Psyllid ID: psy3116

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------
MRTNDDLSVTSFNSMGTKIFDKLMIQLDKPDSSDDEDMTICRICYGADQQNLLSICQCKGSIAYVHIECIERWLQECGVDKCDLCKYQFTTERLPTQTKLKSLLSWVKHVDNREDMEEMLTDFAATFLFSPFIILLTLSGYQTFSNNAIRLDYYIGITYSSTLEFEVPNVRELTEYE
cccccccccEEcccccccccccHHcccccccccccccccccEEEEccccccccccccccccHHHHHHHHHHHHHHHcccccccccccEEEEccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHcc
ccccccEEEEEEEccccccccHHHHccccccccccccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHccccEEEEcccEEEEEEcccccccccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHcccccccccccccc
mrtnddlsvtsfnsmgTKIFDKLMIqldkpdssddedmtICRICYGADQQNLLSICQCKGSIAYVHIECIERWLqecgvdkcdlckyqftterlptqTKLKSLLSWVKHVDNREDMEEMLTDFAATFLFSPFIILLTLSgyqtfsnnairLDYYIGITYsstlefevpnvrelteye
mrtnddlsvtsfnsmgtkIFDKLMIQLDKPDSSDDEDMTICRICYGADQQNLLSICQCKGSIAYVHIECIERWLQECGVDKCDLCKYQFtterlptqtklkSLLSWVKHVDNREDMEEMLTDFAATFLFSPFIILLTLSGYQTFSNNAIRLDYYIGITYsstlefevpnvrelteye
MRTNDDLSVTSFNSMGTKIFDKLMIQLDKPDSSDDEDMTICRICYGADQQNLLSICQCKGSIAYVHIECIERWLQECGVDKCDLCKYQFTTERLPTQTKLKSLLSWVKHVDNREDMEEMLTDFAATFLFSPFIILLTLSGYQTFSNNAIRLDYYIGITYSSTLEFEVPNVRELTEYE
****************TKIFDKLMIQ***********MTICRICYGADQQNLLSICQCKGSIAYVHIECIERWLQECGVDKCDLCKYQFTTERLPTQTKLKSLLSWVKHVDNREDMEEMLTDFAATFLFSPFIILLTLSGYQTFSNNAIRLDYYIGITYSSTLEFEVPN********
*****************************************RICYGADQQNLLSICQCKGSIAYVHIECIERWLQECGVDKCDLCKYQFTTERLPTQTKLKSLLSWVKHVDNREDMEEMLTDFAATFLFSPFIILLTLSGYQTFSNNAIRLDYYIGITYSSTLEFEVPNVRELT***
********VTSFNSMGTKIFDKLMIQLDKPDSSDDEDMTICRICYGADQQNLLSICQCKGSIAYVHIECIERWLQECGVDKCDLCKYQFTTERLPTQTKLKSLLSWVKHVDNREDMEEMLTDFAATFLFSPFIILLTLSGYQTFSNNAIRLDYYIGITYSSTLEFEVPNVRELTEYE
****DDLSVTSFNSMGTKIFDKLMIQLDK******EDMTICRICYGADQQNLLSICQCKGSIAYVHIECIERWLQECGVDKCDLCKYQFTTERLPTQTKLKSLLSWVKHVDNREDMEEMLTDFAATFLFSPFIILLTLSGYQTFSNNAIRLDYYIGITYSSTLEFEVPNVR******
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRTNDDLSVTSFNSMGTKIFDKLMIQLDKPDSSDDEDMTICRICYGADQQNLLSICQCKGSIAYVHIECIERWLQECGVDKCDLCKYQFTTERLPTQTKLKSLLSWVKHVDNREDMEEMLTDFAATFLFSPFIILLTLSGYQTFSNNAIRLDYYIGITYSSTLEFEVPNVRELTEYE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query177 2.2.26 [Sep-21-2011]
Q86UD3253 E3 ubiquitin-protein liga yes N/A 0.570 0.399 0.309 3e-13
Q0IH10252 E3 ubiquitin-protein liga N/A N/A 0.570 0.400 0.309 3e-13
Q5XIE5253 E3 ubiquitin-protein liga yes N/A 0.570 0.399 0.309 3e-13
A0JN69253 E3 ubiquitin-protein liga yes N/A 0.570 0.399 0.309 4e-13
Q68FA7251 E3 ubiquitin-protein liga yes N/A 0.548 0.386 0.311 4e-13
Q8BRX9218 E3 ubiquitin-protein liga yes N/A 0.570 0.463 0.309 4e-13
Q5I0I2246 E3 ubiquitin-protein liga no N/A 0.700 0.504 0.297 9e-13
Q32L65245 E3 ubiquitin-protein liga no N/A 0.757 0.546 0.273 5e-12
Q99M02246 E3 ubiquitin-protein liga no N/A 0.700 0.504 0.289 7e-12
Q9P0N8246 E3 ubiquitin-protein liga no N/A 0.700 0.504 0.289 8e-12
>sp|Q86UD3|MARH3_HUMAN E3 ubiquitin-protein ligase MARCH3 OS=Homo sapiens GN=MARCH3 PE=2 SV=1 Back     alignment and function desciption
 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 58/110 (52%), Gaps = 9/110 (8%)

