441 | 0.134 | 0.554 | 1.6e-24 | |
| UNIPROTKB|E9PGV9 | 824 | ABCG1 "ATP-binding cassette su | 0.441 | 0.128 | 0.554 | 1.8e-24 | |
| RGD|620294 | 666 | Abcg1 "ATP-binding cassette, s | 0.429 | 0.154 | 0.552 | 1.8e-24 |
| FB|FBgn0025683 CG3164 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 392 (143.0 bits), Expect = 3.3e-37, Sum P(2) = 3.3e-37
Identities = 79/104 (75%), Positives = 87/104 (83%)
Query: 40 NEKTILKSVSGRLRSGELTAIMGPSGAGKSTLLNILTGYKTSGTEGSITINGHERNLSQF 99
N KTILK VSGRLRSGELTAIMGPSGAGKSTLLNIL+GYKTS EGS+T+NG ERNLS F
Sbjct: 63 NAKTILKGVSGRLRSGELTAIMGPSGAGKSTLLNILSGYKTSSIEGSVTMNGAERNLSAF 122
Query: 100 RKLSCYIMQDNQLHANLTVEEAMNVATALKLGKDLTKAARKDVV 143
RKLS YIMQDNQLH NLTV+EAM VAT LKL K +K + ++
Sbjct: 123 RKLSAYIMQDNQLHGNLTVQEAMTVATNLKLSKKFSKPEKHSMI 166
|
|
| FB|FBgn0020762 Atet "ABC transporter expressed in trachea" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LVB3 ABCG1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BYW4 ABCG1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070424-84 abcg1 "ATP-binding cassette, sub-family G (WHITE), member 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:107704 Abcg1 "ATP-binding cassette, sub-family G (WHITE), member 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V642 Abcg1 "ATP-binding cassette, sub-family G (WHITE), member 1, isoform CRA_a" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7ERE5 ABCG1 "ATP-binding cassette sub-family G member 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PGV9 ABCG1 "ATP-binding cassette sub-family G member 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|620294 Abcg1 "ATP-binding cassette, subfamily G (WHITE), member 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 240 | |||
| cd03213 | 194 | cd03213, ABCG_EPDR, Eye pigment and drug resistanc | 1e-35 | |
| TIGR00955 | 617 | TIGR00955, 3a01204, The Eye Pigment Precursor Tran | 5e-31 | |
| cd03234 | 226 | cd03234, ABCG_White, White pigment protein homolog | 9e-24 | |
| COG1131 | 293 | COG1131, CcmA, ABC-type multidrug transport system | 1e-21 | |
| cd03232 | 192 | cd03232, ABCG_PDR_domain2, Second domain of the pl | 2e-21 | |
| COG1136 | 226 | COG1136, SalX, ABC-type antimicrobial peptide tran | 3e-20 | |
| cd03255 | 218 | cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse | 3e-19 | |
| TIGR00956 | 1394 | TIGR00956, 3a01205, Pleiotropic Drug Resistance (P | 6e-19 | |
| cd03230 | 173 | cd03230, ABC_DR_subfamily_A, ATP-binding cassette | 6e-18 | |
| cd03229 | 178 | cd03229, ABC_Class3, ATP-binding cassette domain o | 7e-18 | |
| cd03259 | 213 | cd03259, ABC_Carb_Solutes_like, ATP-binding casset | 1e-17 | |
| COG3842 | 352 | COG3842, PotA, ABC-type spermidine/putrescine tran | 9e-17 | |
| cd03225 | 211 | cd03225, ABC_cobalt_CbiO_domain1, First domain of | 2e-16 | |
| PLN03140 | 1470 | PLN03140, PLN03140, ABC transporter G family membe | 2e-16 | |
| cd03213 | 194 | cd03213, ABCG_EPDR, Eye pigment and drug resistanc | 4e-16 | |
| cd03224 | 222 | cd03224, ABC_TM1139_LivF_branched, ATP-binding cas | 4e-16 | |
| cd03256 | 241 | cd03256, ABC_PhnC_transporter, ATP-binding cassett | 5e-16 | |
| cd00267 | 157 | cd00267, ABC_ATPase, ATP-binding cassette transpor | 7e-16 | |
| cd03228 | 171 | cd03228, ABCC_MRP_Like, ATP-binding cassette domai | 1e-15 | |
| COG3840 | 231 | COG3840, ThiQ, ABC-type thiamine transport system, | 2e-15 | |
| PRK13548 | 258 | PRK13548, hmuV, hemin importer ATP-binding subunit | 4e-15 | |
| cd03261 | 235 | cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca | 4e-15 | |
| PLN03211 | 659 | PLN03211, PLN03211, ABC transporter G-25; Provisio | 5e-15 | |
| TIGR02673 | 214 | TIGR02673, FtsE, cell division ATP-binding protein | 5e-15 | |
| cd03263 | 220 | cd03263, ABC_subfamily_A, ATP-binding cassette dom | 7e-15 | |
| cd03264 | 211 | cd03264, ABC_drug_resistance_like, ABC-type multid | 2e-14 | |
| TIGR02315 | 243 | TIGR02315, ABC_phnC, phosphonate ABC transporter, | 3e-14 | |
| COG1126 | 240 | COG1126, GlnQ, ABC-type polar amino acid transport | 3e-14 | |
| cd03298 | 211 | cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin | 4e-14 | |
| cd03246 | 173 | cd03246, ABCC_Protease_Secretion, ATP-binding cass | 6e-14 | |
| cd03293 | 220 | cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c | 6e-14 | |
| COG1116 | 248 | COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon | 6e-14 | |
| TIGR00955 | 617 | TIGR00955, 3a01204, The Eye Pigment Precursor Tran | 1e-13 | |
| cd03226 | 205 | cd03226, ABC_cobalt_CbiO_domain2, Second domain of | 2e-13 | |
| COG1127 | 263 | COG1127, Ttg2A, ABC-type transport system involved | 2e-13 | |
| COG3638 | 258 | COG3638, COG3638, ABC-type phosphate/phosphonate t | 2e-13 | |
| COG3839 | 338 | COG3839, MalK, ABC-type sugar transport systems, A | 2e-13 | |
| COG1124 | 252 | COG1124, DppF, ABC-type dipeptide/oligopeptide/nic | 2e-13 | |
| COG1123 | 539 | COG1123, COG1123, ATPase components of various ABC | 2e-13 | |
| COG1118 | 345 | COG1118, CysA, ABC-type sulfate/molybdate transpor | 3e-13 | |
| PRK13548 | 258 | PRK13548, hmuV, hemin importer ATP-binding subunit | 5e-13 | |
| COG1122 | 235 | COG1122, CbiO, ABC-type cobalt transport system, A | 7e-13 | |
| COG2274 | 709 | COG2274, SunT, ABC-type bacteriocin/lantibiotic ex | 8e-13 | |
| PRK10771 | 232 | PRK10771, thiQ, thiamine transporter ATP-binding s | 8e-13 | |
| cd03233 | 202 | cd03233, ABCG_PDR_domain1, First domain of the ple | 9e-13 | |
| COG4988 | 559 | COG4988, CydD, ABC-type transport system involved | 1e-12 | |
| COG1120 | 258 | COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore | 1e-12 | |
| cd03235 | 213 | cd03235, ABC_Metallic_Cations, ATP-binding cassett | 1e-12 | |
| COG2884 | 223 | COG2884, FtsE, Predicted ATPase involved in cell d | 1e-12 | |
| TIGR01277 | 213 | TIGR01277, thiQ, thiamine ABC transporter, ATP-bin | 1e-12 | |
| cd03214 | 180 | cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind | 1e-12 | |
| PRK13539 | 207 | PRK13539, PRK13539, cytochrome c biogenesis protei | 1e-12 | |
| COG0410 | 237 | COG0410, LivF, ABC-type branched-chain amino acid | 2e-12 | |
| COG4181 | 228 | COG4181, COG4181, Predicted ABC-type transport sys | 2e-12 | |
| TIGR01978 | 243 | TIGR01978, sufC, FeS assembly ATPase SufC | 3e-12 | |
| COG1129 | 500 | COG1129, MglA, ABC-type sugar transport system, AT | 3e-12 | |
| COG4559 | 259 | COG4559, COG4559, ABC-type hemin transport system, | 4e-12 | |
| cd03262 | 213 | cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai | 4e-12 | |
| COG1135 | 339 | COG1135, AbcC, ABC-type metal ion transport system | 5e-12 | |
| cd03258 | 233 | cd03258, ABC_MetN_methionine_transporter, ATP-bind | 5e-12 | |
| TIGR03608 | 206 | TIGR03608, L_ocin_972_ABC, putative bacteriocin ex | 5e-12 | |
| PRK11174 | 588 | PRK11174, PRK11174, cysteine/glutathione ABC trans | 7e-12 | |
| cd03217 | 200 | cd03217, ABC_FeS_Assembly, ABC-type transport syst | 7e-12 | |
| TIGR02982 | 220 | TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi | 7e-12 | |
| cd03257 | 228 | cd03257, ABC_NikE_OppD_transporters, ATP-binding c | 8e-12 | |
| TIGR03797 | 686 | TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste | 9e-12 | |
| cd03216 | 163 | cd03216, ABC_Carb_Monos_I, First domain of the ATP | 9e-12 | |
| cd03292 | 214 | cd03292, ABC_FtsE_transporter, ATP-binding cassett | 1e-11 | |
| cd03219 | 236 | cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas | 1e-11 | |
| COG0396 | 251 | COG0396, sufC, Cysteine desulfurase activator ATPa | 1e-11 | |
| cd03300 | 232 | cd03300, ABC_PotA_N, ATP-binding cassette domain o | 1e-11 | |
| TIGR02857 | 529 | TIGR02857, CydD, thiol reductant ABC exporter, Cyd | 1e-11 | |
| COG1131 | 293 | COG1131, CcmA, ABC-type multidrug transport system | 2e-11 | |
| TIGR03265 | 353 | TIGR03265, PhnT2, putative 2-aminoethylphosphonate | 2e-11 | |
| COG4525 | 259 | COG4525, TauB, ABC-type taurine transport system, | 3e-11 | |
| COG1125 | 309 | COG1125, OpuBA, ABC-type proline/glycine betaine t | 4e-11 | |
| COG4604 | 252 | COG4604, CeuD, ABC-type enterochelin transport sys | 5e-11 | |
| COG1136 | 226 | COG1136, SalX, ABC-type antimicrobial peptide tran | 6e-11 | |
| COG1132 | 567 | COG1132, MdlB, ABC-type multidrug transport system | 6e-11 | |
| cd00267 | 157 | cd00267, ABC_ATPase, ATP-binding cassette transpor | 8e-11 | |
| cd03232 | 192 | cd03232, ABCG_PDR_domain2, Second domain of the pl | 1e-10 | |
| TIGR00956 | 1394 | TIGR00956, 3a01205, Pleiotropic Drug Resistance (P | 1e-10 | |
| TIGR00968 | 237 | TIGR00968, 3a0106s01, sulfate ABC transporter, ATP | 1e-10 | |
| cd03214 | 180 | cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind | 2e-10 | |
| cd03260 | 227 | cd03260, ABC_PstB_phosphate_transporter, ATP-bindi | 2e-10 | |
| cd03296 | 239 | cd03296, ABC_CysA_sulfate_importer, ATP-binding ca | 2e-10 | |
| PLN03140 | 1470 | PLN03140, PLN03140, ABC transporter G family membe | 3e-10 | |
| COG0411 | 250 | COG0411, LivG, ABC-type branched-chain amino acid | 3e-10 | |
| COG1121 | 254 | COG1121, ZnuC, ABC-type Mn/Zn transport systems, A | 3e-10 | |
| cd03251 | 234 | cd03251, ABCC_MsbA, ATP-binding cassette domain of | 3e-10 | |
| cd03225 | 211 | cd03225, ABC_cobalt_CbiO_domain1, First domain of | 4e-10 | |
| COG1123 | 539 | COG1123, COG1123, ATPase components of various ABC | 4e-10 | |
| TIGR01978 | 243 | TIGR01978, sufC, FeS assembly ATPase SufC | 4e-10 | |
| TIGR03864 | 236 | TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi | 4e-10 | |
| cd03255 | 218 | cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse | 5e-10 | |
| TIGR03411 | 242 | TIGR03411, urea_trans_UrtD, urea ABC transporter, | 5e-10 | |
| cd03217 | 200 | cd03217, ABC_FeS_Assembly, ABC-type transport syst | 6e-10 | |
| COG1119 | 257 | COG1119, ModF, ABC-type molybdenum transport syste | 6e-10 | |
| TIGR03740 | 223 | TIGR03740, galliderm_ABC, gallidermin-class lantib | 6e-10 | |
| cd03220 | 224 | cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon | 8e-10 | |
| PRK15439 | 510 | PRK15439, PRK15439, autoinducer 2 ABC transporter | 9e-10 | |
| cd03234 | 226 | cd03234, ABCG_White, White pigment protein homolog | 1e-09 | |
| cd03228 | 171 | cd03228, ABCC_MRP_Like, ATP-binding cassette domai | 1e-09 | |
| cd03261 | 235 | cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca | 1e-09 | |
| COG4559 | 259 | COG4559, COG4559, ABC-type hemin transport system, | 1e-09 | |
| COG0396 | 251 | COG0396, sufC, Cysteine desulfurase activator ATPa | 1e-09 | |
| COG4987 | 573 | COG4987, CydC, ABC-type transport system involved | 1e-09 | |
| cd03253 | 236 | cd03253, ABCC_ATM1_transporter, ATP-binding casset | 1e-09 | |
| cd03229 | 178 | cd03229, ABC_Class3, ATP-binding cassette domain o | 2e-09 | |
| TIGR02211 | 221 | TIGR02211, LolD_lipo_ex, lipoprotein releasing sys | 2e-09 | |
| cd03297 | 214 | cd03297, ABC_ModC_molybdenum_transporter, ATP-bind | 2e-09 | |
| cd03254 | 229 | cd03254, ABCC_Glucan_exporter_like, ATP-binding ca | 2e-09 | |
| TIGR03258 | 362 | TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans | 2e-09 | |
| cd03249 | 238 | cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett | 2e-09 | |
| TIGR03375 | 694 | TIGR03375, type_I_sec_LssB, type I secretion syste | 2e-09 | |
| cd03247 | 178 | cd03247, ABCC_cytochrome_bd, ATP-binding cassette | 2e-09 | |
| cd03218 | 232 | cd03218, ABC_YhbG, ATP-binding cassette component | 3e-09 | |
| cd03245 | 220 | cd03245, ABCC_bacteriocin_exporters, ATP-binding c | 3e-09 | |
| TIGR02868 | 530 | TIGR02868, CydC, thiol reductant ABC exporter, Cyd | 3e-09 | |
| COG4133 | 209 | COG4133, CcmA, ABC-type transport system involved | 4e-09 | |
| COG1127 | 263 | COG1127, Ttg2A, ABC-type transport system involved | 5e-09 | |
| COG0488 | 530 | COG0488, Uup, ATPase components of ABC transporter | 5e-09 | |
| cd03295 | 242 | cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas | 5e-09 | |
| cd03293 | 220 | cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c | 6e-09 | |
| cd03301 | 213 | cd03301, ABC_MalK_N, The N-terminal ATPase domain | 6e-09 | |
| COG1120 | 258 | COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore | 7e-09 | |
| COG4152 | 300 | COG4152, COG4152, ABC-type uncharacterized transpo | 8e-09 | |
| cd03230 | 173 | cd03230, ABC_DR_subfamily_A, ATP-binding cassette | 1e-08 | |
| COG1116 | 248 | COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon | 1e-08 | |
| cd03226 | 205 | cd03226, ABC_cobalt_CbiO_domain2, Second domain of | 1e-08 | |
| cd03235 | 213 | cd03235, ABC_Metallic_Cations, ATP-binding cassett | 1e-08 | |
| cd03268 | 208 | cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c | 1e-08 | |
| COG4674 | 249 | COG4674, COG4674, Uncharacterized ABC-type transpo | 1e-08 | |
| COG1134 | 249 | COG1134, TagH, ABC-type polysaccharide/polyol phos | 1e-08 | |
| cd03259 | 213 | cd03259, ABC_Carb_Solutes_like, ATP-binding casset | 2e-08 | |
| cd03246 | 173 | cd03246, ABCC_Protease_Secretion, ATP-binding cass | 2e-08 | |
| COG3839 | 338 | COG3839, MalK, ABC-type sugar transport systems, A | 2e-08 | |
| cd03219 | 236 | cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas | 2e-08 | |
| PRK11248 | 255 | PRK11248, tauB, taurine transporter ATP-binding su | 2e-08 | |
| PRK09452 | 375 | PRK09452, potA, putrescine/spermidine ABC transpor | 2e-08 | |
| cd03267 | 236 | cd03267, ABC_NatA_like, ATP-binding cassette domai | 2e-08 | |
| COG1137 | 243 | COG1137, YhbG, ABC-type (unclassified) transport s | 2e-08 | |
| COG4148 | 352 | COG4148, ModC, ABC-type molybdate transport system | 2e-08 | |
| TIGR00956 | 1394 | TIGR00956, 3a01205, Pleiotropic Drug Resistance (P | 3e-08 | |
| PLN03211 | 659 | PLN03211, PLN03211, ABC transporter G-25; Provisio | 3e-08 | |
| TIGR03608 | 206 | TIGR03608, L_ocin_972_ABC, putative bacteriocin ex | 3e-08 | |
| cd03216 | 163 | cd03216, ABC_Carb_Monos_I, First domain of the ATP | 3e-08 | |
| cd03260 | 227 | cd03260, ABC_PstB_phosphate_transporter, ATP-bindi | 3e-08 | |
| CHL00131 | 252 | CHL00131, ycf16, sulfate ABC transporter protein; | 3e-08 | |
| TIGR03410 | 230 | TIGR03410, urea_trans_UrtE, urea ABC transporter, | 3e-08 | |
| COG1117 | 253 | COG1117, PstB, ABC-type phosphate transport system | 4e-08 | |
| cd03299 | 235 | cd03299, ABC_ModC_like, ATP-binding cassette domai | 4e-08 | |
| cd03265 | 220 | cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist | 4e-08 | |
| PRK11607 | 377 | PRK11607, potG, putrescine transporter ATP-binding | 4e-08 | |
| TIGR02857 | 529 | TIGR02857, CydD, thiol reductant ABC exporter, Cyd | 5e-08 | |
| cd03269 | 210 | cd03269, ABC_putative_ATPase, ATP-binding cassette | 5e-08 | |
| COG1129 | 500 | COG1129, MglA, ABC-type sugar transport system, AT | 7e-08 | |
| COG1126 | 240 | COG1126, GlnQ, ABC-type polar amino acid transport | 8e-08 | |
| COG1101 | 263 | COG1101, PhnK, ABC-type uncharacterized transport | 8e-08 | |
| COG3845 | 501 | COG3845, COG3845, ABC-type uncharacterized transpo | 8e-08 | |
| cd03256 | 241 | cd03256, ABC_PhnC_transporter, ATP-binding cassett | 9e-08 | |
| COG4181 | 228 | COG4181, COG4181, Predicted ABC-type transport sys | 9e-08 | |
| TIGR03522 | 301 | TIGR03522, GldA_ABC_ATP, gliding motility-associat | 9e-08 | |
| cd03244 | 221 | cd03244, ABCC_MRP_domain2, ATP-binding cassette do | 9e-08 | |
| COG1124 | 252 | COG1124, DppF, ABC-type dipeptide/oligopeptide/nic | 1e-07 | |
| COG0410 | 237 | COG0410, LivF, ABC-type branched-chain amino acid | 1e-07 | |
| PRK09700 | 510 | PRK09700, PRK09700, D-allose transporter ATP-bindi | 1e-07 | |
| PRK10535 | 648 | PRK10535, PRK10535, macrolide transporter ATP-bind | 1e-07 | |
| cd03252 | 237 | cd03252, ABCC_Hemolysin, ATP-binding cassette doma | 1e-07 | |
| PRK11288 | 501 | PRK11288, araG, L-arabinose transporter ATP-bindin | 1e-07 | |
| TIGR01842 | 544 | TIGR01842, type_I_sec_PrtD, type I secretion syste | 1e-07 | |
| COG3842 | 352 | COG3842, PotA, ABC-type spermidine/putrescine tran | 2e-07 | |
| cd03224 | 222 | cd03224, ABC_TM1139_LivF_branched, ATP-binding cas | 2e-07 | |
| COG1122 | 235 | COG1122, CbiO, ABC-type cobalt transport system, A | 2e-07 | |
| TIGR03797 | 686 | TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste | 2e-07 | |
| CHL00131 | 252 | CHL00131, ycf16, sulfate ABC transporter protein; | 2e-07 | |
| TIGR01166 | 190 | TIGR01166, cbiO, cobalt transport protein ATP-bind | 2e-07 | |
| TIGR01189 | 198 | TIGR01189, ccmA, heme ABC exporter, ATP-binding pr | 2e-07 | |
| cd03221 | 144 | cd03221, ABCF_EF-3, ATP-binding cassette domain of | 2e-07 | |
| cd03231 | 201 | cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog | 2e-07 | |
| COG4618 | 580 | COG4618, ArpD, ABC-type protease/lipase transport | 2e-07 | |
| PRK13632 | 271 | PRK13632, cbiO, cobalt transporter ATP-binding sub | 2e-07 | |
| TIGR00972 | 247 | TIGR00972, 3a0107s01c2, phosphate ABC transporter, | 2e-07 | |
| PLN03140 | 1470 | PLN03140, PLN03140, ABC transporter G family membe | 3e-07 | |
| COG0411 | 250 | COG0411, LivG, ABC-type branched-chain amino acid | 3e-07 | |
| COG1119 | 257 | COG1119, ModF, ABC-type molybdenum transport syste | 3e-07 | |
| cd03220 | 224 | cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon | 3e-07 | |
| PRK13549 | 506 | PRK13549, PRK13549, xylose transporter ATP-binding | 3e-07 | |
| TIGR03864 | 236 | TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi | 4e-07 | |
| COG1134 | 249 | COG1134, TagH, ABC-type polysaccharide/polyol phos | 4e-07 | |
| cd03250 | 204 | cd03250, ABCC_MRP_domain1, ATP-binding cassette do | 4e-07 | |
| COG1123 | 539 | COG1123, COG1123, ATPase components of various ABC | 5e-07 | |
| COG1118 | 345 | COG1118, CysA, ABC-type sulfate/molybdate transpor | 5e-07 | |
| cd03257 | 228 | cd03257, ABC_NikE_OppD_transporters, ATP-binding c | 5e-07 | |
| COG4604 | 252 | COG4604, CeuD, ABC-type enterochelin transport sys | 5e-07 | |
| cd03296 | 239 | cd03296, ABC_CysA_sulfate_importer, ATP-binding ca | 5e-07 | |
| PRK10247 | 225 | PRK10247, PRK10247, putative ABC transporter ATP-b | 5e-07 | |
| COG3840 | 231 | COG3840, ThiQ, ABC-type thiamine transport system, | 6e-07 | |
| COG1121 | 254 | COG1121, ZnuC, ABC-type Mn/Zn transport systems, A | 6e-07 | |
| PRK03695 | 248 | PRK03695, PRK03695, vitamin B12-transporter ATPase | 6e-07 | |
| COG3638 | 258 | COG3638, COG3638, ABC-type phosphate/phosphonate t | 7e-07 | |
| COG0488 | 530 | COG0488, Uup, ATPase components of ABC transporter | 7e-07 | |
| COG4618 | 580 | COG4618, ArpD, ABC-type protease/lipase transport | 7e-07 | |
| COG4586 | 325 | COG4586, COG4586, ABC-type uncharacterized transpo | 7e-07 | |
| PRK11153 | 343 | PRK11153, metN, DL-methionine transporter ATP-bind | 7e-07 | |
| PRK09580 | 248 | PRK09580, sufC, cysteine desulfurase ATPase compon | 7e-07 | |
| PRK11300 | 255 | PRK11300, livG, leucine/isoleucine/valine transpor | 7e-07 | |
| PRK10895 | 241 | PRK10895, PRK10895, lipopolysaccharide ABC transpo | 7e-07 | |
| cd03233 | 202 | cd03233, ABCG_PDR_domain1, First domain of the ple | 8e-07 | |
| PRK13547 | 272 | PRK13547, hmuV, hemin importer ATP-binding subunit | 8e-07 | |
| COG1117 | 253 | COG1117, PstB, ABC-type phosphate transport system | 9e-07 | |
| PRK13639 | 275 | PRK13639, cbiO, cobalt transporter ATP-binding sub | 9e-07 | |
| PRK11174 | 588 | PRK11174, PRK11174, cysteine/glutathione ABC trans | 1e-06 | |
| COG4987 | 573 | COG4987, CydC, ABC-type transport system involved | 1e-06 | |
| COG0488 | 530 | COG0488, Uup, ATPase components of ABC transporter | 1e-06 | |
| PRK10247 | 225 | PRK10247, PRK10247, putative ABC transporter ATP-b | 1e-06 | |
| PRK09536 | 402 | PRK09536, btuD, corrinoid ABC transporter ATPase; | 1e-06 | |
| PRK10851 | 353 | PRK10851, PRK10851, sulfate/thiosulfate transporte | 1e-06 | |
| PRK11629 | 233 | PRK11629, lolD, lipoprotein transporter ATP-bindin | 1e-06 | |
| COG4619 | 223 | COG4619, COG4619, ABC-type uncharacterized transpo | 1e-06 | |
| PRK14247 | 250 | PRK14247, PRK14247, phosphate ABC transporter ATP- | 1e-06 | |
| cd03248 | 226 | cd03248, ABCC_TAP, ATP-binding cassette domain of | 1e-06 | |
| TIGR01188 | 302 | TIGR01188, drrA, daunorubicin resistance ABC trans | 1e-06 | |
| TIGR02770 | 230 | TIGR02770, nickel_nikD, nickel import ATP-binding | 1e-06 | |
| PRK10938 | 490 | PRK10938, PRK10938, putative molybdenum transport | 1e-06 | |
| TIGR02315 | 243 | TIGR02315, ABC_phnC, phosphonate ABC transporter, | 2e-06 | |
| COG4988 | 559 | COG4988, CydD, ABC-type transport system involved | 2e-06 | |
| PRK10535 | 648 | PRK10535, PRK10535, macrolide transporter ATP-bind | 2e-06 | |
| TIGR01842 | 544 | TIGR01842, type_I_sec_PrtD, type I secretion syste | 2e-06 | |
| PRK11264 | 250 | PRK11264, PRK11264, putative amino-acid ABC transp | 2e-06 | |
| PRK11831 | 269 | PRK11831, PRK11831, putative ABC transporter ATP-b | 2e-06 | |
| COG4136 | 213 | COG4136, COG4136, ABC-type uncharacterized transpo | 2e-06 | |
| COG4555 | 245 | COG4555, NatA, ABC-type Na+ transport system, ATPa | 2e-06 | |
| COG4608 | 268 | COG4608, AppF, ABC-type oligopeptide transport sys | 2e-06 | |
| pfam00005 | 119 | pfam00005, ABC_tran, ABC transporter | 2e-06 | |
| TIGR01184 | 230 | TIGR01184, ntrCD, nitrate transport ATP-binding su | 2e-06 | |
| cd03291 | 282 | cd03291, ABCC_CFTR1, ATP-binding cassette domain o | 2e-06 | |
| TIGR03873 | 256 | TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra | 2e-06 | |
| cd03263 | 220 | cd03263, ABC_subfamily_A, ATP-binding cassette dom | 3e-06 | |
| cd03298 | 211 | cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin | 3e-06 | |
| cd03262 | 213 | cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai | 3e-06 | |
| COG4525 | 259 | COG4525, TauB, ABC-type taurine transport system, | 3e-06 | |
| cd03247 | 178 | cd03247, ABCC_cytochrome_bd, ATP-binding cassette | 3e-06 | |
| TIGR01271 | 1490 | TIGR01271, CFTR_protein, cystic fibrosis transmemb | 3e-06 | |
| PRK13538 | 204 | PRK13538, PRK13538, cytochrome c biogenesis protei | 3e-06 | |
| PRK11160 | 574 | PRK11160, PRK11160, cysteine/glutathione ABC trans | 3e-06 | |
| PRK10771 | 232 | PRK10771, thiQ, thiamine transporter ATP-binding s | 4e-06 | |
| cd03248 | 226 | cd03248, ABCC_TAP, ATP-binding cassette domain of | 4e-06 | |
| PRK10419 | 268 | PRK10419, nikE, nickel transporter ATP-binding pro | 4e-06 | |
| TIGR02633 | 500 | TIGR02633, xylG, D-xylose ABC transporter, ATP-bin | 4e-06 | |
| PRK13647 | 274 | PRK13647, cbiO, cobalt transporter ATP-binding sub | 4e-06 | |
| TIGR01277 | 213 | TIGR01277, thiQ, thiamine ABC transporter, ATP-bin | 5e-06 | |
| cd03221 | 144 | cd03221, ABCF_EF-3, ATP-binding cassette domain of | 5e-06 | |
| PRK09580 | 248 | PRK09580, sufC, cysteine desulfurase ATPase compon | 5e-06 | |
| COG4167 | 267 | COG4167, SapF, ABC-type antimicrobial peptide tran | 5e-06 | |
| PRK10908 | 222 | PRK10908, PRK10908, cell division protein FtsE; Pr | 5e-06 | |
| TIGR02142 | 354 | TIGR02142, modC_ABC, molybdenum ABC transporter, A | 5e-06 | |
| PRK13634 | 290 | PRK13634, cbiO, cobalt transporter ATP-binding sub | 5e-06 | |
| PRK11231 | 255 | PRK11231, fecE, iron-dicitrate transporter ATP-bin | 5e-06 | |
| COG4178 | 604 | COG4178, COG4178, ABC-type uncharacterized transpo | 5e-06 | |
| TIGR00956 | 1394 | TIGR00956, 3a01205, Pleiotropic Drug Resistance (P | 6e-06 | |
| PRK13539 | 207 | PRK13539, PRK13539, cytochrome c biogenesis protei | 6e-06 | |
| cd03253 | 236 | cd03253, ABCC_ATM1_transporter, ATP-binding casset | 6e-06 | |
| TIGR02868 | 530 | TIGR02868, CydC, thiol reductant ABC exporter, Cyd | 6e-06 | |
| COG5265 | 497 | COG5265, ATM1, ABC-type transport system involved | 6e-06 | |
| COG0444 | 316 | COG0444, DppD, ABC-type dipeptide/oligopeptide/nic | 6e-06 | |
| COG1123 | 539 | COG1123, COG1123, ATPase components of various ABC | 7e-06 | |
| COG2274 | 709 | COG2274, SunT, ABC-type bacteriocin/lantibiotic ex | 7e-06 | |
| cd03300 | 232 | cd03300, ABC_PotA_N, ATP-binding cassette domain o | 7e-06 | |
| PRK03695 | 248 | PRK03695, PRK03695, vitamin B12-transporter ATPase | 7e-06 | |
| PRK14250 | 241 | PRK14250, PRK14250, phosphate ABC transporter ATP- | 7e-06 | |
| cd03251 | 234 | cd03251, ABCC_MsbA, ATP-binding cassette domain of | 9e-06 | |
| TIGR02211 | 221 | TIGR02211, LolD_lipo_ex, lipoprotein releasing sys | 9e-06 | |
| PRK11650 | 356 | PRK11650, ugpC, glycerol-3-phosphate transporter A | 9e-06 | |
| TIGR03265 | 353 | TIGR03265, PhnT2, putative 2-aminoethylphosphonate | 1e-05 | |
| TIGR00968 | 237 | TIGR00968, 3a0106s01, sulfate ABC transporter, ATP | 1e-05 | |
| COG4133 | 209 | COG4133, CcmA, ABC-type transport system involved | 1e-05 | |
| cd03268 | 208 | cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c | 1e-05 | |
| PRK11248 | 255 | PRK11248, tauB, taurine transporter ATP-binding su | 1e-05 | |
| TIGR01166 | 190 | TIGR01166, cbiO, cobalt transport protein ATP-bind | 1e-05 | |
| TIGR00972 | 247 | TIGR00972, 3a0107s01c2, phosphate ABC transporter, | 1e-05 | |
| cd03250 | 204 | cd03250, ABCC_MRP_domain1, ATP-binding cassette do | 1e-05 | |
| PRK10851 | 353 | PRK10851, PRK10851, sulfate/thiosulfate transporte | 1e-05 | |
| PRK11247 | 257 | PRK11247, ssuB, aliphatic sulfonates transport ATP | 1e-05 | |
| COG4598 | 256 | COG4598, HisP, ABC-type histidine transport system | 1e-05 | |
| PRK15112 | 267 | PRK15112, PRK15112, antimicrobial peptide ABC syst | 1e-05 | |
| PRK09984 | 262 | PRK09984, PRK09984, phosphonate/organophosphate es | 1e-05 | |
| TIGR02203 | 571 | TIGR02203, MsbA_lipidA, lipid A export permease/AT | 1e-05 | |
| PRK09493 | 240 | PRK09493, glnQ, glutamine ABC transporter ATP-bind | 1e-05 | |
| TIGR02324 | 224 | TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys | 1e-05 | |
| TIGR02673 | 214 | TIGR02673, FtsE, cell division ATP-binding protein | 2e-05 | |
| TIGR03411 | 242 | TIGR03411, urea_trans_UrtD, urea ABC transporter, | 2e-05 | |
| cd03254 | 229 | cd03254, ABCC_Glucan_exporter_like, ATP-binding ca | 2e-05 | |
| TIGR03258 | 362 | TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans | 2e-05 | |
| TIGR03375 | 694 | TIGR03375, type_I_sec_LssB, type I secretion syste | 2e-05 | |
| cd03218 | 232 | cd03218, ABC_YhbG, ATP-binding cassette component | 2e-05 | |
| cd03267 | 236 | cd03267, ABC_NatA_like, ATP-binding cassette domai | 2e-05 | |
| PRK11288 | 501 | PRK11288, araG, L-arabinose transporter ATP-bindin | 2e-05 | |
| PRK10938 | 490 | PRK10938, PRK10938, putative molybdenum transport | 2e-05 | |
| TIGR03719 | 552 | TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot | 2e-05 | |
| cd03266 | 218 | cd03266, ABC_NatA_sodium_exporter, ATP-binding cas | 2e-05 | |
| cd01854 | 211 | cd01854, YjeQ_EngC, Ribosomal interacting GTPase Y | 2e-05 | |
| TIGR00958 | 711 | TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) | 2e-05 | |
| TIGR02204 | 576 | TIGR02204, MsbA_rel, ABC transporter, permease/ATP | 2e-05 | |
| COG4138 | 248 | COG4138, BtuD, ABC-type cobalamin transport system | 2e-05 | |
| PRK14239 | 252 | PRK14239, PRK14239, phosphate transporter ATP-bind | 2e-05 | |
| cd03223 | 166 | cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset | 2e-05 | |
| PRK11614 | 237 | PRK11614, livF, leucine/isoleucine/valine transpor | 2e-05 | |
| cd03264 | 211 | cd03264, ABC_drug_resistance_like, ABC-type multid | 3e-05 | |
| TIGR03740 | 223 | TIGR03740, galliderm_ABC, gallidermin-class lantib | 3e-05 | |
| cd03245 | 220 | cd03245, ABCC_bacteriocin_exporters, ATP-binding c | 3e-05 | |
| cd03269 | 210 | cd03269, ABC_putative_ATPase, ATP-binding cassette | 3e-05 | |
| PRK13547 | 272 | PRK13547, hmuV, hemin importer ATP-binding subunit | 3e-05 | |
| cd01854 | 211 | cd01854, YjeQ_EngC, Ribosomal interacting GTPase Y | 3e-05 | |
| PRK13543 | 214 | PRK13543, PRK13543, cytochrome c biogenesis protei | 3e-05 | |
| PRK11144 | 352 | PRK11144, modC, molybdate transporter ATP-binding | 3e-05 | |
| PRK13637 | 287 | PRK13637, cbiO, cobalt transporter ATP-binding sub | 3e-05 | |
| TIGR01193 | 708 | TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t | 3e-05 | |
| PRK15439 | 510 | PRK15439, PRK15439, autoinducer 2 ABC transporter | 4e-05 | |
| cd03265 | 220 | cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist | 4e-05 | |
| PRK11264 | 250 | PRK11264, PRK11264, putative amino-acid ABC transp | 4e-05 | |
| PRK10619 | 257 | PRK10619, PRK10619, histidine/lysine/arginine/orni | 4e-05 | |
| COG4175 | 386 | COG4175, ProV, ABC-type proline/glycine betaine tr | 4e-05 | |
| pfam03193 | 161 | pfam03193, DUF258, Protein of unknown function, DU | 4e-05 | |
| pfam03193 | 161 | pfam03193, DUF258, Protein of unknown function, DU | 4e-05 | |
| PRK10789 | 569 | PRK10789, PRK10789, putative multidrug transporter | 4e-05 | |
| PRK10419 | 268 | PRK10419, nikE, nickel transporter ATP-binding pro | 5e-05 | |
| PRK11231 | 255 | PRK11231, fecE, iron-dicitrate transporter ATP-bin | 5e-05 | |
| PRK13633 | 280 | PRK13633, PRK13633, cobalt transporter ATP-binding | 5e-05 | |
| PRK14246 | 257 | PRK14246, PRK14246, phosphate ABC transporter ATP- | 5e-05 | |
| COG2884 | 223 | COG2884, FtsE, Predicted ATPase involved in cell d | 6e-05 | |
| COG0488 | 530 | COG0488, Uup, ATPase components of ABC transporter | 6e-05 | |
| cd03301 | 213 | cd03301, ABC_MalK_N, The N-terminal ATPase domain | 6e-05 | |
| TIGR02204 | 576 | TIGR02204, MsbA_rel, ABC transporter, permease/ATP | 6e-05 | |
| PRK11701 | 258 | PRK11701, phnK, phosphonate C-P lyase system prote | 6e-05 | |
| COG1132 | 567 | COG1132, MdlB, ABC-type multidrug transport system | 7e-05 | |
| COG3845 | 501 | COG3845, COG3845, ABC-type uncharacterized transpo | 7e-05 | |
| TIGR03522 | 301 | TIGR03522, GldA_ABC_ATP, gliding motility-associat | 7e-05 | |
| cd03231 | 201 | cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog | 7e-05 | |
| PRK11247 | 257 | PRK11247, ssuB, aliphatic sulfonates transport ATP | 7e-05 | |
| TIGR02324 | 224 | TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys | 7e-05 | |
| TIGR01187 | 325 | TIGR01187, potA, spermidine/putrescine ABC transpo | 7e-05 | |
| TIGR01257 | 2272 | TIGR01257, rim_protein, retinal-specific rim ABC t | 7e-05 | |
| COG1135 | 339 | COG1135, AbcC, ABC-type metal ion transport system | 8e-05 | |
| COG4674 | 249 | COG4674, COG4674, Uncharacterized ABC-type transpo | 8e-05 | |
| TIGR03410 | 230 | TIGR03410, urea_trans_UrtE, urea ABC transporter, | 8e-05 | |
| COG4619 | 223 | COG4619, COG4619, ABC-type uncharacterized transpo | 8e-05 | |
| PRK13641 | 287 | PRK13641, cbiO, cobalt transporter ATP-binding sub | 8e-05 | |
| cd03297 | 214 | cd03297, ABC_ModC_molybdenum_transporter, ATP-bind | 9e-05 | |
| PRK13538 | 204 | PRK13538, PRK13538, cytochrome c biogenesis protei | 9e-05 | |
| cd03266 | 218 | cd03266, ABC_NatA_sodium_exporter, ATP-binding cas | 9e-05 | |
| COG4138 | 248 | COG4138, BtuD, ABC-type cobalamin transport system | 9e-05 | |
| COG4172 | 534 | COG4172, COG4172, ABC-type uncharacterized transpo | 9e-05 | |
| TIGR03005 | 252 | TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB | 9e-05 | |
| PRK14236 | 272 | PRK14236, PRK14236, phosphate transporter ATP-bind | 9e-05 | |
| PRK13657 | 588 | PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra | 9e-05 | |
| TIGR01192 | 585 | TIGR01192, chvA, glucan exporter ATP-binding prote | 9e-05 | |
| cd03249 | 238 | cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett | 1e-04 | |
| PRK09452 | 375 | PRK09452, potA, putrescine/spermidine ABC transpor | 1e-04 | |
| COG1137 | 243 | COG1137, YhbG, ABC-type (unclassified) transport s | 1e-04 | |
| COG1101 | 263 | COG1101, PhnK, ABC-type uncharacterized transport | 1e-04 | |
| TIGR01189 | 198 | TIGR01189, ccmA, heme ABC exporter, ATP-binding pr | 1e-04 | |
| PRK09536 | 402 | PRK09536, btuD, corrinoid ABC transporter ATPase; | 1e-04 | |
| PRK11629 | 233 | PRK11629, lolD, lipoprotein transporter ATP-bindin | 1e-04 | |
| PRK11831 | 269 | PRK11831, PRK11831, putative ABC transporter ATP-b | 1e-04 | |
| COG4136 | 213 | COG4136, COG4136, ABC-type uncharacterized transpo | 1e-04 | |
| PRK14246 | 257 | PRK14246, PRK14246, phosphate ABC transporter ATP- | 1e-04 | |
| PRK11701 | 258 | PRK11701, phnK, phosphonate C-P lyase system prote | 1e-04 | |
| PRK14262 | 250 | PRK14262, PRK14262, phosphate ABC transporter ATP- | 1e-04 | |
| PRK10744 | 260 | PRK10744, pstB, phosphate transporter ATP-binding | 1e-04 | |
| smart00382 | 148 | smart00382, AAA, ATPases associated with a variety | 1e-04 | |
| PRK10762 | 501 | PRK10762, PRK10762, D-ribose transporter ATP bindi | 1e-04 | |
| PRK15134 | 529 | PRK15134, PRK15134, microcin C ABC transporter ATP | 1e-04 | |
| cd03258 | 233 | cd03258, ABC_MetN_methionine_transporter, ATP-bind | 2e-04 | |
| PRK09700 | 510 | PRK09700, PRK09700, D-allose transporter ATP-bindi | 2e-04 | |
| TIGR01188 | 302 | TIGR01188, drrA, daunorubicin resistance ABC trans | 2e-04 | |
| TIGR01184 | 230 | TIGR01184, ntrCD, nitrate transport ATP-binding su | 2e-04 | |
| PRK09493 | 240 | PRK09493, glnQ, glutamine ABC transporter ATP-bind | 2e-04 | |
| PRK10789 | 569 | PRK10789, PRK10789, putative multidrug transporter | 2e-04 | |
| PRK14236 | 272 | PRK14236, PRK14236, phosphate transporter ATP-bind | 2e-04 | |
| PRK10744 | 260 | PRK10744, pstB, phosphate transporter ATP-binding | 2e-04 | |
| PRK11308 | 327 | PRK11308, dppF, dipeptide transporter ATP-binding | 2e-04 | |
| PRK11176 | 582 | PRK11176, PRK11176, lipid transporter ATP-binding/ | 2e-04 | |
| PRK13914 | 481 | PRK13914, PRK13914, invasion associated secreted e | 2e-04 | |
| PRK11819 | 556 | PRK11819, PRK11819, putative ABC transporter ATP-b | 2e-04 | |
| TIGR02769 | 265 | TIGR02769, nickel_nikE, nickel import ATP-binding | 2e-04 | |
| cd03294 | 269 | cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette | 2e-04 | |
| PRK13536 | 340 | PRK13536, PRK13536, nodulation factor exporter sub | 2e-04 | |
| COG3845 | 501 | COG3845, COG3845, ABC-type uncharacterized transpo | 3e-04 | |
| cd03244 | 221 | cd03244, ABCC_MRP_domain2, ATP-binding cassette do | 3e-04 | |
| TIGR03873 | 256 | TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra | 3e-04 | |
| TIGR03269 | 520 | TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc | 3e-04 | |
| cd03215 | 182 | cd03215, ABC_Carb_Monos_II, Second domain of the A | 3e-04 | |
| COG4161 | 242 | COG4161, ArtP, ABC-type arginine transport system, | 3e-04 | |
| COG4615 | 546 | COG4615, PvdE, ABC-type siderophore export system, | 3e-04 | |
| PRK14235 | 267 | PRK14235, PRK14235, phosphate transporter ATP-bind | 3e-04 | |
| PRK13635 | 279 | PRK13635, cbiO, cobalt transporter ATP-binding sub | 3e-04 | |
| COG1125 | 309 | COG1125, OpuBA, ABC-type proline/glycine betaine t | 4e-04 | |
| cd03299 | 235 | cd03299, ABC_ModC_like, ATP-binding cassette domai | 4e-04 | |
| PRK11300 | 255 | PRK11300, livG, leucine/isoleucine/valine transpor | 4e-04 | |
| COG4608 | 268 | COG4608, AppF, ABC-type oligopeptide transport sys | 4e-04 | |
| PRK11160 | 574 | PRK11160, PRK11160, cysteine/glutathione ABC trans | 4e-04 | |
| PRK09984 | 262 | PRK09984, PRK09984, phosphonate/organophosphate es | 4e-04 | |
| TIGR00958 | 711 | TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) | 4e-04 | |
| TIGR03269 | 520 | TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc | 4e-04 | |
| COG4107 | 258 | COG4107, PhnK, ABC-type phosphonate transport syst | 4e-04 | |
| COG0486 | 454 | COG0486, ThdF, Predicted GTPase [General function | 4e-04 | |
| PRK01889 | 356 | PRK01889, PRK01889, GTPase RsgA; Reviewed | 4e-04 | |
| PRK01889 | 356 | PRK01889, PRK01889, GTPase RsgA; Reviewed | 4e-04 | |