Query: 33  SDDEDMTICRICY-GADQQNLLSICQCKGSIAYVHIECIERWLQECGVDKCDLCKYQFTT 91
           S   D  +CRIC+ G+ Q++LLS C+C G++  +H  C+E WL       C+LC ++F  
Sbjct: 63  SPFNDRPMCRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFAV 122

Query: 92  ERLPTQTKLKSLLSWVKHVDNREDMEEMLTDFAATFLFSPFIILLTLSGY 141
           ER P     + L+ W+++   + +   +  D       +P   L T+SG+
Sbjct: 123 ERKP-----RPLVEWLRNPGPQHEKRTLFGDMVCFLFITP---LATISGW 164
E3 ubiquitin-protein ligase which may be involved in endosomal trafficking. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
Homo sapiens (taxid: 9606)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q0IH10|MARH3_XENLA E3 ubiquitin-protein ligase MARCH3 OS=Xenopus laevis GN=march3 PE=2 SV=1 Back     alignment and function description
>sp|Q5XIE5|MARH3_RAT E3 ubiquitin-protein ligase MARCH3 OS=Rattus norvegicus GN=March3 PE=1 SV=1 Back     alignment and function description
>sp|A0JN69|MARH3_BOVIN E3 ubiquitin-protein ligase MARCH3 OS=Bos taurus GN=MARCH3 PE=2 SV=1 Back     alignment and function description
>sp|Q68FA7|MARH3_XENTR E3 ubiquitin-protein ligase MARCH3 OS=Xenopus tropicalis GN=march3 PE=2 SV=1 Back     alignment and function description
>sp|Q8BRX9|MARH3_MOUSE E3 ubiquitin-protein ligase MARCH3 OS=Mus musculus GN=March3 PE=2 SV=1 Back     alignment and function description
>sp|Q5I0I2|MARH2_RAT E3 ubiquitin-protein ligase MARCH2 OS=Rattus norvegicus GN=March2 PE=1 SV=1 Back     alignment and function description
>sp|Q32L65|MARH2_BOVIN E3 ubiquitin-protein ligase MARCH2 OS=Bos taurus GN=MARCH2 PE=2 SV=1 Back     alignment and function description
>sp|Q99M02|MARH2_MOUSE E3 ubiquitin-protein ligase MARCH2 OS=Mus musculus GN=March2 PE=2 SV=1 Back     alignment and function description
>sp|Q9P0N8|MARH2_HUMAN E3 ubiquitin-protein ligase MARCH2 OS=Homo sapiens GN=MARCH2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query177
242006254 297 membrane associated RING finger, putativ 0.706 0.420 0.335 3e-18
350537601276 E3 ubiquitin ligase MARCH3 [Oncorhynchus 0.570 0.365 0.354 3e-14
213511630276 E3 ubiquitin-protein ligase MARCH3 [Salm 0.570 0.365 0.354 3e-14
339251976236 E3 ubiquitin-protein ligase MARCH2 [Tric 0.666 0.5 0.325 1e-13
195455933 460 GK22887 [Drosophila willistoni] gi|19417 0.734 0.282 0.343 2e-13
357623418 385 hypothetical protein KGM_21401 [Danaus p 0.768 0.353 0.303 2e-13
242021543 358 membrane associated RING finger 1,8, put 0.548 0.270 0.361 4e-13
194753732 453 GF12746 [Drosophila ananassae] gi|190620 0.649 0.253 0.362 1e-12
348501400248 PREDICTED: E3 ubiquitin-protein ligase M 0.649 0.463 0.346 1e-12
189240777 621 PREDICTED: similar to parcas CG7761-PA [ 0.553 0.157 0.37 1e-12
>gi|242006254|ref|XP_002423967.1| membrane associated RING finger, putative [Pediculus humanus corporis] gi|212507249|gb|EEB11229.1| membrane associated RING finger, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 79/137 (57%), Gaps = 12/137 (8%)