| COG2401 | 593 | COG2401, COG2401, ABC-type ATPase fused to a predi | 4e-04 | |
| TIGR02323 | 253 | TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys | 4e-04 | |
| PRK05291 | 449 | PRK05291, trmE, tRNA modification GTPase TrmE; Rev | 4e-04 | |
| cd03289 | 275 | cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 | 4e-04 | |
| PRK11124 | 242 | PRK11124, artP, arginine transporter ATP-binding s | 4e-04 | |
| PRK10982 | 491 | PRK10982, PRK10982, galactose/methyl galaxtoside t | 5e-04 | |
| COG4778 | 235 | COG4778, PhnL, ABC-type phosphonate transport syst | 5e-04 | |
| PRK10584 | 228 | PRK10584, PRK10584, putative ABC transporter ATP-b | 5e-04 | |
| PRK13639 | 275 | PRK13639, cbiO, cobalt transporter ATP-binding sub | 6e-04 | |
| PRK14262 | 250 | PRK14262, PRK14262, phosphate ABC transporter ATP- | 6e-04 | |
| TIGR01186 | 363 | TIGR01186, proV, glycine betaine/L-proline transpo | 6e-04 | |
| PRK14264 | 305 | PRK14264, PRK14264, phosphate ABC transporter ATP- | 6e-04 | |
| PRK13409 | 590 | PRK13409, PRK13409, putative ATPase RIL; Provision | 6e-04 | |
| PRK13409 | 590 | PRK13409, PRK13409, putative ATPase RIL; Provision | 6e-04 | |
| TIGR00630 | 925 | TIGR00630, uvra, excinuclease ABC, A subunit | 6e-04 | |
| TIGR00630 | 925 | TIGR00630, uvra, excinuclease ABC, A subunit | 6e-04 | |
| PRK11650 | 356 | PRK11650, ugpC, glycerol-3-phosphate transporter A | 7e-04 | |
| COG4598 | 256 | COG4598, HisP, ABC-type histidine transport system | 7e-04 | |
| TIGR02203 | 571 | TIGR02203, MsbA_lipidA, lipid A export permease/AT | 7e-04 | |
| cd03223 | 166 | cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset | 7e-04 | |
| COG4107 | 258 | COG4107, PhnK, ABC-type phosphonate transport syst | 7e-04 | |
| PRK10584 | 228 | PRK10584, PRK10584, putative ABC transporter ATP-b | 7e-04 | |
| PRK09544 | 251 | PRK09544, znuC, high-affinity zinc transporter ATP | 7e-04 | |
| TIGR01288 | 303 | TIGR01288, nodI, ATP-binding ABC transporter famil | 7e-04 | |
| PRK14247 | 250 | PRK14247, PRK14247, phosphate ABC transporter ATP- | 8e-04 | |
| COG4555 | 245 | COG4555, NatA, ABC-type Na+ transport system, ATPa | 8e-04 | |
| PRK15064 | 530 | PRK15064, PRK15064, ABC transporter ATP-binding pr | 8e-04 | |
| PRK15064 | 530 | PRK15064, PRK15064, ABC transporter ATP-binding pr | 8e-04 | |
| PRK11432 | 351 | PRK11432, fbpC, ferric transporter ATP-binding sub | 8e-04 | |
| COG2401 | 593 | COG2401, COG2401, ABC-type ATPase fused to a predi | 9e-04 | |
| PLN03140 | 1470 | PLN03140, PLN03140, ABC transporter G family membe | 0.001 | |
| cd03292 | 214 | cd03292, ABC_FtsE_transporter, ATP-binding cassett | 0.001 | |
| PRK11607 | 377 | PRK11607, potG, putrescine transporter ATP-binding | 0.001 | |
| TIGR01271 | 1490 | TIGR01271, CFTR_protein, cystic fibrosis transmemb | 0.001 | |
| PRK14250 | 241 | PRK14250, PRK14250, phosphate ABC transporter ATP- | 0.001 | |
| TIGR03719 | 552 | TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot | 0.001 | |
| PRK14239 | 252 | PRK14239, PRK14239, phosphate transporter ATP-bind | 0.001 | |
| TIGR03005 | 252 | TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB | 0.001 | |
| PRK13657 | 588 | PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra | 0.001 | |
| TIGR02769 | 265 | TIGR02769, nickel_nikE, nickel import ATP-binding | 0.001 | |
| PRK13537 | 306 | PRK13537, PRK13537, nodulation ABC transporter Nod | 0.001 | |
| PRK14240 | 250 | PRK14240, PRK14240, phosphate transporter ATP-bind | 0.001 | |
| PRK00349 | 943 | PRK00349, uvrA, excinuclease ABC subunit A; Review | 0.001 | |
| cd04164 | 159 | cd04164, trmE, trmE is a tRNA modification GTPase | 0.001 | |
| PRK13636 | 283 | PRK13636, cbiO, cobalt transporter ATP-binding sub | 0.001 | |
| PRK13636 | 283 | PRK13636, cbiO, cobalt transporter ATP-binding sub | 0.001 | |
| COG1162 | 301 | COG1162, COG1162, Predicted GTPases [General funct | 0.001 | |
| COG1162 | 301 | COG1162, COG1162, Predicted GTPases [General funct | 0.001 | |
| PRK13540 | 200 | PRK13540, PRK13540, cytochrome c biogenesis protei | 0.001 | |
| PRK15079 | 331 | PRK15079, PRK15079, oligopeptide ABC transporter A | 0.001 | |
| PRK10253 | 265 | PRK10253, PRK10253, iron-enterobactin transporter | 0.001 | |
| TIGR03771 | 223 | TIGR03771, anch_rpt_ABC, anchored repeat-type ABC | 0.001 | |
| PRK10522 | 547 | PRK10522, PRK10522, multidrug transporter membrane | 0.001 | |
| PRK13649 | 280 | PRK13649, cbiO, cobalt transporter ATP-binding sub | 0.001 | |
| COG4148 | 352 | COG4148, ModC, ABC-type molybdate transport system | 0.002 | |
| cd03252 | 237 | cd03252, ABCC_Hemolysin, ATP-binding cassette doma | 0.002 | |
| COG4586 | 325 | COG4586, COG4586, ABC-type uncharacterized transpo | 0.002 | |
| TIGR01271 | 1490 | TIGR01271, CFTR_protein, cystic fibrosis transmemb | 0.002 | |
| PRK13634 | 290 | PRK13634, cbiO, cobalt transporter ATP-binding sub | 0.002 | |
| COG4178 | 604 | COG4178, COG4178, ABC-type uncharacterized transpo | 0.002 | |
| TIGR01192 | 585 | TIGR01192, chvA, glucan exporter ATP-binding prote | 0.002 | |
| smart00382 | 148 | smart00382, AAA, ATPases associated with a variety | 0.002 | |
| COG4778 | 235 | COG4778, PhnL, ABC-type phosphonate transport syst | 0.002 | |
| PRK09544 | 251 | PRK09544, znuC, high-affinity zinc transporter ATP | 0.002 | |
| PRK14240 | 250 | PRK14240, PRK14240, phosphate transporter ATP-bind | 0.002 | |
| cd03369 | 207 | cd03369, ABCC_NFT1, ATP-binding cassette domain 2 | 0.002 | |
| PRK10575 | 265 | PRK10575, PRK10575, iron-hydroxamate transporter A | 0.002 | |
| COG1245 | 591 | COG1245, COG1245, Predicted ATPase, RNase L inhibi | 0.002 | |
| COG1245 | 591 | COG1245, COG1245, Predicted ATPase, RNase L inhibi | 0.002 | |
| PRK13652 | 277 | PRK13652, cbiO, cobalt transporter ATP-binding sub | 0.002 | |
| PRK00098 | 298 | PRK00098, PRK00098, GTPase RsgA; Reviewed | 0.002 | |
| PRK00098 | 298 | PRK00098, PRK00098, GTPase RsgA; Reviewed | 0.002 | |
| PRK14261 | 253 | PRK14261, PRK14261, phosphate ABC transporter ATP- | 0.002 | |
| PRK14270 | 251 | PRK14270, PRK14270, phosphate ABC transporter ATP- | 0.002 | |
| PRK14238 | 271 | PRK14238, PRK14238, phosphate transporter ATP-bind | 0.002 | |
| PRK14268 | 258 | PRK14268, PRK14268, phosphate ABC transporter ATP- | 0.002 | |
| TIGR02982 | 220 | TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi | 0.003 | |
| PRK13647 | 274 | PRK13647, cbiO, cobalt transporter ATP-binding sub | 0.003 | |
| TIGR02142 | 354 | TIGR02142, modC_ABC, molybdenum ABC transporter, A | 0.003 | |
| COG4175 | 386 | COG4175, ProV, ABC-type proline/glycine betaine tr | 0.003 | |
| cd03294 | 269 | cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette | 0.003 | |
| PRK14235 | 267 | PRK14235, PRK14235, phosphate transporter ATP-bind | 0.003 | |
| TIGR02323 | 253 | TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys | 0.003 | |
| PRK13537 | 306 | PRK13537, PRK13537, nodulation ABC transporter Nod | 0.003 | |
| pfam01926 | 117 | pfam01926, MMR_HSR1, 50S ribosome-binding GTPase | 0.003 | |
| PRK15056 | 272 | PRK15056, PRK15056, manganese/iron transporter ATP | 0.003 | |
| TIGR03415 | 382 | TIGR03415, ABC_choXWV_ATP, choline ABC transporter | 0.003 | |
| cd03271 | 261 | cd03271, ABC_UvrA_II, ATP-binding cassette domain | 0.003 | |
| cd03271 | 261 | cd03271, ABC_UvrA_II, ATP-binding cassette domain | 0.003 | |
| PRK13549 | 506 | PRK13549, PRK13549, xylose transporter ATP-binding | 0.004 | |
| TIGR03719 | 552 | TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot | 0.004 | |
| TIGR03719 | 552 | TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot | 0.004 | |
| PRK10619 | 257 | PRK10619, PRK10619, histidine/lysine/arginine/orni | 0.004 | |
| PRK15134 | 529 | PRK15134, PRK15134, microcin C ABC transporter ATP | 0.004 | |
| PRK10253 | 265 | PRK10253, PRK10253, iron-enterobactin transporter | 0.004 | |
| PRK14249 | 251 | PRK14249, PRK14249, phosphate ABC transporter ATP- | 0.004 | |
| pfam13207 | 114 | pfam13207, AAA_17, AAA domain | 0.004 | |
| cd02019 | 69 | cd02019, NK, Nucleoside/nucleotide kinase (NK) is | 0.004 | |
| cd02019 | 69 | cd02019, NK, Nucleoside/nucleotide kinase (NK) is | 0.004 | |
| PRK11000 | 369 | PRK11000, PRK11000, maltose/maltodextrin transport | 0.004 | |
| PRK14258 | 261 | PRK14258, PRK14258, phosphate ABC transporter ATP- | 0.004 | |
| TIGR03796 | 710 | TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste | 0.004 | |
| PRK14254 | 285 | PRK14254, PRK14254, phosphate ABC transporter ATP- | 0.004 |
| >gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily | Back alignment and domain information |
|---|
Score = 124 bits (315), Expect = 1e-35
Identities = 47/89 (52%), Positives = 59/89 (66%), Gaps = 1/89 (1%)
Query: 42 KTILKSVSGRLRSGELTAIMGPSGAGKSTLLNILTGYKTS-GTEGSITINGHERNLSQFR 100
K +LK+VSG+ + GELTAIMGPSGAGKSTLLN L G +T G G + ING + FR
Sbjct: 22 KQLLKNVSGKAKPGELTAIMGPSGAGKSTLLNALAGRRTGLGVSGEVLINGRPLDKRSFR 81
Query: 101 KLSCYIMQDNQLHANLTVEEAMNVATALK 129
K+ Y+ QD+ LH LTV E + A L+
Sbjct: 82 KIIGYVPQDDILHPTLTVRETLMFAAKLR 110
|
ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR). DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus. Length = 194 |
| >gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein | Back alignment and domain information |
|---|
| >gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters | Back alignment and domain information |
|---|
| >gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein | Back alignment and domain information |
|---|
| >gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A | Back alignment and domain information |
|---|
| >gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems | Back alignment and domain information |
|---|
| >gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like | Back alignment and domain information |
|---|
| >gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system | Back alignment and domain information |
|---|
| >gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters | Back alignment and domain information |
|---|
| >gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents | Back alignment and domain information |
|---|
| >gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A | Back alignment and domain information |
|---|
| >gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters | Back alignment and domain information |
|---|
| >gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein | Back alignment and domain information |
|---|
| >gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system | Back alignment and domain information |
|---|
| >gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters | Back alignment and domain information |
|---|
| >gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters | Back alignment and domain information |
|---|
| >gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters | Back alignment and domain information |
|---|
| >gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter | Back alignment and domain information |
|---|
| >gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters | Back alignment and domain information |
|---|
| >gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system | Back alignment and domain information |
|---|
| >gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter | Back alignment and domain information |
|---|
| >gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters | Back alignment and domain information |
|---|
| >gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter | Back alignment and domain information |
|---|
| >gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system | Back alignment and domain information |
|---|
| >gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein | Back alignment and domain information |
|---|
| >gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system | Back alignment and domain information |
|---|
| >gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters | Back alignment and domain information |
|---|
| >gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents | Back alignment and domain information |
|---|
| >gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems | Back alignment and domain information |
|---|
| >gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters | Back alignment and domain information |
|---|
| >gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A | Back alignment and domain information |
|---|
| >gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters | Back alignment and domain information |
|---|
| >gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter | Back alignment and domain information |
|---|
| >gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like | Back alignment and domain information |
|---|
| >gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system | Back alignment and domain information |
|---|
| >gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA | Back alignment and domain information |
|---|
| >gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system | Back alignment and domain information |
|---|
| >gnl|CDD|214372 CHL00131, ycf16, sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter | Back alignment and domain information |
|---|
| >gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system | Back alignment and domain information |
|---|
| >gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter | Back alignment and domain information |
|---|
| >gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|214372 CHL00131, ycf16, sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F | Back alignment and domain information |
|---|
| >gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein | Back alignment and domain information |
|---|
| >gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system | Back alignment and domain information |
|---|
| >gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters | Back alignment and domain information |
|---|
| >gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter | Back alignment and domain information |
|---|
| >gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235150 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181965 PRK09580, sufC, cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters | Back alignment and domain information |
|---|
| >gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >gnl|CDD|182852 PRK10938, PRK10938, putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236997 PRK11831, PRK11831, putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter | Back alignment and domain information |
|---|
| >gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >gnl|CDD|213258 cd03291, ABCC_CFTR1, ATP-binding cassette domain of the cystic fibrosis transmembrane regulator, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A | Back alignment and domain information |
|---|
| >gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters | Back alignment and domain information |
|---|
| >gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >gnl|CDD|184125 PRK13538, PRK13538, cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F | Back alignment and domain information |
|---|
| >gnl|CDD|181965 PRK09580, sufC, cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|226637 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|182829 PRK10908, PRK10908, cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter | Back alignment and domain information |
|---|
| >gnl|CDD|235150 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|236947 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter | Back alignment and domain information |
|---|
| >gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|185067 PRK15112, PRK15112, antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA | Back alignment and domain information |
|---|
| >gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182852 PRK10938, PRK10938, putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter | Back alignment and domain information |
|---|
| >gnl|CDD|206747 cd01854, YjeQ_EngC, Ribosomal interacting GTPase YjeQ/EngC, a circularly permuted subfamily of the Ras GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|226622 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D | Back alignment and domain information |
|---|
| >gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter | Back alignment and domain information |
|---|
| >gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206747 cd01854, YjeQ_EngC, Ribosomal interacting GTPase YjeQ/EngC, a circularly permuted subfamily of the Ras GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|184129 PRK13543, PRK13543, cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182993 PRK11144, modC, molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|217416 pfam03193, DUF258, Protein of unknown function, DUF258 | Back alignment and domain information |
|---|
| >gnl|CDD|217416 pfam03193, DUF258, Protein of unknown function, DUF258 | Back alignment and domain information |
|---|
| >gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein | Back alignment and domain information |
|---|
| >gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system | Back alignment and domain information |
|---|
| >gnl|CDD|184125 PRK13538, PRK13538, cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter | Back alignment and domain information |
|---|
| >gnl|CDD|226622 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236997 PRK11831, PRK11831, putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter | Back alignment and domain information |
|---|
| >gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236898 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237555 PRK13914, PRK13914, invasion associated secreted endopeptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system | Back alignment and domain information |
|---|
| >gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system | Back alignment and domain information |
|---|
| >gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226968 COG4615, PvdE, ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237645 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter | Back alignment and domain information |
|---|
| >gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223561 COG0486, ThdF, Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|234988 PRK01889, PRK01889, GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234988 PRK01889, PRK01889, GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|225265 COG2401, COG2401, ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >gnl|CDD|235392 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|213256 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 of CFTR,subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227118 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233062 TIGR00630, uvra, excinuclease ABC, A subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233062 TIGR00630, uvra, excinuclease ABC, A subunit | Back alignment and domain information |
|---|
| >gnl|CDD|236947 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D | Back alignment and domain information |
|---|
| >gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237894 PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237894 PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225265 COG2401, COG2401, ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter | Back alignment and domain information |
|---|
| >gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234734 PRK00349, uvrA, excinuclease ABC subunit A; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|206727 cd04164, trmE, trmE is a tRNA modification GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224084 COG1162, COG1162, Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224084 COG1162, COG1162, Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|184127 PRK13540, PRK13540, cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185037 PRK15079, PRK15079, oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|236707 PRK10522, PRK10522, multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >gnl|CDD|227118 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234631 PRK00098, PRK00098, GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234631 PRK00098, PRK00098, GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system | Back alignment and domain information |
|---|
| >gnl|CDD|237645 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188317 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213238 cd03271, ABC_UvrA_II, ATP-binding cassette domain II of the excision repair protein UvrA | Back alignment and domain information |
|---|
| >gnl|CDD|213238 cd03271, ABC_UvrA_II, ATP-binding cassette domain II of the excision repair protein UvrA | Back alignment and domain information |
|---|
| >gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221983 pfam13207, AAA_17, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|238977 cd02019, NK, Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >gnl|CDD|238977 cd02019, NK, Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|237649 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 240 | |||
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 100.0 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 100.0 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 100.0 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 100.0 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 100.0 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 100.0 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 99.97 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 99.97 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 99.97 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 99.97 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 99.97 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 99.97 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 99.97 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 99.96 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 99.96 | |
| COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 99.96 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 99.96 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 99.95 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 99.95 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 99.95 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 99.95 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 99.95 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 99.95 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 99.94 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 99.94 | |
| COG1135 | 339 | AbcC ABC-type metal ion transport system, ATPase c | 99.94 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 99.94 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 99.94 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 99.93 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 99.93 | |
| COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 99.93 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 99.93 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 99.93 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 99.92 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 99.92 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 99.92 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 99.92 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 99.91 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 99.91 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 99.91 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 99.91 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 99.91 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 99.91 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 99.91 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 99.91 | |
| COG1137 | 243 | YhbG ABC-type (unclassified) transport system, ATP | 99.91 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 99.91 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 99.91 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 99.91 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 99.9 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 99.9 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 99.9 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 99.9 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 99.9 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 99.9 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 99.9 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 99.9 | |
| COG0411 | 250 | LivG ABC-type branched-chain amino acid transport | 99.9 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 99.9 | |
| TIGR01188 | 302 | drrA daunorubicin resistance ABC transporter ATP-b | 99.9 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 99.9 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 99.9 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 99.9 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 99.9 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 99.9 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 99.9 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 99.9 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 99.9 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 99.9 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 99.9 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 99.9 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 99.9 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 99.89 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 99.89 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 99.89 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 99.89 | |
| COG4152 | 300 | ABC-type uncharacterized transport system, ATPase | 99.89 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 99.89 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 99.89 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 99.89 | |
| COG0410 | 237 | LivF ABC-type branched-chain amino acid transport | 99.89 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 99.89 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 99.89 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 99.89 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 99.89 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 99.89 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 99.89 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 99.89 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 99.89 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 99.89 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 99.89 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 99.89 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 99.89 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 99.89 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 99.89 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 99.88 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 99.88 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.88 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 99.88 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 99.88 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 99.88 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 99.88 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 99.88 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 99.88 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 99.88 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 99.88 | |
| PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.88 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 99.88 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 99.88 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.88 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 99.88 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 99.88 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 99.88 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 99.88 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.87 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 99.87 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 99.87 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 99.87 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 99.87 | |
| PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 99.87 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 99.87 | |
| COG4181 | 228 | Predicted ABC-type transport system involved in ly | 99.87 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 99.87 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 99.87 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 99.87 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 99.87 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 99.87 | |
| PRK13636 | 283 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 99.87 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 99.87 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 99.87 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 99.87 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 99.87 | |
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 99.87 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 99.87 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 99.87 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 99.87 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 99.87 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| cd03300 | 232 | ABC_PotA_N PotA is an ABC-type transporter and the | 99.87 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 99.87 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 99.87 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 99.87 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 99.86 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 99.86 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 99.86 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 99.86 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.86 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 99.86 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 99.86 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 99.86 | |
| TIGR00968 | 237 | 3a0106s01 sulfate ABC transporter, ATP-binding pro | 99.86 | |
| TIGR03873 | 256 | F420-0_ABC_ATP proposed F420-0 ABC transporter, AT | 99.86 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 99.86 | |
| TIGR02142 | 354 | modC_ABC molybdenum ABC transporter, ATP-binding p | 99.86 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 99.86 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.86 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 99.86 | |
| PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.86 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 99.86 | |
| cd03299 | 235 | ABC_ModC_like Archeal protein closely related to M | 99.86 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.86 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 99.86 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 99.86 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 99.86 | |
| cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 99.86 | |
| PLN03211 | 659 | ABC transporter G-25; Provisional | 99.86 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 99.86 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 99.86 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.85 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.85 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 99.85 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.85 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 99.85 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.85 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 99.85 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 99.85 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 99.85 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.85 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.85 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 99.85 | |
| PRK11144 | 352 | modC molybdate transporter ATP-binding protein; Pr | 99.85 | |
| PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 99.85 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.85 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 99.85 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 99.85 | |
| COG4559 | 259 | ABC-type hemin transport system, ATPase component | 99.85 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 99.85 | |
| COG4598 | 256 | HisP ABC-type histidine transport system, ATPase c | 99.85 | |
| PRK14260 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 99.85 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 99.85 | |
| KOG0061|consensus | 613 | 99.85 | ||
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.85 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 99.85 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 99.84 | |
| PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.84 | |
| PRK14272 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.84 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 99.84 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 99.84 | |
| PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 99.84 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 99.84 | |
| TIGR00955 | 617 | 3a01204 The Eye Pigment Precursor Transporter (EPP | 99.84 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 99.84 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 99.84 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 99.84 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 99.84 | |
| TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 99.84 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 99.84 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.84 | |
| PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 99.84 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 99.84 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 99.84 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 99.84 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 99.84 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 99.83 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 99.83 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 99.83 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 99.83 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.83 | |
| PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 99.83 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 99.83 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 99.83 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 99.83 | |
| PRK14266 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.83 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 99.83 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 99.83 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 99.83 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 99.83 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 99.83 | |
| PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 99.83 | |