Query: 20  FDKLMIQLDKPDSSDDEDMT-----ICRICYGA-DQQNLLSICQCKGSIAYVHIECIERW 73
           + +LM+Q  KP+ +    +      ICRIC  A  +++L++ C C+G++ ++H+ C+E W
Sbjct: 51  YKQLMLQQQKPNDAASISLVNSSSDICRICREAGSKEDLITTCCCRGTMRFIHLSCLEHW 110

Query: 74  LQECGVDKCDLCKYQFTTERLPTQTKLKSLLSWVKHVDNREDMEEMLTDFAATFLFSP-- 131
           L E    KC+LC YQ+ T R P  + +KS+L W+++   R D  E++ DF A  +F+P  
Sbjct: 111 LAESDSTKCELCSYQYQTVRTPKYSIIKSILLWLQNPGRRRDAREIMLDFLALIVFTPMA 170

Query: 132 ----FIILLTLSGYQTF 144
               ++ LLT   +  F
Sbjct: 171 FFGTYMALLTAETWYIF 187

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350537601|ref|NP_001233283.1| E3 ubiquitin ligase MARCH3 [Oncorhynchus mykiss] gi|329771347|emb|CCA64454.1| E3 ubiquitin ligase MARCH3 [Oncorhynchus mykiss] Back     alignment and taxonomy information
>gi|213511630|ref|NP_001135117.1| E3 ubiquitin-protein ligase MARCH3 [Salmo salar] gi|209155340|gb|ACI33902.1| E3 ubiquitin-protein ligase MARCH3 [Salmo salar] Back     alignment and taxonomy information
>gi|339251976|ref|XP_003371211.1| E3 ubiquitin-protein ligase MARCH2 [Trichinella spiralis] gi|316968582|gb|EFV52844.1| E3 ubiquitin-protein ligase MARCH2 [Trichinella spiralis] Back     alignment and taxonomy information
>gi|195455933|ref|XP_002074929.1| GK22887 [Drosophila willistoni] gi|194171014|gb|EDW85915.1| GK22887 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|357623418|gb|EHJ74578.1| hypothetical protein KGM_21401 [Danaus plexippus] Back     alignment and taxonomy information
>gi|242021543|ref|XP_002431204.1| membrane associated RING finger 1,8, putative [Pediculus humanus corporis] gi|212516453|gb|EEB18466.1| membrane associated RING finger 1,8, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|194753732|ref|XP_001959164.1| GF12746 [Drosophila ananassae] gi|190620462|gb|EDV35986.1| GF12746 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|348501400|ref|XP_003438258.1| PREDICTED: E3 ubiquitin-protein ligase MARCH2-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|189240777|ref|XP_969434.2| PREDICTED: similar to parcas CG7761-PA [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query177
FB|FBgn0034546 425 CG13442 [Drosophila melanogast 0.598 0.249 0.364 7.7e-15
UNIPROTKB|A0JN69253 MARCH3 "E3 ubiquitin-protein l 0.548 0.383 0.311 6.2e-14
UNIPROTKB|E2R088253 MARCH3 "Uncharacterized protei 0.548 0.383 0.311 6.2e-14
UNIPROTKB|Q86UD3253 MARCH3 "E3 ubiquitin-protein l 0.548 0.383 0.311 6.2e-14
UNIPROTKB|F1RKL9253 MARCH3 "Uncharacterized protei 0.548 0.383 0.311 6.2e-14