| COG4161 | 242 | ArtP ABC-type arginine transport system, ATPase co | 99.83 | |
| COG4604 | 252 | CeuD ABC-type enterochelin transport system, ATPas | 99.83 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 99.82 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 99.82 | |
| PRK14258 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 99.82 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 99.82 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 99.82 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 99.82 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 99.82 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 99.82 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 99.82 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 99.82 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 99.82 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 99.82 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 99.82 | |
| COG1119 | 257 | ModF ABC-type molybdenum transport system, ATPase | 99.82 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 99.82 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 99.82 | |
| cd03253 | 236 | ABCC_ATM1_transporter ATM1 is an ABC transporter t | 99.82 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 99.82 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 99.81 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 99.81 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 99.81 | |
| COG4136 | 213 | ABC-type uncharacterized transport system, ATPase | 99.81 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 99.81 | |
| PRK09580 | 248 | sufC cysteine desulfurase ATPase component; Review | 99.81 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 99.81 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 99.81 | |
| PRK03695 | 248 | vitamin B12-transporter ATPase; Provisional | 99.81 | |
| KOG0057|consensus | 591 | 99.8 | ||
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 99.8 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 99.8 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 99.8 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 99.8 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 99.8 | |
| cd03289 | 275 | ABCC_CFTR2 The CFTR subfamily domain 2. The cystic | 99.8 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 99.8 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 99.8 | |
| cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 99.8 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 99.8 | |
| COG4674 | 249 | Uncharacterized ABC-type transport system, ATPase | 99.79 | |
| COG0444 | 316 | DppD ABC-type dipeptide/oligopeptide/nickel transp | 99.79 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 99.79 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 99.79 | |
| TIGR03797 | 686 | NHPM_micro_ABC2 NHPM bacteriocin system ABC transp | 99.79 | |
| KOG0927|consensus | 614 | 99.79 | ||
| cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 99.79 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 99.78 | |
| PRK10535 | 648 | macrolide transporter ATP-binding /permease protei | 99.78 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 99.78 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 99.78 | |
| KOG0058|consensus | 716 | 99.78 | ||
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 99.78 | |
| TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 99.78 | |
| TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 99.78 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 99.78 | |
| TIGR02857 | 529 | CydD thiol reductant ABC exporter, CydD subunit. U | 99.78 | |
| PRK10790 | 592 | putative multidrug transporter membrane\ATP-bindin | 99.78 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 99.78 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 99.78 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 99.78 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 99.77 | |
| PRK11160 | 574 | cysteine/glutathione ABC transporter membrane/ATP- | 99.77 | |
| TIGR00958 | 711 | 3a01208 Conjugate Transporter-2 (CT2) Family prote | 99.77 | |
| TIGR01842 | 544 | type_I_sec_PrtD type I secretion system ABC transp | 99.77 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 99.77 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 99.77 | |
| PRK13657 | 588 | cyclic beta-1,2-glucan ABC transporter; Provisiona | 99.76 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 99.76 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 99.76 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 99.76 | |
| TIGR03375 | 694 | type_I_sec_LssB type I secretion system ATPase, Ls | 99.76 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 99.75 | |
| PRK13545 | 549 | tagH teichoic acids export protein ATP-binding sub | 99.75 | |
| COG4167 | 267 | SapF ABC-type antimicrobial peptide transport syst | 99.75 | |
| TIGR01192 | 585 | chvA glucan exporter ATP-binding protein. This mod | 99.75 | |
| TIGR02204 | 576 | MsbA_rel ABC transporter, permease/ATP-binding pro | 99.75 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 99.74 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 99.74 | |
| TIGR02203 | 571 | MsbA_lipidA lipid A export permease/ATP-binding pr | 99.74 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 99.74 | |
| TIGR01846 | 694 | type_I_sec_HlyB type I secretion system ABC transp | 99.74 | |
| COG4618 | 580 | ArpD ABC-type protease/lipase transport system, AT | 99.74 | |
| COG1101 | 263 | PhnK ABC-type uncharacterized transport system, AT | 99.74 | |
| KOG0065|consensus | 1391 | 99.74 | ||
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 99.74 | |
| COG4988 | 559 | CydD ABC-type transport system involved in cytochr | 99.74 | |
| PRK10789 | 569 | putative multidrug transporter membrane\ATP-bindin | 99.74 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 99.73 | |
| PRK15177 | 213 | Vi polysaccharide export ATP-binding protein VexC; | 99.73 | |
| TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 99.73 | |
| cd03291 | 282 | ABCC_CFTR1 The CFTR subfamily domain 1. The cystic | 99.73 | |
| KOG0055|consensus | 1228 | 99.72 | ||
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 99.72 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 99.72 | |
| TIGR00954 | 659 | 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA | 99.72 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 99.72 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 99.72 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 99.72 | |
| PRK10522 | 547 | multidrug transporter membrane component/ATP-bindi | 99.72 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 99.72 | |
| COG4148 | 352 | ModC ABC-type molybdate transport system, ATPase c | 99.71 | |
| TIGR01194 | 555 | cyc_pep_trnsptr cyclic peptide transporter. This m | 99.7 | |
| KOG0059|consensus | 885 | 99.7 | ||
| cd03236 | 255 | ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o | 99.69 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 99.69 | |
| COG4586 | 325 | ABC-type uncharacterized transport system, ATPase | 99.69 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 99.69 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 99.68 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 99.68 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 99.68 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 99.68 | |
| COG4107 | 258 | PhnK ABC-type phosphonate transport system, ATPase | 99.67 | |
| COG4987 | 573 | CydC ABC-type transport system involved in cytochr | 99.67 | |
| TIGR01187 | 325 | potA spermidine/putrescine ABC transporter ATP-bin | 99.67 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 99.67 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 99.67 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 99.65 | |
| KOG0055|consensus | 1228 | 99.65 | ||
| KOG0056|consensus | 790 | 99.65 | ||
| COG4778 | 235 | PhnL ABC-type phosphonate transport system, ATPase | 99.61 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 99.59 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 99.59 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 99.58 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 99.58 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 99.58 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 99.56 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 99.54 | |
| PRK00635 | 1809 | excinuclease ABC subunit A; Provisional | 99.53 | |
| KOG0054|consensus | 1381 | 99.52 | ||
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 99.52 | |
| KOG0066|consensus | 807 | 99.52 | ||
| KOG0062|consensus | 582 | 99.52 | ||
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 99.47 | |
| KOG0054|consensus | 1381 | 99.47 | ||
| COG4615 | 546 | PvdE ABC-type siderophore export system, fused ATP | 99.44 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 99.44 | |
| COG5265 | 497 | ATM1 ABC-type transport system involved in Fe-S cl | 99.43 | |
| cd03278 | 197 | ABC_SMC_barmotin Barmotin is a tight junction-asso | 99.38 | |
| COG4138 | 248 | BtuD ABC-type cobalamin transport system, ATPase c | 99.37 | |
| COG4178 | 604 | ABC-type uncharacterized transport system, permeas | 99.36 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 99.35 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 99.29 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 99.28 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 99.27 | |
| COG4559 | 259 | ABC-type hemin transport system, ATPase component | 99.27 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 99.26 | |
| COG1119 | 257 | ModF ABC-type molybdenum transport system, ATPase | 99.26 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 99.25 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 99.25 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 99.25 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 99.25 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 99.24 | |
| cd03270 | 226 | ABC_UvrA_I The excision repair protein UvrA domain | 99.24 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 99.24 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 99.24 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 99.24 | |
| COG0411 | 250 | LivG ABC-type branched-chain amino acid transport | 99.23 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 99.23 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 99.23 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 99.23 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 99.23 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 99.23 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 99.23 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 99.23 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 99.23 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 99.23 | |
| TIGR01188 | 302 | drrA daunorubicin resistance ABC transporter ATP-b | 99.22 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 99.22 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 99.22 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 99.22 | |
| COG0410 | 237 | LivF ABC-type branched-chain amino acid transport | 99.22 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 99.22 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 99.22 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 99.22 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 99.22 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 99.22 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 99.22 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 99.22 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 99.21 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 99.21 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 99.21 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 99.21 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 99.21 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 99.21 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 99.21 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 99.21 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 99.21 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 99.2 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 99.2 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 99.2 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 99.2 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 99.2 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 99.2 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 99.2 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 99.2 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 99.2 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 99.2 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 99.2 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 99.2 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 99.2 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 99.2 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 99.19 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 99.19 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 99.19 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 99.19 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 99.19 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 99.19 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 99.19 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 99.19 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 99.19 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 99.19 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 99.19 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 99.19 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 99.19 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 99.18 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 99.18 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 99.18 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 99.18 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 99.18 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 99.18 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 99.18 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 99.18 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 99.18 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 99.18 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 99.18 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 99.18 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 99.18 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 99.18 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 99.18 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 99.18 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 99.18 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.18 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 99.17 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 99.17 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.17 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.17 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 99.17 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 99.17 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 99.17 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 99.16 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 99.16 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 99.16 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 99.16 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 99.16 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 99.16 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 99.16 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 99.16 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.16 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.16 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.16 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 99.16 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 99.15 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 99.15 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.15 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 99.15 | |
| cd03272 | 243 | ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein | 99.15 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.15 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.15 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 99.15 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 99.15 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 99.14 |
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.6e-33 Score=261.08 Aligned_cols=94 Identities=32% Similarity=0.385 Sum_probs=80.6
Q ss_pred CCCceecCCCceeeeeeEEEEeCCCEEEEECCCCchHHHHHHHHhCCCCC-CCccEEEECCccCCch----hhhhhceEE
Q psy310 32 NTNNNCEPNEKTILKSVSGRLRSGELTAIMGPSGAGKSTLLNILTGYKTS-GTEGSITINGHERNLS----QFRKLSCYI 106 (240)
Q Consensus 32 ~~~~~~~~~~~~~L~~vsl~I~~Ge~vgLvG~NGSGKSTLLr~L~G~~~~-~~~G~V~v~g~~~~~~----~~~~~~g~v 106 (240)
-+|+++.++++++|+++||+|++||+++|+|||||||||||++|+|++++ |++|+|.++|.+.... ..++.++|+
T Consensus 8 ~~nl~~~~~~~~il~~isl~i~~Ge~~~l~G~nGsGKSTLl~~l~Gl~~~~~~~G~i~~~g~~~~~~~~~~~~~~~i~~v 87 (506)
T PRK13549 8 MKNITKTFGGVKALDNVSLKVRAGEIVSLCGENGAGKSTLMKVLSGVYPHGTYEGEIIFEGEELQASNIRDTERAGIAII 87 (506)
T ss_pred EeeeEEEeCCeEeecceeEEEeCCeEEEEECCCCCCHHHHHHHHhCCCCCCCCCeEEEECCEECCCCCHHHHHHCCeEEE
Confidence 46788899888999999999999999999999999999999999998554 4799999999876321 124569999
Q ss_pred cccccccccccHHHHHHHH
Q psy310 107 MQDNQLHANLTVEEAMNVA 125 (240)
Q Consensus 107 ~Q~~~~~~~ltv~e~l~~~ 125 (240)
+|++.+++.+++.|++.+.
T Consensus 88 ~q~~~~~~~~tv~e~l~~~ 106 (506)
T PRK13549 88 HQELALVKELSVLENIFLG 106 (506)
T ss_pred EeccccCCCCcHHHHhhhc
Confidence 9999888889999988764
|
|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03299 ABC_ModC_like Archeal protein closely related to ModC | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
|---|
| >PLN03211 ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11144 modC molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14260 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0061|consensus | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14272 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >PRK14266 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14258 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >PRK03695 vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >KOG0057|consensus | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >KOG0927|consensus | Back alignment and domain information |
|---|
| >cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >PRK10535 macrolide transporter ATP-binding /permease protein; Provisional | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0058|consensus | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >TIGR02857 CydD thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR01192 chvA glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
|---|
| >COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0065|consensus | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional | Back alignment and domain information |
|---|
| >TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 | Back alignment and domain information |
|---|
| >KOG0055|consensus | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01194 cyc_pep_trnsptr cyclic peptide transporter | Back alignment and domain information |
|---|
| >KOG0059|consensus | Back alignment and domain information |
|---|
| >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >KOG0055|consensus | Back alignment and domain information |
|---|
| >KOG0056|consensus | Back alignment and domain information |
|---|
| >COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00635 excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >KOG0054|consensus | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0066|consensus | Back alignment and domain information |
|---|
| >KOG0062|consensus | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >KOG0054|consensus | Back alignment and domain information |
|---|
| >COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function | Back alignment and domain information |
|---|
| >COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 240 | ||||
| 4g1u_C | 266 | X-Ray Structure Of The Bacterial Heme Transporter H | 2e-07 | ||
| 4g1u_C | 266 | X-Ray Structure Of The Bacterial Heme Transporter H | 5e-07 | ||
| 2pcj_A | 224 | Crystal Structure Of Abc Transporter (Aq_297) From | 8e-07 | ||
| 2hyd_A | 578 | Multidrug Abc Transporter Sav1866 Length = 578 | 1e-06 | ||
| 2it1_A | 362 | Structure Of Ph0203 Protein From Pyrococcus Horikos | 4e-06 | ||
| 3c41_J | 242 | Abc Protein Artp In Complex With Amp-PnpMG2+ Length | 6e-06 | ||
| 2olj_A | 263 | Abc Protein Artp In Complex With AdpMG2+ Length = 2 | 7e-06 | ||
| 3tif_A | 235 | Dimeric Structure Of A Post-Hydrolysis State Of The | 7e-06 | ||
| 3tif_A | 235 | Dimeric Structure Of A Post-Hydrolysis State Of The | 1e-04 | ||
| 1l2t_A | 235 | Dimeric Structure Of Mj0796, A Bacterial Abc Transp | 8e-06 | ||
| 1l2t_A | 235 | Dimeric Structure Of Mj0796, A Bacterial Abc Transp | 1e-04 | ||
| 1z47_A | 355 | Structure Of The Atpase Subunit Cysa Of The Putativ | 9e-06 | ||
| 2pzf_A | 228 | Minimal Human Cftr First Nucleotide Binding Domain | 9e-06 | ||
| 1xmj_A | 290 | Crystal Structure Of Human Deltaf508 Human Nbd1 Dom | 2e-05 | ||
| 3si7_A | 285 | The Crystal Structure Of The Nbd1 Domain Of The Mou | 2e-05 | ||
| 1xmi_A | 291 | Crystal Structure Of Human F508a Nbd1 Domain With A | 4e-05 | ||
| 3d31_A | 348 | Modbc From Methanosarcina Acetivorans Length = 348 | 5e-05 | ||
| 1xef_A | 241 | Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI | 5e-05 | ||
| 2ffa_A | 247 | Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr | 5e-05 | ||
| 1mt0_A | 241 | Atp-Binding Domain Of Haemolysin B From Escherichia | 5e-05 | ||
| 2pmk_A | 243 | Crystal Structures Of An Isolated Abc-Atpase In Com | 5e-05 | ||
| 2ff7_A | 247 | The Abc-Atpase Of The Abc-Transporter Hlyb In The A | 5e-05 | ||
| 2ffb_A | 247 | The Crystal Structure Of The Hlyb-Nbd E631q Mutant | 5e-05 | ||
| 3fvq_A | 359 | Crystal Structure Of The Nucleotide Binding Domain | 6e-05 | ||
| 4dbl_C | 249 | Crystal Structure Of E159q Mutant Of Btucdf Length | 7e-05 | ||
| 4dbl_C | 249 | Crystal Structure Of E159q Mutant Of Btucdf Length | 8e-04 | ||
| 4fi3_C | 249 | Structure Of Vitamin B12 Transporter Btucd-F In A N | 7e-05 | ||
| 4fi3_C | 249 | Structure Of Vitamin B12 Transporter Btucd-F In A N | 8e-04 | ||
| 2pzg_A | 241 | Minimal Human Cftr First Nucleotide Binding Domain | 7e-05 | ||
| 2pze_A | 229 | Minimal Human Cftr First Nucleotide Binding Domain | 9e-05 | ||
| 3b5j_A | 243 | Crystal Structures Of The S504a Mutant Of An Isolat | 1e-04 | ||
| 1xf9_A | 283 | Structure Of Nbd1 From Murine Cftr- F508s Mutant Le | 1e-04 | ||
| 2bbo_A | 291 | Human Nbd1 With Phe508 Length = 291 | 1e-04 | ||
| 1r0z_A | 286 | Phosphorylated Cystic Fibrosis Transmembrane Conduc | 1e-04 | ||
| 1xfa_A | 283 | Structure Of Nbd1 From Murine Cftr- F508r Mutant Le | 1e-04 | ||
| 1q3h_A | 286 | Mouse Cftr Nbd1 With Amp.Pnp Length = 286 | 1e-04 | ||
| 2yyz_A | 359 | Crystal Structure Of Sugar Abc Transporter, Atp-Bin | 1e-04 | ||
| 1f3o_A | 235 | Crystal Structure Of Mj0796 Atp-Binding Cassette Le | 1e-04 | ||
| 2d2e_A | 250 | Crystal Structure Of Atypical Cytoplasmic Abc-Atpas | 2e-04 | ||
| 2d2e_A | 250 | Crystal Structure Of Atypical Cytoplasmic Abc-Atpas | 2e-04 | ||
| 4hlu_D | 268 | Structure Of The Ecfa-a' Heterodimer Bound To Adp L | 2e-04 | ||
| 1oxx_K | 353 | Crystal Structure Of Glcv, The Abc-Atpase Of The Gl | 2e-04 | ||
| 2qi9_C | 249 | Abc-Transporter Btucd In Complex With Its Periplasm | 2e-04 | ||
| 1l7v_C | 249 | Bacterial Abc Transporter Involved In B12 Uptake Le | 2e-04 | ||
| 4f4c_A | 1321 | The Crystal Structure Of The Multi-Drug Transporter | 2e-04 | ||
| 1oxs_C | 353 | Crystal Structure Of Glcv, The Abc-Atpase Of The Gl | 2e-04 | ||
| 4ayt_A | 595 | Structure Of The Human Mitochondrial Abc Transporte | 2e-04 | ||
| 2bbt_A | 290 | Human Deltaf508 Nbd1 With Two Solublizing Mutations | 2e-04 | ||
| 2bbs_A | 290 | Human Deltaf508 Nbd1 With Three Solubilizing Mutati | 3e-04 | ||
| 3qf4_B | 598 | Crystal Structure Of A Heterodimeric Abc Transporte | 3e-04 | ||
| 4ayw_A | 619 | Structure Of The Human Mitochondrial Abc Transporte | 3e-04 | ||
| 1gaj_A | 257 | Crystal Structure Of A Nucleotide-Free Atp-Binding | 3e-04 | ||
| 1gaj_A | 257 | Crystal Structure Of A Nucleotide-Free Atp-Binding | 3e-04 | ||
| 1g6h_A | 257 | Crystal Structure Of The Adp Conformation Of Mj1267 | 3e-04 | ||
| 1g6h_A | 257 | Crystal Structure Of The Adp Conformation Of Mj1267 | 3e-04 | ||
| 1mv5_A | 243 | Crystal Structure Of Lmra Atp-Binding Domain Length | 3e-04 | ||
| 2r6g_A | 381 | The Crystal Structure Of The E. Coli Maltose Transp | 4e-04 | ||
| 1q12_A | 381 | Crystal Structure Of The Atp-bound E. Coli Malk Len | 4e-04 | ||
| 2ihy_A | 279 | Structure Of The Staphylococcus Aureus Putative Atp | 4e-04 | ||
| 1q1b_A | 381 | Crystal Structure Of E. Coli Malk In The Nucleotide | 4e-04 | ||
| 2d3w_A | 248 | Crystal Structure Of Escherichia Coli Sufc, An Atpa | 5e-04 | ||
| 2d3w_A | 248 | Crystal Structure Of Escherichia Coli Sufc, An Atpa | 8e-04 | ||
| 1vpl_A | 256 | Crystal Structure Of Abc Transporter Atp-binding Pr | 6e-04 | ||
| 1vpl_A | 256 | Crystal Structure Of Abc Transporter Atp-binding Pr | 6e-04 | ||
| 2zu0_C | 267 | Crystal Structure Of Sufc-Sufd Complex Involved In | 6e-04 | ||
| 2zu0_C | 267 | Crystal Structure Of Sufc-Sufd Complex Involved In | 9e-04 | ||
| 1g9x_A | 257 | Characterization Of The Twinning Structure Of Mj126 | 8e-04 | ||
| 1g9x_A | 257 | Characterization Of The Twinning Structure Of Mj126 | 8e-04 |
| >pdb|4G1U|C Chain C, X-Ray Structure Of The Bacterial Heme Transporter Hmuuv From Yersinia Pestis Length = 266 | Back alignment and structure |
|
| >pdb|4G1U|C Chain C, X-Ray Structure Of The Bacterial Heme Transporter Hmuuv From Yersinia Pestis Length = 266 | Back alignment and structure |
| >pdb|2PCJ|A Chain A, Crystal Structure Of Abc Transporter (Aq_297) From Aquifex Aeolicus Vf5 Length = 224 | Back alignment and structure |
| >pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 | Back alignment and structure |
| >pdb|2IT1|A Chain A, Structure Of Ph0203 Protein From Pyrococcus Horikoshii Length = 362 | Back alignment and structure |
| >pdb|3C41|J Chain J, Abc Protein Artp In Complex With Amp-PnpMG2+ Length = 242 | Back alignment and structure |
| >pdb|2OLJ|A Chain A, Abc Protein Artp In Complex With AdpMG2+ Length = 263 | Back alignment and structure |
| >pdb|3TIF|A Chain A, Dimeric Structure Of A Post-Hydrolysis State Of The Atp-Binding Cassette Mj0796 Bound To Adp And Pi Length = 235 | Back alignment and structure |
| >pdb|3TIF|A Chain A, Dimeric Structure Of A Post-Hydrolysis State Of The Atp-Binding Cassette Mj0796 Bound To Adp And Pi Length = 235 | Back alignment and structure |
| >pdb|1L2T|A Chain A, Dimeric Structure Of Mj0796, A Bacterial Abc Transporter Cassette Length = 235 | Back alignment and structure |
| >pdb|1L2T|A Chain A, Dimeric Structure Of Mj0796, A Bacterial Abc Transporter Cassette Length = 235 | Back alignment and structure |
| >pdb|1Z47|A Chain A, Structure Of The Atpase Subunit Cysa Of The Putative Sulfate Atp-Binding Cassette (Abc) Transporter From Alicyclobacillus Acidocaldarius Length = 355 | Back alignment and structure |
| >pdb|2PZF|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer With Delta F508 Length = 228 | Back alignment and structure |
| >pdb|1XMJ|A Chain A, Crystal Structure Of Human Deltaf508 Human Nbd1 Domain With Atp Length = 290 | Back alignment and structure |
| >pdb|3SI7|A Chain A, The Crystal Structure Of The Nbd1 Domain Of The Mouse Cftr Protein, Deltaf508 Mutant Length = 285 | Back alignment and structure |
| >pdb|1XMI|A Chain A, Crystal Structure Of Human F508a Nbd1 Domain With Atp Length = 291 | Back alignment and structure |
| >pdb|3D31|A Chain A, Modbc From Methanosarcina Acetivorans Length = 348 | Back alignment and structure |
| >pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 | Back alignment and structure |
| >pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 | Back alignment and structure |
| >pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 | Back alignment and structure |
| >pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 | Back alignment and structure |
| >pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 | Back alignment and structure |
| >pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 | Back alignment and structure |
| >pdb|3FVQ|A Chain A, Crystal Structure Of The Nucleotide Binding Domain Fbpc Complexed With Atp Length = 359 | Back alignment and structure |
| >pdb|4DBL|C Chain C, Crystal Structure Of E159q Mutant Of Btucdf Length = 249 | Back alignment and structure |
| >pdb|4DBL|C Chain C, Crystal Structure Of E159q Mutant Of Btucdf Length = 249 | Back alignment and structure |
| >pdb|4FI3|C Chain C, Structure Of Vitamin B12 Transporter Btucd-F In A Nucleotide-Bound State Length = 249 | Back alignment and structure |
| >pdb|4FI3|C Chain C, Structure Of Vitamin B12 Transporter Btucd-F In A Nucleotide-Bound State Length = 249 | Back alignment and structure |
| >pdb|2PZG|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Monomer Length = 241 | Back alignment and structure |
| >pdb|2PZE|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer Length = 229 | Back alignment and structure |
| >pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 | Back alignment and structure |
| >pdb|1XF9|A Chain A, Structure Of Nbd1 From Murine Cftr- F508s Mutant Length = 283 | Back alignment and structure |
| >pdb|2BBO|A Chain A, Human Nbd1 With Phe508 Length = 291 | Back alignment and structure |
| >pdb|1R0Z|A Chain A, Phosphorylated Cystic Fibrosis Transmembrane Conductance Regulator (Cftr) Nucleotide-Binding Domain One (Nbd1) With Atp Length = 286 | Back alignment and structure |
| >pdb|1XFA|A Chain A, Structure Of Nbd1 From Murine Cftr- F508r Mutant Length = 283 | Back alignment and structure |
| >pdb|1Q3H|A Chain A, Mouse Cftr Nbd1 With Amp.Pnp Length = 286 | Back alignment and structure |
| >pdb|2YYZ|A Chain A, Crystal Structure Of Sugar Abc Transporter, Atp-Binding Protein Length = 359 | Back alignment and structure |
| >pdb|1F3O|A Chain A, Crystal Structure Of Mj0796 Atp-Binding Cassette Length = 235 | Back alignment and structure |
| >pdb|2D2E|A Chain A, Crystal Structure Of Atypical Cytoplasmic Abc-Atpase Sufc From Thermus Thermophilus Hb8 Length = 250 | Back alignment and structure |
| >pdb|2D2E|A Chain A, Crystal Structure Of Atypical Cytoplasmic Abc-Atpase Sufc From Thermus Thermophilus Hb8 Length = 250 | Back alignment and structure |
| >pdb|4HLU|D Chain D, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 | Back alignment and structure |
| >pdb|1OXX|K Chain K, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 | Back alignment and structure |
| >pdb|2QI9|C Chain C, Abc-Transporter Btucd In Complex With Its Periplasmic Binding Protein Btuf Length = 249 | Back alignment and structure |
| >pdb|1L7V|C Chain C, Bacterial Abc Transporter Involved In B12 Uptake Length = 249 | Back alignment and structure |
| >pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 | Back alignment and structure |
| >pdb|1OXS|C Chain C, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 | Back alignment and structure |
| >pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 | Back alignment and structure |
| >pdb|2BBT|A Chain A, Human Deltaf508 Nbd1 With Two Solublizing Mutations. Length = 290 | Back alignment and structure |
| >pdb|2BBS|A Chain A, Human Deltaf508 Nbd1 With Three Solubilizing Mutations Length = 290 | Back alignment and structure |
| >pdb|3QF4|B Chain B, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 598 | Back alignment and structure |
| >pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 | Back alignment and structure |
| >pdb|1GAJ|A Chain A, Crystal Structure Of A Nucleotide-Free Atp-Binding Cassette From An Abc Transporter Length = 257 | Back alignment and structure |
| >pdb|1GAJ|A Chain A, Crystal Structure Of A Nucleotide-Free Atp-Binding Cassette From An Abc Transporter Length = 257 | Back alignment and structure |
| >pdb|1G6H|A Chain A, Crystal Structure Of The Adp Conformation Of Mj1267, An Atp- Binding Cassette Of An Abc Transporter Length = 257 | Back alignment and structure |
| >pdb|1G6H|A Chain A, Crystal Structure Of The Adp Conformation Of Mj1267, An Atp- Binding Cassette Of An Abc Transporter Length = 257 | Back alignment and structure |
| >pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 | Back alignment and structure |
| >pdb|2R6G|A Chain A, The Crystal Structure Of The E. Coli Maltose Transporter Length = 381 | Back alignment and structure |
| >pdb|1Q12|A Chain A, Crystal Structure Of The Atp-bound E. Coli Malk Length = 381 | Back alignment and structure |
| >pdb|2IHY|A Chain A, Structure Of The Staphylococcus Aureus Putative Atpase Subunit Of An Atp-Binding Cassette (Abc) Transporter Length = 279 | Back alignment and structure |
| >pdb|1Q1B|A Chain A, Crystal Structure Of E. Coli Malk In The Nucleotide-Free Form Length = 381 | Back alignment and structure |
| >pdb|2D3W|A Chain A, Crystal Structure Of Escherichia Coli Sufc, An Atpase Compenent Of The Suf Iron-Sulfur Cluster Assembly Machinery Length = 248 | Back alignment and structure |
| >pdb|2D3W|A Chain A, Crystal Structure Of Escherichia Coli Sufc, An Atpase Compenent Of The Suf Iron-Sulfur Cluster Assembly Machinery Length = 248 | Back alignment and structure |
| >pdb|1VPL|A Chain A, Crystal Structure Of Abc Transporter Atp-binding Protein (tm0544) From Thermotoga Maritima At 2.10 A Resolution Length = 256 | Back alignment and structure |
| >pdb|1VPL|A Chain A, Crystal Structure Of Abc Transporter Atp-binding Protein (tm0544) From Thermotoga Maritima At 2.10 A Resolution Length = 256 | Back alignment and structure |
| >pdb|2ZU0|C Chain C, Crystal Structure Of Sufc-Sufd Complex Involved In The Iron- Sulfur Cluster Biosynthesis Length = 267 | Back alignment and structure |
| >pdb|2ZU0|C Chain C, Crystal Structure Of Sufc-Sufd Complex Involved In The Iron- Sulfur Cluster Biosynthesis Length = 267 | Back alignment and structure |
| >pdb|1G9X|A Chain A, Characterization Of The Twinning Structure Of Mj1267, An Atp-Binding Cassette Of An Abc Transporter Length = 257 | Back alignment and structure |
| >pdb|1G9X|A Chain A, Characterization Of The Twinning Structure Of Mj1267, An Atp-Binding Cassette Of An Abc Transporter Length = 257 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 240 | |||
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 5e-16 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 2e-11 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 3e-14 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 3e-06 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 7e-14 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 5e-06 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 7e-14 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 3e-06 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 2e-13 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 2e-10 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 3e-13 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 5e-10 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 1e-12 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 2e-05 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 4e-12 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 5e-10 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 6e-12 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 6e-10 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 2e-11 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 2e-07 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 2e-11 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 3e-06 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 3e-11 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 4e-04 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 3e-11 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 3e-06 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 4e-11 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 2e-09 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 4e-11 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 1e-05 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 5e-11 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 2e-07 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 3e-10 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 1e-06 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 3e-10 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 1e-06 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 3e-10 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 7e-09 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 3e-06 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 7e-06 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 4e-10 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 3e-07 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 7e-10 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 3e-07 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 1e-09 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 6e-08 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 1e-09 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 2e-08 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 4e-06 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 6e-06 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 1e-09 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 1e-07 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 2e-09 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 5e-06 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 2e-09 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 3e-05 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 2e-09 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 4e-06 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 2e-09 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 5e-08 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 1e-04 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 3e-04 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 2e-09 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 9e-07 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 3e-09 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 4e-07 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 4e-06 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 2e-05 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 3e-09 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 9e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-07 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 9e-09 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 1e-08 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 2e-06 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 3e-05 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 1e-08 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 3e-05 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 1e-08 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 1e-06 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 4e-08 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 9e-06 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 5e-08 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 1e-07 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 4e-05 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 1e-07 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 2e-05 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 2e-07 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 4e-06 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 2e-07 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 2e-05 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 4e-05 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 1e-04 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 3e-07 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 4e-05 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 4e-07 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 4e-04 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 2e-06 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 3e-06 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 7e-04 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 3e-06 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 2e-05 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 4e-05 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 6e-05 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 6e-05 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 7e-05 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 8e-05 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 7e-05 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 7e-05 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 1e-04 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 9e-05 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 1e-04 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 2e-04 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 3e-04 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 4e-04 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 5e-04 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 5e-04 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 8e-04 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 9e-04 |
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 | Back alignment and structure |
|---|
Score = 73.7 bits (182), Expect = 5e-16
Identities = 33/131 (25%), Positives = 53/131 (40%), Gaps = 22/131 (16%)
Query: 41 EKTILKSVSGRLRSGELTAIMGPSGAGKSTLLNILTGYKTSGTEGSITINGHERNLSQF- 99
E T L +SG +R+GE+ ++GP+GAGKSTLL + G + +GSI G + L +
Sbjct: 12 ESTRLGPLSGEVRAGEILHLVGPNGAGKSTLLARMAGMTSG--KGSIQFAG--QPLEAWS 67
Query: 100 -----RKLSCYIMQDNQLHANLTVEEAMNVATALKLGKDLTKAARKDVVRTLFYRSDTNH 154
+ Y+ Q V + L R +++ + +
Sbjct: 68 ATKLALHRA-YLSQQQTPPFATPVWHY--LT----LH--QHDKTRTELLNDVAGALALDD 118
Query: 155 -AQRCF--LSG 162
R LSG
Sbjct: 119 KLGRSTNQLSG 129
|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Length = 250 | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Length = 250 | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Length = 267 | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Length = 267 | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Length = 262 | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Length = 262 | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Length = 263 | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Length = 263 | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Length = 359 | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Length = 372 | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Length = 372 | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Length = 358 | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Length = 358 | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Length = 301 | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Length = 301 | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Length = 381 | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Length = 302 | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Length = 302 | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Length = 307 | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Length = 307 | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Length = 413 | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Length = 413 | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Length = 972 | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Length = 916 | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Length = 670 | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Length = 842 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 240 | |||