UNIPROTKB|Q0IH10252 march3 "E3 ubiquitin-protein l 0.570 0.400 0.309 6.2e-14
UNIPROTKB|Q68FA7251 march3 "E3 ubiquitin-protein l 0.548 0.386 0.311 6.2e-14
MGI|MGI:2443667218 March3 "membrane-associated ri 0.548 0.444 0.311 6.2e-14
RGD|1359308253 March3 "membrane-associated ri 0.548 0.383 0.311 6.2e-14
UNIPROTKB|Q5XIE5253 March3 "E3 ubiquitin-protein l 0.548 0.383 0.311 6.2e-14
FB|FBgn0034546 CG13442 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 195 (73.7 bits), Expect = 7.7e-15, P = 7.7e-15
 Identities = 39/107 (36%), Positives = 60/107 (56%)

Query:    40 ICRICYGADQ-QNLLSICQCKGSIAYVHIECIERWLQECGVDKCDLCKYQFTTERLPTQT 98
             +CRIC+ AD  + L+S C CKGS+ YVH+ C+E W+       C+LC++Q+ TE+    T
Sbjct:   166 VCRICHNADNPEQLVSPCLCKGSLTYVHVHCLECWISTSRCTTCELCQFQYNTEQTLRYT 225

Query:    99 KLKSLLSWVKHVDNREDMEEMLTDFAATFLFSPFIILLTLSGYQTFS 145
              L+SL  W     +R  ++E    F+   L +  II   L G Q ++
Sbjct:   226 CLQSLRLWYSRAMSRRALQEDCQMFSLLTLVAFGIIGTLLVGIQYYA 272
GO:0008270 "zinc ion binding" evidence=IEA
UNIPROTKB|A0JN69 MARCH3 "E3 ubiquitin-protein ligase MARCH3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R088 MARCH3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q86UD3 MARCH3 "E3 ubiquitin-protein ligase MARCH3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RKL9 MARCH3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q0IH10 march3 "E3 ubiquitin-protein ligase MARCH3" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q68FA7 march3 "E3 ubiquitin-protein ligase MARCH3" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
MGI|MGI:2443667 March3 "membrane-associated ring finger (C3HC4) 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1359308 March3 "membrane-associated ring finger (C3HC4) 3, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5XIE5 March3 "E3 ubiquitin-protein ligase MARCH3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
smart0074449 smart00744, RINGv, The RING-variant domain is a C4 5e-13
COG5183 1175 COG5183, SSM4, Protein involved in mRNA turnover a 5e-12
pfam1290647 pfam12906, RINGv, RING-variant domain 1e-11
>gnl|CDD|128983 smart00744, RINGv, The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information 
 Score = 60.0 bits (146), Expect = 5e-13
 Identities = 25/49 (51%), Positives = 33/49 (67%), Gaps = 2/49 (4%)

Query: 40 ICRICYGADQ--QNLLSICQCKGSIAYVHIECIERWLQECGVDKCDLCK 86
          ICRIC+        L+S C+CKGS+ YVH EC+ERW+ E G   C++CK
Sbjct: 1  ICRICHDEGDEGDPLVSPCRCKGSLKYVHQECLERWINESGNKTCEICK 49