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 99.94 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 99.94 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 99.93 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 99.93 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 99.93 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 99.93 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 99.93 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 99.93 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 99.93 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 99.93 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 99.93 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 99.93 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 99.93 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 99.93 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 99.93 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 99.92 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 99.92 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 99.92 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 99.92 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 99.92 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 99.92 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 99.92 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 99.91 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 99.91 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 99.91 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 99.91 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 99.91 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 99.9 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 99.9 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 99.9 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 99.89 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 99.89 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 99.89 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 99.88 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 99.88 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 99.88 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 99.88 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 99.87 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 99.87 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 99.86 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 99.86 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 99.85 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 99.84 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 99.82 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 99.82 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 99.82 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 99.81 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 99.81 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 99.8 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 99.79 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 99.74 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 99.74 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 99.72 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 99.72 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 99.7 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 99.69 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 99.65 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 99.59 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 99.58 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 99.55 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 99.4 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 99.36 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 99.35 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 99.32 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 99.32 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 99.31 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 99.31 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 99.3 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 99.3 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 99.3 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 99.3 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 99.3 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 99.29 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 99.29 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 99.29 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 99.28 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 99.27 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 99.27 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 99.27 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 99.27 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 99.27 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 99.27 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 99.26 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 99.26 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 99.26 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 99.25 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 99.25 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 99.24 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 99.24 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 99.24 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 99.23 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 99.23 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 99.22 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 99.21 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 99.21 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 99.2 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 99.2 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 99.19 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 99.19 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 99.19 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 99.19 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 99.18 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 99.18 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 99.17 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 99.16 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 99.16 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 99.15 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 99.15 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 99.15 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 99.15 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 99.14 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 99.14 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 99.14 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 99.13 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 99.12 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 99.11 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 99.1 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 99.09 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 99.09 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 99.08 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 99.08 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 99.07 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 99.03 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 99.03 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 99.02 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 99.02 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 99.01 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 99.0 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 99.0 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 98.99 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 98.99 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 98.98 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 98.98 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 98.97 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 98.97 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 98.96 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 98.96 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 98.94 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 98.93 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 98.93 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 98.93 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 98.92 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 98.92 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 98.91 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 98.88 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 98.87 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 98.87 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 98.86 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 98.86 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 98.85 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 98.84 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 98.84 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 98.81 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 98.81 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 98.8 | |
| 1qhl_A | 227 | Protein (cell division protein MUKB); SMC, chromos | 98.8 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 98.78 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 98.75 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 98.75 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 98.75 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 98.71 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 98.7 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 98.69 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 98.69 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 98.69 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 98.69 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 98.69 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 98.68 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 98.67 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 98.65 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 98.64 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 98.64 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 98.63 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 98.62 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 98.61 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 98.6 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 98.59 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 98.59 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 98.58 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 98.58 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 98.58 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 98.57 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 98.56 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 98.55 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 98.54 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 98.53 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 98.53 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 98.53 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 98.53 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 98.52 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 98.52 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 98.51 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 98.5 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 98.49 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 98.48 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 98.48 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 98.46 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 98.45 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 98.45 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 98.44 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 98.44 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 98.44 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 98.43 | |
| 2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 98.42 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 98.42 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 98.41 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 98.41 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 98.41 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 98.4 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 98.4 | |
| 1e69_A | 322 | Chromosome segregation SMC protein; structural mai | 98.4 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 98.39 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 98.38 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 98.37 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 98.36 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 98.36 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 98.34 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 98.33 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 98.33 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 98.32 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 98.32 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 98.29 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 98.27 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 98.27 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 98.25 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 98.25 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 98.25 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 98.25 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 98.25 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 98.24 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 98.23 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 98.22 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 98.22 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 98.22 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 98.22 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 98.22 | |
| 2o5v_A | 359 | DNA replication and repair protein RECF; ABC ATPas | 98.21 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 98.21 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 98.21 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 98.2 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 98.19 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 98.18 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 98.18 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 98.18 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 98.16 | |
| 2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 98.16 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 98.16 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 98.15 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 98.14 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 98.14 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 98.14 | |
| 2o5v_A | 359 | DNA replication and repair protein RECF; ABC ATPas | 98.13 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 98.13 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 98.13 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 98.13 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 98.13 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 98.11 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 98.11 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 98.1 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 98.09 | |
| 1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 98.08 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 98.08 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 98.07 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 98.07 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 98.06 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 98.05 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 98.03 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 98.03 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 98.03 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 98.01 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 98.0 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 98.0 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 97.99 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 97.97 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 97.97 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 97.96 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 97.96 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 97.96 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 97.95 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 97.95 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 97.95 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 97.94 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 97.94 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 97.94 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 97.93 | |
| 4ad8_A | 517 | DNA repair protein RECN; DNA binding protein, ATPa | 97.92 | |
| 1qhl_A | 227 | Protein (cell division protein MUKB); SMC, chromos | 97.92 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 97.91 | |
| 1e69_A | 322 | Chromosome segregation SMC protein; structural mai | 97.91 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 97.9 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 97.88 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 97.85 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 97.85 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 97.84 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 97.83 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 97.83 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 97.81 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 97.79 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 97.79 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 97.77 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 97.77 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 97.77 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 97.77 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 97.76 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 97.76 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 97.75 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 97.75 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 97.74 | |
| 3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 97.73 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 97.73 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 97.72 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 97.7 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 97.7 | |
| 3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 97.68 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 97.67 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 97.66 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 97.66 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 97.66 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 97.65 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 97.65 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 97.65 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 97.64 | |
| 1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 97.63 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 97.61 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 97.59 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 97.58 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 97.57 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 97.57 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 97.56 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 97.55 | |
| 4ad8_A | 517 | DNA repair protein RECN; DNA binding protein, ATPa | 97.53 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 97.53 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 97.52 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 97.51 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 97.5 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 97.49 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 97.48 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 97.47 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 97.47 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 97.47 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 97.44 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 97.44 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 97.43 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 97.42 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 97.41 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 97.4 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 97.4 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 97.38 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 97.37 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 97.36 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 97.36 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 97.35 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 97.34 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 97.34 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 97.34 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 97.33 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 97.32 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 97.32 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 97.32 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 97.3 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 97.3 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 97.26 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 97.25 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 97.25 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 97.24 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 97.23 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 97.23 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 97.22 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 97.21 | |
| 2ohf_A | 396 | Protein OLA1, GTP-binding protein 9; ATPase, GTPas | 97.2 | |
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 97.19 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 97.18 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 97.18 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 97.17 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 97.17 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 97.15 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.15 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 97.14 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 97.13 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 97.13 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 97.13 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 97.12 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 97.12 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 97.1 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 97.09 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 97.09 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 97.09 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 97.08 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 97.07 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 97.06 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 97.04 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 97.04 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 97.03 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 97.01 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 97.01 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 97.0 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 97.0 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 96.98 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 96.97 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 96.97 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 96.97 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 96.96 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 96.94 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 96.94 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 96.94 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 96.9 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 96.9 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 96.89 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 96.87 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 96.87 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 96.86 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 96.86 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 96.86 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 96.86 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 96.85 | |
| 2ohf_A | 396 | Protein OLA1, GTP-binding protein 9; ATPase, GTPas | 96.84 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 96.84 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 96.81 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 96.8 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 96.78 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 96.78 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 96.77 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 96.77 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 96.77 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 96.76 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 96.75 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 96.74 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 96.73 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 96.73 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 96.73 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 96.72 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 96.72 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 96.72 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 96.72 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 96.71 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 96.7 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 96.69 | |
| 1ko7_A | 314 | HPR kinase/phosphatase; protein kinase, phosphotra | 96.69 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 96.67 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 96.67 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 96.66 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 96.66 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 96.65 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 96.65 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 96.65 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 96.65 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 96.64 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 96.64 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 96.64 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 96.64 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 96.63 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 96.63 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 96.62 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 96.62 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 96.62 | |
| 3b1v_A | 272 | Ferrous iron uptake transporter protein B; G prote | 96.61 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 96.6 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 96.6 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 96.59 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 96.58 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 96.58 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 96.58 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 96.58 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 96.57 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 96.57 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 96.57 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 96.56 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 96.56 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 96.56 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 96.56 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 96.56 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 96.56 | |
| 1jal_A | 363 | YCHF protein; nucleotide-binding fold, structural | 96.55 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 96.55 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 96.54 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 96.54 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 96.53 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 96.53 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 96.52 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 96.52 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 96.52 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 96.52 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 96.52 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 96.51 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 96.51 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 96.51 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 96.51 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 96.5 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 96.48 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 96.48 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 96.47 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 96.46 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 96.46 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 96.46 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 96.46 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 96.45 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 96.45 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 96.45 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 96.44 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 96.43 |
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
Probab=99.94 E-value=3.5e-26 Score=207.08 Aligned_cols=144 Identities=22% Similarity=0.251 Sum_probs=125.0
Q ss_pred CCceecCCCceeeeeeEEEEeCCCEEEEECCCCchHHHHHHHHhCCCCCCCccEEEECCccCC-chhhhhhceEEccccc
Q psy310 33 TNNNCEPNEKTILKSVSGRLRSGELTAIMGPSGAGKSTLLNILTGYKTSGTEGSITINGHERN-LSQFRKLSCYIMQDNQ 111 (240)
Q Consensus 33 ~~~~~~~~~~~~L~~vsl~I~~Ge~vgLvG~NGSGKSTLLr~L~G~~~~~~~G~V~v~g~~~~-~~~~~~~~g~v~Q~~~ 111 (240)
+|+.+.|++..+|+++||+|++||+++|+||||||||||||+|+|+ .+|++|+|.++|.++. ....++.++||||++.
T Consensus 7 ~~l~~~yg~~~~L~~vsl~i~~Ge~~~llGpsGsGKSTLLr~iaGl-~~p~~G~I~i~G~~~~~~~~~~r~ig~VfQ~~~ 85 (381)
T 3rlf_A 7 QNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGL-ETITSGDLFIGEKRMNDTPPAERGVGMVFQSYA 85 (381)
T ss_dssp EEEEEEETTEEEEEEEEEEECTTCEEEEECCTTSSHHHHHHHHHTS-SCCSEEEEEETTEECTTCCGGGSCEEEECTTCC
T ss_pred EeEEEEECCEEEEeeeEEEECCCCEEEEEcCCCchHHHHHHHHHcC-CCCCCeEEEECCEECCCCCHHHCCEEEEecCCc
Confidence 5789999999999999999999999999999999999999999997 5688999999998764 2334567999999999
Q ss_pred ccccccHHHHHHHHHHHhcCCCccHHHHHHHHHHhhhcCCcchhhhhccCCCCCchhhHHHHHHHHhcc
Q psy310 112 LHANLTVEEAMNVATALKLGKDLTKAARKDVVRTLFYRSDTNHAQRCFLSGPWGTFESSVLLALAMYNR 180 (240)
Q Consensus 112 ~~~~ltv~e~l~~~~~~~~~~~l~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 180 (240)
+++.+||.|++.+..... ...+...++.++++++.+++.+...+.+...|++++|++.+++++...
T Consensus 86 l~p~ltV~eni~~~~~~~---~~~~~~~~~~v~~~l~~~~L~~~~~r~p~~LSGGqrQRVaiArAL~~~ 151 (381)
T 3rlf_A 86 LYPHLSVAENMSFGLKLA---GAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAE 151 (381)
T ss_dssp CCTTSCHHHHHTHHHHHT---TCCHHHHHHHHHHHHHHTTCGGGTTCCGGGSCHHHHHHHHHHHHHHHC
T ss_pred CCCCCCHHHHHHHHHHHc---CCCHHHHHHHHHHHHHHcCCchhhcCChhHCCHHHHHHHHHHHHHHcC
Confidence 999999999999865432 234555667788899999998888888888999999999999999875
|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B | Back alignment and structure |
|---|
| >3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 240 | ||||
| d1v43a3 | 239 | c.37.1.12 (A:7-245) Hypothetical protein PH0022, N | 5e-19 | |
| d1v43a3 | 239 | c.37.1.12 (A:7-245) Hypothetical protein PH0022, N | 9e-10 | |
| d1l7vc_ | 231 | c.37.1.12 (C:) ABC transporter involved in vitamin | 3e-18 | |
| d1l7vc_ | 231 | c.37.1.12 (C:) ABC transporter involved in vitamin | 2e-12 | |
| d2hyda1 | 255 | c.37.1.12 (A:324-578) Putative multidrug export AT | 4e-18 | |
| d2hyda1 | 255 | c.37.1.12 (A:324-578) Putative multidrug export AT | 1e-09 | |
| d3dhwc1 | 240 | c.37.1.12 (C:1-240) Methionine import ATP-binding | 2e-17 | |
| d3dhwc1 | 240 | c.37.1.12 (C:1-240) Methionine import ATP-binding | 6e-08 | |
| d1vpla_ | 238 | c.37.1.12 (A:) Putative ABC transporter TM0544 {Th | 1e-16 | |
| d1vpla_ | 238 | c.37.1.12 (A:) Putative ABC transporter TM0544 {Th | 2e-10 | |
| d1l2ta_ | 230 | c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann | 2e-16 | |
| d1l2ta_ | 230 | c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann | 6e-08 | |
| d1b0ua_ | 258 | c.37.1.12 (A:) ATP-binding subunit of the histidin | 3e-16 | |
| d1b0ua_ | 258 | c.37.1.12 (A:) ATP-binding subunit of the histidin | 4e-10 | |
| d2awna2 | 232 | c.37.1.12 (A:4-235) Maltose transport protein MalK | 5e-16 | |
| d2awna2 | 232 | c.37.1.12 (A:4-235) Maltose transport protein MalK | 2e-10 | |
| d1mv5a_ | 242 | c.37.1.12 (A:) Multidrug resistance ABC transporte | 7e-16 | |
| d1mv5a_ | 242 | c.37.1.12 (A:) Multidrug resistance ABC transporte | 2e-09 | |
| d3b60a1 | 253 | c.37.1.12 (A:329-581) Multidrug resistance ABC tra | 1e-15 | |
| d3b60a1 | 253 | c.37.1.12 (A:329-581) Multidrug resistance ABC tra | 2e-09 | |
| d1g6ha_ | 254 | c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann | 2e-15 | |
| d1g6ha_ | 254 | c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann | 3e-10 | |
| d1r0wa_ | 281 | c.37.1.12 (A:) Cystic fibrosis transmembrane condu | 3e-15 | |
| d1r0wa_ | 281 | c.37.1.12 (A:) Cystic fibrosis transmembrane condu | 8e-10 | |
| d1sgwa_ | 200 | c.37.1.12 (A:) Putative ABC transporter PF0895 {Py | 4e-15 | |
| d1sgwa_ | 200 | c.37.1.12 (A:) Putative ABC transporter PF0895 {Py | 2e-10 | |
| d1oxxk2 | 242 | c.37.1.12 (K:1-242) Glucose transport protein GlcV | 9e-15 | |
| d1oxxk2 | 242 | c.37.1.12 (K:1-242) Glucose transport protein GlcV | 7e-10 | |
| d1jj7a_ | 251 | c.37.1.12 (A:) Peptide transporter Tap1, C-termina | 1e-14 | |
| d1jj7a_ | 251 | c.37.1.12 (A:) Peptide transporter Tap1, C-termina | 1e-09 | |
| d3d31a2 | 229 | c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor | 2e-14 | |
| d3d31a2 | 229 | c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor | 2e-09 | |
| d2pmka1 | 241 | c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro | 4e-14 | |
| d2pmka1 | 241 | c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro | 6e-09 | |
| d2onka1 | 240 | c.37.1.12 (A:1-240) Molybdate/tungstate import ATP | 1e-12 | |
| d2onka1 | 240 | c.37.1.12 (A:1-240) Molybdate/tungstate import ATP | 4e-07 | |
| d1g2912 | 240 | c.37.1.12 (1:1-240) Maltose transport protein MalK | 2e-12 | |
| d1g2912 | 240 | c.37.1.12 (1:1-240) Maltose transport protein MalK | 5e-10 | |
| d1ji0a_ | 240 | c.37.1.12 (A:) Branched chain aminoacid ABC transp | 2e-11 | |
| d1ji0a_ | 240 | c.37.1.12 (A:) Branched chain aminoacid ABC transp | 6e-10 | |
| d1ye8a1 | 178 | c.37.1.11 (A:1-178) Hypothetical kinase-like prote | 2e-07 | |
| d1ye8a1 | 178 | c.37.1.11 (A:1-178) Hypothetical kinase-like prote | 2e-05 | |
| d1nrjb_ | 209 | c.37.1.8 (B:) Signal recognition particle receptor | 1e-05 | |
| d1nrjb_ | 209 | c.37.1.8 (B:) Signal recognition particle receptor | 0.001 | |
| d1h65a_ | 257 | c.37.1.8 (A:) Chloroplast protein translocon GTPas | 5e-05 | |
| d1h65a_ | 257 | c.37.1.8 (A:) Chloroplast protein translocon GTPas | 0.003 | |
| d2fh5b1 | 207 | c.37.1.8 (B:63-269) Signal recognition particle re | 1e-04 | |
| d1wf3a1 | 178 | c.37.1.8 (A:3-180) GTPase Era, N-terminal domain { | 1e-04 | |
| d1wf3a1 | 178 | c.37.1.8 (A:3-180) GTPase Era, N-terminal domain { | 1e-04 | |
| d1egaa1 | 179 | c.37.1.8 (A:4-182) GTPase Era, N-terminal domain { | 1e-04 | |
| d1egaa1 | 179 | c.37.1.8 (A:4-182) GTPase Era, N-terminal domain { | 2e-04 | |
| d1nlfa_ | 274 | c.37.1.11 (A:) Hexameric replicative helicase repA | 3e-04 | |
| d1nlfa_ | 274 | c.37.1.11 (A:) Hexameric replicative helicase repA | 0.004 | |
| g1f2t.1 | 292 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 4e-04 | |
| g1f2t.1 | 292 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 4e-04 | |
| d1mkya1 | 171 | c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal | 5e-04 | |
| d1mkya1 | 171 | c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal | 8e-04 | |
| d1lnza2 | 185 | c.37.1.8 (A:158-342) Obg GTP-binding protein middl | 7e-04 | |
| d1lnza2 | 185 | c.37.1.8 (A:158-342) Obg GTP-binding protein middl | 9e-04 | |
| d1udxa2 | 180 | c.37.1.8 (A:157-336) Obg GTP-binding protein middl | 7e-04 | |
| d1udxa2 | 180 | c.37.1.8 (A:157-336) Obg GTP-binding protein middl | 7e-04 | |
| d1puia_ | 188 | c.37.1.8 (A:) Probable GTPase EngB {Escherichia co | 9e-04 | |
| d1puia_ | 188 | c.37.1.8 (A:) Probable GTPase EngB {Escherichia co | 0.002 | |
| d1xzpa2 | 160 | c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotog | 0.001 | |
| d1xzpa2 | 160 | c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotog | 0.001 | |
| d2gj8a1 | 161 | c.37.1.8 (A:216-376) Probable tRNA modification GT | 0.001 | |
| d2gj8a1 | 161 | c.37.1.8 (A:216-376) Probable tRNA modification GT | 0.001 | |
| d1yrba1 | 244 | c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB09 | 0.001 | |
| d2cxxa1 | 184 | c.37.1.8 (A:2-185) GTP-binding protein engB {Pyroc | 0.001 | |
| d2cxxa1 | 184 | c.37.1.8 (A:2-185) GTP-binding protein engB {Pyroc | 0.002 | |
| d1zp6a1 | 176 | c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { | 0.001 | |
| d1zp6a1 | 176 | c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { | 0.001 | |
| d1znwa1 | 182 | c.37.1.1 (A:20-201) Guanylate kinase {Mycobacteriu | 0.001 | |
| d1znwa1 | 182 | c.37.1.1 (A:20-201) Guanylate kinase {Mycobacteriu | 0.001 | |
| d1svia_ | 195 | c.37.1.8 (A:) Probable GTPase EngB {Bacillus subti | 0.002 | |
| d1svia_ | 195 | c.37.1.8 (A:) Probable GTPase EngB {Bacillus subti | 0.003 | |
| d1s96a_ | 205 | c.37.1.1 (A:) Guanylate kinase {Escherichia coli [ | 0.002 | |
| d1s96a_ | 205 | c.37.1.1 (A:) Guanylate kinase {Escherichia coli [ | 0.003 | |
| d1mkya2 | 186 | c.37.1.8 (A:173-358) Probable GTPase Der, N-termin | 0.003 | |
| d1mkya2 | 186 | c.37.1.8 (A:173-358) Probable GTPase Der, N-termin | 0.003 | |
| d1qhxa_ | 178 | c.37.1.3 (A:) Chloramphenicol phosphotransferase { | 0.004 | |
| d1qhxa_ | 178 | c.37.1.3 (A:) Chloramphenicol phosphotransferase { | 0.004 |
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: Hypothetical protein PH0022, N-terminal domain species: Pyrococcus horikoshii [TaxId: 53953]
Score = 80.6 bits (199), Expect = 5e-19
Identities = 29/107 (27%), Positives = 48/107 (44%), Gaps = 5/107 (4%)
Query: 41 EKTILKSVSGRLRSGELTAIMGPSGAGKSTLLNILTGYKTSGTEGSITINGHERN-LSQF 99
T + ++ ++ GE ++GPSG GK+T L ++ G + TEG I + L
Sbjct: 18 NFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEP-TEGRIYFGDRDVTYLPPK 76
Query: 100 RKLSCYIMQDNQLHANLTVEEAMNVATALKLGKDLTKAARKDVVRTL 146
+ + Q + ++TV E N+A LK+ K K VR
Sbjct: 77 DRNISMVFQSYAVWPHMTVYE--NIAFPLKIKK-FPKDEIDKRVRWA 120
|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 257 | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 257 | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 178 | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 178 | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 179 | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 179 | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Length = 274 | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Length = 274 | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 171 | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 171 | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Length = 185 | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Length = 185 | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Length = 180 | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Length = 180 | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Length = 188 | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Length = 188 | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Length = 160 | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Length = 160 | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Length = 161 | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Length = 161 | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Length = 244 | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Length = 184 | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Length = 184 | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 182 | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 182 | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Length = 195 | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Length = 195 | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Length = 205 | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Length = 205 | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 186 | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 186 | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 240 | |||
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 99.96 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 99.96 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 99.96 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 99.96 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 99.95 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 99.95 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 99.95 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 99.95 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 99.94 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 99.94 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 99.93 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 99.93 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 99.9 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 99.9 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 99.9 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 99.9 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 99.88 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 99.87 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 99.82 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 99.8 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 99.39 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 99.37 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 99.37 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 99.37 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 99.36 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 99.35 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 99.34 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 99.33 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 99.3 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 99.29 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 99.29 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 99.27 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 99.27 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 99.27 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 99.26 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 99.25 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 99.23 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 99.19 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 99.17 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 98.99 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 98.58 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 98.13 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 97.99 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 97.94 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 97.91 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 97.85 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 97.72 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.7 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 97.69 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 97.69 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 97.68 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 97.64 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 97.61 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 97.6 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 97.59 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 97.5 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 97.46 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 97.45 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 97.43 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 97.42 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 97.41 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 97.4 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 97.39 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.39 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 97.39 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 97.38 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 97.38 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 97.37 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 97.36 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 97.35 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 97.26 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 97.2 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 97.19 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 97.16 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 97.16 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 97.13 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 97.13 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 97.12 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 97.11 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 97.11 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 97.1 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 97.1 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 97.07 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 97.07 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 97.05 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 97.04 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 97.03 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 97.03 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 97.03 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 97.02 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 97.02 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 96.99 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 96.98 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 96.97 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 96.97 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 96.97 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 96.97 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 96.96 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 96.96 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 96.95 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 96.94 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 96.94 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 96.94 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 96.94 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 96.92 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 96.92 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 96.9 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 96.87 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 96.84 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 96.83 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 96.81 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 96.79 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 96.78 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 96.78 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 96.77 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 96.77 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 96.77 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 96.74 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 96.73 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 96.72 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 96.71 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 96.71 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 96.7 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 96.67 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 96.59 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 96.59 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 96.58 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 96.56 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 96.55 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 96.55 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 96.54 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 96.53 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 96.51 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 96.5 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 96.49 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 96.48 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 96.47 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 96.46 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 96.44 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 96.42 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 96.42 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 96.4 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 96.37 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 96.36 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 96.35 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 96.34 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 96.32 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 96.32 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 96.29 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 96.28 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 96.28 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 96.27 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 96.26 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 96.26 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 96.25 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 96.25 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 96.24 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 96.24 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 96.24 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 96.23 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 96.22 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 96.19 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 96.19 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 96.18 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 96.18 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 96.17 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 96.17 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 96.16 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 96.16 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 96.16 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 96.15 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 96.15 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 96.15 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 96.15 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 96.13 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 96.13 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 96.12 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 96.12 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 96.11 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 96.09 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 96.09 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 96.09 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 96.07 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 96.07 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 96.06 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 96.05 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 96.03 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 96.02 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 95.99 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 95.99 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 95.98 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 95.98 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 95.97 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 95.96 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 95.95 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 95.94 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 95.93 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 95.93 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 95.93 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.92 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 95.92 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 95.9 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 95.89 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 95.89 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 95.87 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 95.86 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 95.86 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 95.85 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 95.84 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 95.83 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 95.83 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 95.83 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 95.81 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 95.8 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 95.8 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 95.79 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 95.79 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.78 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 95.78 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 95.78 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 95.77 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 95.75 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 95.74 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 95.73 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 95.72 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 95.72 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 95.71 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 95.7 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 95.7 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 95.69 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 95.68 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 95.68 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 95.67 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 95.66 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 95.65 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 95.65 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 95.64 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 95.61 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 95.6 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 95.6 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 95.58 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 95.57 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 95.56 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 95.56 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 95.54 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 95.52 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 95.51 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 95.51 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 95.49 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 95.44 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 95.43 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 95.43 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 95.43 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 95.42 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 95.37 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 95.35 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 95.33 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 95.3 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 95.29 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 95.28 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 95.27 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 95.24 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 95.19 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 95.12 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 95.08 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 95.03 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 95.02 | |
| d2akab1 | 299 | Dynamin G domain {Rat (Rattus norvegicus) [TaxId: | 95.02 | |
| d1jwyb_ | 306 | Dynamin G domain {Dictyostelium discoideum [TaxId: | 94.99 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 94.99 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 94.98 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 94.94 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 94.91 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 94.8 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 94.71 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 94.69 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 94.63 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 94.58 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 94.57 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 94.56 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 94.56 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 94.55 | |
| d1kk1a3 | 195 | Initiation factor eIF2 gamma subunit, N-terminal ( | 94.48 | |
| d1wxqa1 | 319 | GTP-binding protein PH0525 {Pyrococcus horikoshii | 94.45 | |
| d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 94.43 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 94.37 | |
| d1jwyb_ | 306 | Dynamin G domain {Dictyostelium discoideum [TaxId: | 94.32 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 94.19 | |
| d2akab1 | 299 | Dynamin G domain {Rat (Rattus norvegicus) [TaxId: | 94.15 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 94.09 | |
| d1ni3a1 | 296 | YchF GTP-binding protein N-terminal domain {Fissio | 94.08 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 93.89 | |
| d1jala1 | 278 | YchF GTP-binding protein N-terminal domain {Haemop | 93.72 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 93.71 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 93.64 | |
| d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 93.63 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 93.61 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 93.58 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 93.58 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 93.39 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 93.35 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 93.32 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 93.28 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 93.24 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 93.22 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 93.21 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 93.09 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 92.89 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 92.73 | |
| d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 92.71 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 92.52 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 92.36 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 92.3 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 92.3 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 92.21 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 92.19 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 92.16 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 92.1 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 91.96 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 91.9 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 91.87 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 91.83 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 91.62 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 91.54 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 91.34 | |
| d1xbta1 | 133 | Thymidine kinase, TK1, N-terminal domain {Human (H | 91.33 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 91.29 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 90.98 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 90.85 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 90.69 | |
| d1jnya3 | 224 | Elongation factor eEF-1alpha, N-terminal (G) domai | 90.53 | |
| d1e2ka_ | 329 | Thymidine kinase {Herpes simplex virus type 1, dif | 90.31 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 90.27 | |
| d2olra1 | 313 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 89.92 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 89.75 | |
| d1j3ba1 | 318 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 89.65 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 89.57 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 89.25 | |
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 89.19 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 89.08 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 89.03 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 88.99 | |
| d1zunb3 | 222 | Sulfate adenylate transferase subunit cysN/C, EF-T | 88.96 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 88.94 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 88.82 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 88.73 | |
| d1ii2a1 | 323 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 88.73 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 88.26 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 88.11 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 87.91 | |
| d1r5ba3 | 245 | Eukaryotic peptide chain release factor ERF2, G do | 87.75 | |
| d1g8fa3 | 122 | ATP sulfurylase C-terminal domain {Baker's yeast ( | 87.46 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 87.04 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 87.03 | |
| d1xx6a1 | 141 | Thymidine kinase, TK1, N-terminal domain {Clostrid | 86.97 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 86.71 | |
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 86.65 | |
| d1f60a3 | 239 | Elongation factor eEF-1alpha, N-terminal (G) domai | 86.61 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 86.56 | |
| d1r5ba3 | 245 | Eukaryotic peptide chain release factor ERF2, G do | 86.37 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 86.31 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 86.22 | |
| d1lkxa_ | 684 | Myosin S1, motor domain {Dictyostelium discoideum, | 85.82 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 85.44 | |
| d1g8fa3 | 122 | ATP sulfurylase C-terminal domain {Baker's yeast ( | 85.39 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 85.29 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 85.13 | |
| d1d0xa2 | 712 | Myosin S1, motor domain {Dictyostelium discoideum | 84.63 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 84.22 | |
| d2b8ta1 | 139 | Thymidine kinase, TK1, N-terminal domain {Ureaplas | 83.82 | |
| d1br2a2 | 710 | Myosin S1, motor domain {Chicken (Gallus gallus), | 83.75 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 83.74 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 82.58 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 82.57 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 82.13 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 82.06 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 81.81 | |
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 80.52 |
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: Hypothetical protein PH0022, N-terminal domain species: Pyrococcus horikoshii [TaxId: 53953]
Probab=99.96 E-value=1.3e-29 Score=213.91 Aligned_cols=144 Identities=21% Similarity=0.258 Sum_probs=120.8
Q ss_pred CCceecCCCceeeeeeEEEEeCCCEEEEECCCCchHHHHHHHHhCCCCCCCccEEEECCccCC-chhhhhhceEEccccc
Q psy310 33 TNNNCEPNEKTILKSVSGRLRSGELTAIMGPSGAGKSTLLNILTGYKTSGTEGSITINGHERN-LSQFRKLSCYIMQDNQ 111 (240)
Q Consensus 33 ~~~~~~~~~~~~L~~vsl~I~~Ge~vgLvG~NGSGKSTLLr~L~G~~~~~~~G~V~v~g~~~~-~~~~~~~~g~v~Q~~~ 111 (240)
+|+.+.|++..+|++|||+|++||+++|+||||||||||+++|+|+ ..|++|+|.++|+++. ....++.+|||||++.
T Consensus 10 ~nlsk~yg~~~al~~vsl~v~~Ge~~~liGpsGaGKSTLl~~i~Gl-~~p~sG~I~i~g~~i~~~~~~~r~ig~v~Q~~~ 88 (239)
T d1v43a3 10 ENLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGL-EEPTEGRIYFGDRDVTYLPPKDRNISMVFQSYA 88 (239)
T ss_dssp EEEEEEETTEEEEEEEEEEECTTCEEEEECCTTSSHHHHHHHHHTS-SCCSEEEEEETTEECTTSCGGGGTEEEEEC---
T ss_pred EEEEEEECCEEEEcceeEEECCCCEEEEECCCCChHHHHHHHHHcC-CCCCCCEEEEcceecccCCcccceEEEEeechh
Confidence 5789999999999999999999999999999999999999999997 5689999999999864 2345678999999999
Q ss_pred ccccccHHHHHHHHHHHhcCCCccHHHHHHHHHHhhhcCCcchhhhhccCCCCCchhhHHHHHHHHhcc
Q psy310 112 LHANLTVEEAMNVATALKLGKDLTKAARKDVVRTLFYRSDTNHAQRCFLSGPWGTFESSVLLALAMYNR 180 (240)
Q Consensus 112 ~~~~ltv~e~l~~~~~~~~~~~l~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 180 (240)
+++.+|++|++.+.... ...++...++.+.++++.+++.+.....+...|++++|++.+|+++...
T Consensus 89 l~~~ltv~enl~~~~~~---~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LSGGq~QRvaiAraL~~~ 154 (239)
T d1v43a3 89 VWPHMTVYENIAFPLKI---KKFPKDEIDKRVRWAAELLQIEELLNRYPAQLSGGQRQRVAVARAIVVE 154 (239)
T ss_dssp ---CCCHHHHHHTTCC-----CCCHHHHHHHHHHHHHHTTCGGGTTSCTTTCCSSCHHHHHHHHHHTTC
T ss_pred hcccchHHHHHHHHHHH---cCCCHHHHHHHHHHHHHHcCChhhhcCChhhCCHHHHHHHHHHhhhccC
Confidence 99999999999864322 2456677788889999999999988888899999999999999999876
|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} | Back information, alignment and structure |
|---|
| >d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|