Some of these proteins have been shown both in vivo and in vitro to have ubiquitin E3 ligase activity. The RING-variant domain is reminiscent of both the RING and the PHD domains and may represent an evolutionary intermediate. To describe this domain the term PHD/LAP domain has been used in the past. Extended description: The RING-variant (RINGv) domain contains a C4HC3 zinc-finger-like motif similar to the PHD domain, while some of the spacing between the Cys/His residues follow a pattern somewhat closer to that found in the RING domain. The RINGv domain, similar to the RING, PHD and LIM domains, is thought to bind two zinc ions co-ordinated by the highly conserved Cys and His residues. RING variant domain: C-x (2) -C-x(10-45)-C-x (1) -C-x (7) -H-x(2)-C-x(11-25)-C-x(2)-C As opposed to a PHD: C-x(1-2) -C-x (7-13)-C-x(2-4)-C-x(4-5)-H-x(2)-C-x(10-21)-C-x(2)-C Classical RING domain: C-x (2) -C-x (9-39)-C-x(1-3)-H-x(2-3)-C-x(2)-C-x(4-48) -C-x(2)-C. Length = 49
>gnl|CDD|227510 COG5183, SSM4, Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|221845 pfam12906, RINGv, RING-variant domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 177
PHA02862156 5L protein; Provisional 99.89
PHA02825162 LAP/PHD finger-like protein; Provisional 99.85
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 99.74
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 99.73
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 99.62
KOG3053|consensus 293 99.59
KOG1609|consensus 323 99.4
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 97.37
PHA02929238 N1R/p28-like protein; Provisional 96.86
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 96.81
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 96.55
cd0016245 RING RING-finger (Really Interesting New Gene) dom 96.12
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 96.03
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 95.93
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 95.68
KOG4628|consensus348 95.48
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 95.22
KOG0823|consensus230 94.95
smart0050463 Ubox Modified RING finger domain. Modified RING fi 94.77
COG52191525 Uncharacterized conserved protein, contains RING Z 94.16
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 94.15
PHA02926242 zinc finger-like protein; Provisional 94.15
KOG0802|consensus 543 93.84
KOG1493|consensus84 93.36
KOG0317|consensus293 92.79
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 92.66
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 92.3
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 92.08
KOG1785|consensus563 90.12
KOG0827|consensus 465 89.38
PLN02189 1040 cellulose synthase 87.62
PLN02436 1094 cellulose synthase A 87.37
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 87.14
KOG4265|consensus349 84.88
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 84.38
PF10272358 Tmpp129: Putative transmembrane protein precursor; 80.77
KOG2930|consensus114 80.77
>PHA02862 5L protein; Provisional Back     alignment and domain information 
Probab=99.89  E-value=3e-24  Score=170.22  Aligned_cols=89  Identities=19%  Similarity=0.447  Sum_probs=77.6

Q ss_pred             CCeeEEcccCCCCcccccccccCccccccHHHHHHHHHHcCCCccCCCCCeeEeeecCccccccchHHHh---hccCChH
Q psy3116          38 MTICRICYGADQQNLLSICQCKGSIAYVHIECIERWLQECGVDKCDLCKYQFTTERLPTQTKLKSLLSWV---KHVDNRE  114 (177)
Q Consensus        38 ~~~CRIC~~~~~~~Li~PC~C~Gs~~~VH~~CL~~Wi~~s~~~~CelC~~~y~~~~~~~y~~~~~l~~W~---~~~~~~~  114 (177)
                      +++||||+++++ +.++||+|+||.+|||++||++|++.+++..||+|+++|.+..+.+     |+++|.   +.+.+..
T Consensus         2 ~diCWIC~~~~~-e~~~PC~C~GS~K~VHq~CL~~WIn~S~k~~CeLCkteY~Ik~~yK-----pf~kW~~~f~d~k~~l   75 (156)
T PHA02862          2 SDICWICNDVCD-ERNNFCGCNEEYKVVHIKCMQLWINYSKKKECNLCKTKYNIKKTYV-----SFKKWNWCFNDKKTTL   75 (156)
T ss_pred             CCEEEEecCcCC-CCcccccccCcchhHHHHHHHHHHhcCCCcCccCCCCeEEEEEccc-----cHHHhhccCCCCCCch
Confidence            579999998873 3369999999999999999999999999999999999999988776     999996   5666778


Q ss_pred             HHHHHhhhhhHHHHHHHH
Q psy3116         115 DMEEMLTDFAATFLFSPF  132 (177)
Q Consensus       115 ~~r~i~~d~l~~l~ltpi  132 (177)
                      +++-++++.++++++||-
T Consensus        76 ~ki~fI~~~v~fi~it~s   93 (156)
T PHA02862         76 SKIFFILFALVFIFLTIS   93 (156)
T ss_pred             heeeeHhhhhhheeeecc
Confidence            888888888888777764

>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG3053|consensus Back     alignment and domain information
>KOG1609|consensus Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG4628|consensus Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>KOG1493|consensus Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785|consensus Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information
>PLN02436 cellulose synthase A Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG4265|consensus Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG2930|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
2d8s_A80 Solution Structure Of The Ring Domain Of The Human 6e-08
>pdb|2D8S|A Chain A, Solution Structure Of The Ring Domain Of The Human Cellular Modulator Of Immune Recognition Protein Length = 80 Back     alignment and structure 
Iteration: 1

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 7/65 (10%)
Query: 30 PDSSDDEDMTICRICY--GADQQNLLSICQCKGSIAYVHIECIERWLQECGVDKCDLCKY 87
          P S D     ICRIC+  G D+  L++ C C GS+ +VH  C+++W++      C+LCKY
Sbjct: 12 PSSQD-----ICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKY 66
Query: 88 QFTTE 92
          +F  E
Sbjct: 67 EFIME 71

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 5e-20
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 2e-19
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 Back     alignment and structure
 Score = 77.8 bits (192), Expect = 5e-20
 Identities = 17/58 (29%), Positives = 24/58 (41%)

Query: 34 DDEDMTICRICYGADQQNLLSICQCKGSIAYVHIECIERWLQECGVDKCDLCKYQFTT 91
          +DED+ +C IC           C C G +  VH  C+  WL       C +C   + T
Sbjct: 2  EDEDVPVCWICNEELGNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNT 59
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query177
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 99.83
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.74
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 97.73
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 97.72
2ecm_A55 Ring finger and CHY zinc finger domain- containing 97.59
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.58
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 97.57
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 97.49
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 97.49
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 97.43
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 97.34
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.28
2ect_A78 Ring finger protein 126; metal binding protein, st 97.26
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 97.22
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 97.19
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 97.18
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 97.15
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 97.1
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 97.08
2ecw_A85 Tripartite motif-containing protein 30; metal bind 97.01
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 96.99
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 96.95
2ysl_A73 Tripartite motif-containing protein 31; ring-type 96.85
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 96.81
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 96.64
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 96.63
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 96.62
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 96.6
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 96.58
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 96.55
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 96.54
2ysj_A63 Tripartite motif-containing protein 31; ring-type 96.43
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 96.43
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 96.4
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 96.26
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 96.24
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 96.0
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 95.81
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 95.71
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 95.66
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 95.48
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 95.43
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 95.37
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 95.25
1z6u_A150 NP95-like ring finger protein isoform B; structura 95.16
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 95.04
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 95.0
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 95.0
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 94.62
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 94.61
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 93.78
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 93.52
3nw0_A238 Non-structural maintenance of chromosomes element 93.35
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 92.89
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 92.3
2f42_A179 STIP1 homology and U-box containing protein 1; cha 92.12
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 91.88
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 90.66
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 90.19
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 89.3
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 89.09
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 88.78
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 87.98
2ea5_A68 Cell growth regulator with ring finger domain prot 87.61
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 86.62
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 85.82
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 85.31
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 82.43
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 80.69
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
Probab=99.83  E-value=1.7e-21  Score=132.29  Aligned_cols=58  Identities=29%  Similarity=0.770  Sum_probs=53.6

Q ss_pred             CCCCCCeeEEcccCCCCcccccccccCccccccHHHHHHHHHHcCCCccCCCCCeeEe
Q psy3116          34 DDEDMTICRICYGADQQNLLSICQCKGSIAYVHIECIERWLQECGVDKCDLCKYQFTT   91 (177)
Q Consensus        34 ~~~~~~~CRIC~~~~~~~Li~PC~C~Gs~~~VH~~CL~~Wi~~s~~~~CelC~~~y~~   91 (177)
                      ++++++.||||+++++++|+.||+|+||+++||+.||.+|+.++++.+||+|+++|++
T Consensus         2 e~~~~~~CrIC~~~~~~~l~~PC~C~gs~~~~H~~Cl~~W~~~~~~~~C~~C~~~~~~   59 (60)
T 1vyx_A            2 EDEDVPVCWICNEELGNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNT   59 (60)
T ss_dssp             TTCSCCEETTTTEECSCCCCCSCCCSSGGGSCCHHHHHHHHHHHTCSBCTTTCCBCCC
T ss_pred             CCCCCCEeEEeecCCCCceecCcCCCCchhhhHHHHHHHHHHhCCCCccCCCCCeeec
Confidence            3568899999998776789999999999999999999999999999999999999986
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 177
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 6e-11
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

 Score = 53.3 bits (127), Expect = 6e-11
 Identities = 17/58 (29%), Positives = 24/58 (41%)

Query: 34 DDEDMTICRICYGADQQNLLSICQCKGSIAYVHIECIERWLQECGVDKCDLCKYQFTT 91
          +DED+ +C IC           C C G +  VH  C+  WL       C +C   + T
Sbjct: 2  EDEDVPVCWICNEELGNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNT 59

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query177
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.64
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 97.82
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 97.56
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 97.51
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 97.45
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.29
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 97.28
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 97.06
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 96.11
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 96.01
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 95.89
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 94.51
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 91.85
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 91.54
d2c2la280 STIP1 homology and U box-containing protein 1, STU 91.31
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 87.76
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 82.36
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

Probab=99.64  E-value=4.3e-17  Score=108.01  Aligned_cols=58  Identities=29%  Similarity=0.770  Sum_probs=53.9

Q ss_pred             CCCCCCeeEEcccCCCCcccccccccCccccccHHHHHHHHHHcCCCccCCCCCeeEe
Q psy3116          34 DDEDMTICRICYGADQQNLLSICQCKGSIAYVHIECIERWLQECGVDKCDLCKYQFTT   91 (177)
Q Consensus        34 ~~~~~~~CRIC~~~~~~~Li~PC~C~Gs~~~VH~~CL~~Wi~~s~~~~CelC~~~y~~   91 (177)
                      .+++.++|+||+++.+++++.||.|+|+..++|..||++|++.+++.+|++|+++|++
T Consensus         2 eded~~~C~IC~~~~~~~~~~~c~c~~c~h~~H~~Cl~~W~~~~~~~~CP~Cr~~~~~   59 (60)
T d1vyxa_           2 EDEDVPVCWICNEELGNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNT   59 (60)
T ss_dssp             TTCSCCEETTTTEECSCCCCCSCCCSSGGGSCCHHHHHHHHHHHTCSBCTTTCCBCCC
T ss_pred             CCCCCCCCccCCccCCCceeEecccCCCCCEEcHHHHHHHHhhCCCCCCcccCCeeec
Confidence            3678899999998877889999999999999999999999999999999999999986
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure