Psyllid ID: psy318


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------44
MDGTTSDSSLPSKQYYEKLSNNEIQEDKHQEQIVKQLDNVYVSIKNYAPQSKSMFSFFQDKVKQPKGLYIYGAVGGGKTMLMDIFYESCETKQKQRVHFNKFMLDVHAKIHEVKKILARDKAKSYDPGVPNRLDVMKEEEEKEREREREREREREREREREREAKSYDPIPPVANDIISKTWLICFDEFQVTDIADAMILKRLFTELFQLGVVVVATSNRAPDDLYKNGLQRSNFLPFIDVLKTYCDVASLNSNIDYRSLKANAEESSTKTYFVKNFANEKKLHGIFKLLCSQENDIVRPRVITIMGRNVTFNKTCGQILEATFDELCSRDLGSSDYLHICQIFHTVIIRNVPQLNIKLRSQSRRFITLIDALYDNNIRLVISSDVPLNKLFSNEAVIDTHSDEHRMLMDDLNIKANDGTDANLKSNIFTVGTSCVNL
ccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccHHHHccccccccccEEEEEcccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEcccccccccccccccccccHHHHHHHHHHcEEEEcccccccccccccccccccEEEEcccHHHHHHHHHHHHHHHccccccccccEEEEcccEEEEccccccEEEEEHHHHHcccccHHHHHHHHccccEEEEcccccccccccHHHHHHHHHHHHHHHccccEEEEEcccHHHHcccccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHcccc
ccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHccccccccEEEEEccccccHHHHHHHHHHHcccccccEHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccEEEEcccEHHHHHHHHHHHHHHHHHHHcccEEEEEcccccHHHccccHHHHHHHHHHHHHHHcccEEEEccccccHHcccccccccEEEEccccHHHHHHHHHHHHHHHccccccccccEEEEEcEEEEEEcccccEEEEcHHHHccccccHHHHHHHHHHccEEEEcccccccHHHHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHcccccccccHHHHHHHHHHHcccccHHccccccccEEEEEHHcccc
mdgttsdsslpskqyyeklsnneiqedKHQEQIVKQLDNVYVSIKnyapqsksmFSFFQdkvkqpkglyiygavgggkTMLMDIFYESCETKQKQRVHFNKFMLDVHAKIHEVKKILArdkaksydpgvpnrldvmKEEEEKEREREREREREREREREREReaksydpippvandiisktwlicfdefqvtdIADAMILKRLFTELFQLGVVVVAtsnrapddlyknglqrsnflpfIDVLKTYCDVASLNSNIDYRSLKanaeesstktYFVKNFANEKKLHGIFKLLCsqendivrpRVITIMGRNVTFNKTCGQILEATFDElcsrdlgssdylHICQIFHTVIIRNVPQLNIKLRSQSRRFITLIDALYdnnirlvissdvplnklfsneavidthSDEHRMLMDDlnikandgtdanlksnIFTVGTSCVNL
mdgttsdsslpskqYYEKLSNNEIQEDKHQEQIVKQLDNVYVSIKNYAPQSKSMFSFFQDKVKQPKGLYIYGAVGGGKTMLMDIFYESCETKQKQRVHFNKFMLDVHAKIHEVKKilardkaksydpgvpnrldvmkeeeekerererererererererereaksydpippvanDIISKTWLICFDEFQVTDIADAMILKRLFTELFQLGVVVVATSnrapddlyknglqrsnFLPFIDVLKTYCDVASLNSNIDYRSLkanaeesstkTYFVKNFANEKKLHGIFKLLCSQENDIVRPRVITIMGRNVTFNKTCGQILEATFDELCSRDLGSSDYLHICQIFHTVIIRNVPQLNIKLRSQSRRFITLIDALYDNNIRLVISsdvplnklfSNEAVIDTHSDEHRMLMDDLNIKandgtdanlksniftvgtscvnl
MDGTTSDSSLPSKQYYEKLSNNEIQEDKHQEQIVKQLDNVYVSIKNYAPQSKSMFSFFQDKVKQPKGLYIYGAVGGGKTMLMDIFYESCETKQKQRVHFNKFMLDVHAKIHEVKKILARDKAKSYDPGVPNRLDVMkeeeekerererererererererereAKSYDPIPPVANDIISKTWLICFDEFQVTDIADAMILKRLFTELFQLGVVVVATSNRAPDDLYKNGLQRSNFLPFIDVLKTYCDVASLNSNIDYRSLKANAEESSTKTYFVKNFANEKKLHGIFKLLCSQENDIVRPRVITIMGRNVTFNKTCGQILEATFDELCSRDLGSSDYLHICQIFHTVIIRNVPQLNIKLRSQSRRFITLIDALYDNNIRLVISSDVPLNKLFSNEAVIDTHSDEHRMLMDDLNIKANDGTDANLKSNIFTVGTSCVNL
********************************IVKQLDNVYVSIKNYAPQSKSMFSFFQDKVKQPKGLYIYGAVGGGKTMLMDIFYESCETKQKQRVHFNKFMLDVHAKIHEVKKILAR****************************************************PVANDIISKTWLICFDEFQVTDIADAMILKRLFTELFQLGVVVVATSNRAPDDLYKNGLQRSNFLPFIDVLKTYCDVASLNSNIDYRSLKA******TKTYFVKNFANEKKLHGIFKLLCSQENDIVRPRVITIMGRNVTFNKTCGQILEATFDELCSRDLGSSDYLHICQIFHTVIIRNVPQLNIKLRSQSRRFITLIDALYDNNIRLVISSDVPLNKLFSNEAVIDTHS***RMLMDDLNIK*******NLKSNIFTVGT*****
************KQYYEKLSNNEIQEDKHQEQIVKQLDNVYVSIKNYAPQSK********KVKQPKGLYIYGAVGGGKTMLMDIFYESCETKQKQRVHFNKFMLDVHAKIHEVKKI**********PGVPNRLDVMKEEEEKERERERERERER**********KSYDPIPPVANDIISKTWLICFDEFQVTDIADAMILKRLFTELFQLGVVVVATSNRAPDDLYKNGLQRSNFLPFIDVLKTYCDVASLNSNIDYRSLKANAEESSTKTYFVKNFANEKKLHGIFKLLCSQ******PRVITIMGRNVTFNKTCGQILEATFDELCSRDLGSSDYLHICQIFHTVIIRNVPQLNIKLRSQSRRFITLIDALYDNNIRLVISSDVPLNKLFSNEAVIDT****************************FTVGTSCVNL
***********SKQYYEKLSNNEIQEDKHQEQIVKQLDNVYVSIKNYAPQSKSMFSFFQDKVKQPKGLYIYGAVGGGKTMLMDIFYESCETKQKQRVHFNKFMLDVHAKIHEVKKILARDKAKSYDPGVPNRLDVM*****************************SYDPIPPVANDIISKTWLICFDEFQVTDIADAMILKRLFTELFQLGVVVVATSNRAPDDLYKNGLQRSNFLPFIDVLKTYCDVASLNSNIDYRSLKANAEESSTKTYFVKNFANEKKLHGIFKLLCSQENDIVRPRVITIMGRNVTFNKTCGQILEATFDELCSRDLGSSDYLHICQIFHTVIIRNVPQLNIKLRSQSRRFITLIDALYDNNIRLVISSDVPLNKLFSNEAVIDTHSDEHRMLMDDLNIKANDGTDANLKSNIFTVGTSCVNL
*******SSLPSKQYYEKLSNNEIQEDKHQEQIVKQLDNVYVSIKNYAPQSKSMFSFFQDKVKQPKGLYIYGAVGGGKTMLMDIFYESCETKQKQRVHFNKFMLDVHAKIHEVKKILARD****************KEEEEKEREREREREREREREREREREAKSYDPIPPVANDIISKTWLICFDEFQVTDIADAMILKRLFTELFQLGVVVVATSNRAPDDLYKNGLQRSNFLPFIDVLKTYCDVASLNSNIDYRSLKANAEESSTKTYFVKNFANEKKLHGIFKLLCSQENDIVRPRVITIMGRNVTFNKTCGQILEATFDELCSRDLGSSDYLHICQIFHTVIIRNVPQLNIKLRSQSRRFITLIDALYDNNIRLVISSDVPLNKLFSNEAVIDTHSDEHRMLMDDLNIKANDGTDANLKSNIFTVGTSCVNL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGTTSDSSLPSKQYYEKLSNNEIQEDKHQEQIVKQLDNVYVSIKNYAPQSKSMFSFFQDKVKQPKGLYIYGAVGGGKTMLMDIFYESCETKQKQRVHFNKFMLDVHAKIHEVKKILARDKAKSYDPGVPNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKSYDPIPPVANDIISKTWLICFDEFQVTDIADAMILKRLFTELFQLGVVVVATSNRAPDDLYKNGLQRSNFLPFIDVLKTYCDVASLNSNIDYRSLKANAEESSTKTYFVKNFANEKKLHGIFKLLCSQENDIVRPRVITIMGRNVTFNKTCGQILEATFDELCSRDLGSSDYLHICQIFHTVIIRNVPQLNIKLRSQSRRFITLIDALYDNNIRLVISSDVPLNKLFSNEAVIDTHSDEHRMLMDDLNIKANDGTDANLKSNIFTVGTSCVNL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query438 2.2.26 [Sep-21-2011]
P46441464 Putative ATPase N2B OS=Ha N/A N/A 0.858 0.810 0.460 1e-106
Q3V384480 Lactation elevated protei yes N/A 0.826 0.754 0.451 2e-98
Q8WV93481 Lactation elevated protei yes N/A 0.826 0.752 0.434 3e-95
Q32PX9480 Lactation elevated protei yes N/A 0.826 0.754 0.441 7e-95
Q5TYS0503 Lactation elevated protei no N/A 0.710 0.618 0.447 1e-84
O42895454 Uncharacterized protein C yes N/A 0.776 0.748 0.315 4e-54
P64612375 Uncharacterized protein Y N/A N/A 0.748 0.874 0.297 1e-50
P64613375 Uncharacterized protein Y N/A N/A 0.748 0.874 0.297 1e-50
P32317509 Protein AFG1 OS=Saccharom yes N/A 0.785 0.675 0.308 2e-48
>sp|P46441|N2B_HAEIR Putative ATPase N2B OS=Haematobia irritans PE=2 SV=1 Back     alignment and function desciption
 Score =  385 bits (990), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 203/441 (46%), Positives = 278/441 (63%), Gaps = 65/441 (14%)

Query: 11  PSKQYYEKLSNNEIQEDKHQEQIVKQLDNVYVSIKNYAP-----QSKSMFSFFQDKVKQ- 64
           P + Y +++ + E+  DK Q++  ++L+++Y ++KNY P     ++ S   FF   +K+ 
Sbjct: 37  PMQAYEQRIESKELLPDKVQKKTTQELEDLYNTLKNYQPKPVRVETSSGGGFFGRFMKKE 96

Query: 65  -------------PKGLYIYGAVGGGKTMLMDIFYESCE-TKQKQRVHFNKFMLDVHAKI 110
                        PKG+YIYG+VGGGKT LMD+FY  C+   +KQRVHFN FM  VH  I
Sbjct: 97  QSAPKIELLNTTAPKGMYIYGSVGGGKTTLMDMFYSCCDDIPKKQRVHFNSFMSKVHGLI 156

Query: 111 HEVKKILARDKAKSYDPGVPNRLDVMKEEEEKEREREREREREREREREREREAKSYDPI 170
           H+VK                        +E   ++R    E+              +DP 
Sbjct: 157 HKVK------------------------QERGPQDRAFNSEK-----------PLPFDPT 181

Query: 171 PPVANDIISKTWLICFDEFQVTDIADAMILKRLFTELFQLGVVVVATSNRAPDDLYKNGL 230
            PVA  I +++WLICFDEFQVTDIADAMILK LFT LF  G+V +ATSNR P+DLYKNGL
Sbjct: 182 LPVAEMIANESWLICFDEFQVTDIADAMILKSLFTHLFNEGIVCIATSNRHPNDLYKNGL 241

Query: 231 QRSNFLPFIDVLKTYCDVASLNSNIDYRSLKANAEESSTKTYFVKNFANEK-KLHGIFKL 289
           QRSNF+PFI VL   C+VA+++S +DYR +     +S    YFV    + K ++  +FK+
Sbjct: 242 QRSNFIPFIGVLLNRCNVAAMDSGVDYRRIA----QSGDTNYFVTTQTDAKSQMERMFKI 297

Query: 290 LCSQENDIVRPRVITIMGRNVTFNKTCGQILEATFDELCSRDLGSSDYLHICQIFHTVII 349
           LCSQENDI+RPR IT  GR++TF +TCGQ+L++ F+ELC+R LG SDY+ I Q FHTV+I
Sbjct: 298 LCSQENDIIRPRTITHFGRDLTFQRTCGQVLDSNFEELCNRPLGGSDYIQIGQFFHTVLI 357

Query: 350 RNVPQLNIKLRSQSRRFITLIDALYDNNIRLVISSDVPLNKLFSNEAVIDTHSDEHRMLM 409
            +VPQL + L+SQ RRFITLID LYDN +R+VIS++VPL++LFS        +DE RMLM
Sbjct: 358 HDVPQLTLLLKSQMRRFITLIDTLYDNRVRVVISAEVPLDQLFSFTDKPKDLADEQRMLM 417

Query: 410 DDLNIKANDGTDANLKSNIFT 430
           DDL +      D +  +++FT
Sbjct: 418 DDLKLG-----DTDTSASVFT 433





Haematobia irritans (taxid: 7368)
>sp|Q3V384|LACE1_MOUSE Lactation elevated protein 1 OS=Mus musculus GN=Lace1 PE=2 SV=1 Back     alignment and function description
>sp|Q8WV93|LACE1_HUMAN Lactation elevated protein 1 OS=Homo sapiens GN=LACE1 PE=2 SV=2 Back     alignment and function description
>sp|Q32PX9|LACE1_RAT Lactation elevated protein 1 OS=Rattus norvegicus GN=Lace1 PE=2 SV=1 Back     alignment and function description
>sp|Q5TYS0|LCE1B_DANRE Lactation elevated protein 1 homolog B OS=Danio rerio GN=lace1b PE=2 SV=1 Back     alignment and function description
>sp|O42895|YBQ2_SCHPO Uncharacterized protein C115.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC115.02c PE=3 SV=1 Back     alignment and function description
>sp|P64612|YHCM_ECOLI Uncharacterized protein YhcM OS=Escherichia coli (strain K12) GN=yhcM PE=1 SV=1 Back     alignment and function description
>sp|P64613|YHCM_ECO57 Uncharacterized protein YhcM OS=Escherichia coli O157:H7 GN=yhcM PE=3 SV=1 Back     alignment and function description
>sp|P32317|AFG1_YEAST Protein AFG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFG1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query438
170047507464 ATPase n2b [Culex quinquefasciatus] gi|1 0.858 0.810 0.544 1e-124
189234955411 PREDICTED: similar to AGAP009867-PA [Tri 0.835 0.890 0.540 1e-122
270002336433 hypothetical protein TcasGA2_TC001347 [T 0.835 0.845 0.540 1e-122
345493794452 PREDICTED: putative ATPase N2B-like [Nas 0.863 0.836 0.536 1e-122
158298827470 AGAP009867-PA [Anopheles gambiae str. PE 0.858 0.8 0.522 1e-121
380027226450 PREDICTED: putative ATPase N2B-like [Api 0.840 0.817 0.544 1e-120
328786418453 PREDICTED: putative ATPase N2B-like [Api 0.840 0.812 0.542 1e-119
383847086451 PREDICTED: putative ATPase N2B-like [Meg 0.840 0.815 0.534 1e-118
307213991399 Putative ATPase N2B [Harpegnathos saltat 0.831 0.912 0.535 1e-118
332017145518 Putative ATPase N2B [Acromyrmex echinati 0.842 0.712 0.516 1e-118
>gi|170047507|ref|XP_001851260.1| ATPase n2b [Culex quinquefasciatus] gi|167869933|gb|EDS33316.1| ATPase n2b [Culex quinquefasciatus] Back     alignment and taxonomy information
 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 234/430 (54%), Positives = 288/430 (66%), Gaps = 54/430 (12%)

Query: 11  PSKQYYEKLSNNEIQEDKHQEQIVKQLDNVYVSIKNYAPQSKS-----MFSFFQ---DKV 62
           P +   +KLS  EI+ D HQ QI + L  VY SI+ Y P   +      F F     +KV
Sbjct: 48  PLELLQDKLSRGEIRPDPHQNQITEALQKVYDSIQGYEPPKPTGGIGKWFGFKARKAEKV 107

Query: 63  KQPKGLYIYGAVGGGKTMLMDIFYESCETKQKQRVHFNKFMLDVHAKIHEVKKILARDKA 122
           + PKGLYIYG+VGGGKTMLMD+FY+ CE  +K+RVHFN FM DVH KIHE+K    RD  
Sbjct: 108 EAPKGLYIYGSVGGGKTMLMDMFYDCCEINRKRRVHFNSFMTDVHTKIHEIKSKQVRDVT 167

Query: 123 KSYDPGVPNRLDVMKEEEEKEREREREREREREREREREREAKSYDPIPPVANDIISKTW 182
            +                                      + + +DPI PVA  I + +W
Sbjct: 168 ST--------------------------------------KPQPFDPIKPVAEIITADSW 189

Query: 183 LICFDEFQVTDIADAMILKRLFTELFQLGVVVVATSNRAPDDLYKNGLQRSNFLPFIDVL 242
           LICFDEFQVTDIADAMILKRLFT LF  GV+VVATSNRAPDDLYKNGLQRSNF+PFI VL
Sbjct: 190 LICFDEFQVTDIADAMILKRLFTYLFDSGVIVVATSNRAPDDLYKNGLQRSNFVPFIGVL 249

Query: 243 KTYCDVASLNSNIDYRSLKANAEESSTKTYFVKNFAN-EKKLHGIFKLLCSQENDIVRPR 301
           K++C+V +L+S +DYR+     E      YFVK+  + +  +  +FK+LCSQEND++RP+
Sbjct: 250 KSHCNVVTLSSGVDYRTATLKGEGMH---YFVKSEVDADGAMDKLFKVLCSQENDLIRPK 306

Query: 302 VITIMGRNVTFNKTCGQILEATFDELCSRDLGSSDYLHICQIFHTVIIRNVPQLNIKLRS 361
             T  GRN++F KTCGQ+L++TFDELC R LG+SDYL I Q FHTV+IR++PQLN+KL+S
Sbjct: 307 TFTHFGRNISFAKTCGQVLDSTFDELCDRPLGASDYLQITQFFHTVLIRDIPQLNLKLKS 366

Query: 362 QSRRFITLIDALYDNNIRLVISSDVPLNKLFSNEAVIDTH-SDEHRMLMDDLNIKANDGT 420
           Q+RRFITLID LYD+ +RLV+SSDVP   LFSNE   D H SDEHRMLMDDL I   D  
Sbjct: 367 QTRRFITLIDTLYDSRVRLVVSSDVPYKFLFSNEKPDDIHTSDEHRMLMDDLKI-TKDSQ 425

Query: 421 DANLKSNIFT 430
           DA+  SNIFT
Sbjct: 426 DAS--SNIFT 433




Source: Culex quinquefasciatus

Species: Culex quinquefasciatus

Genus: Culex

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189234955|ref|XP_973142.2| PREDICTED: similar to AGAP009867-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270002336|gb|EEZ98783.1| hypothetical protein TcasGA2_TC001347 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|345493794|ref|XP_003427154.1| PREDICTED: putative ATPase N2B-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|158298827|ref|XP_318985.4| AGAP009867-PA [Anopheles gambiae str. PEST] gi|157014073|gb|EAA14419.4| AGAP009867-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|380027226|ref|XP_003697330.1| PREDICTED: putative ATPase N2B-like [Apis florea] Back     alignment and taxonomy information
>gi|328786418|ref|XP_624398.2| PREDICTED: putative ATPase N2B-like [Apis mellifera] Back     alignment and taxonomy information
>gi|383847086|ref|XP_003699186.1| PREDICTED: putative ATPase N2B-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307213991|gb|EFN89198.1| Putative ATPase N2B [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332017145|gb|EGI57944.1| Putative ATPase N2B [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query438
FB|FBgn0033734458 CG8520 [Drosophila melanogaste 0.557 0.532 0.604 1.1e-98
MGI|MGI:2148801480 Lace1 "lactation elevated 1" [ 0.563 0.514 0.523 8.8e-96
UNIPROTKB|F1PD84480 LACE1 "Uncharacterized protein 0.563 0.514 0.511 3e-93
RGD|1561501480 Lace1 "lactation elevated 1" [ 0.563 0.514 0.515 7.9e-93
UNIPROTKB|Q8WV93481 LACE1 "Lactation elevated prot 0.563 0.513 0.507 7.9e-93
UNIPROTKB|E1BQ18480 LACE1 "Uncharacterized protein 0.563 0.514 0.511 1.6e-92
ZFIN|ZDB-GENE-091006-2471 lace1a "lactation elevated 1a" 0.579 0.539 0.511 3e-91
UNIPROTKB|E1C0S7493 LACE1 "Uncharacterized protein 0.563 0.501 0.527 3.8e-91
WB|WBGene00016261445 C30F12.2 [Caenorhabditis elega 0.584 0.575 0.469 2.5e-81
ZFIN|ZDB-GENE-041014-178516 lace1b "lactation elevated 1b" 0.584 0.496 0.471 3.2e-81
FB|FBgn0033734 CG8520 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 764 (274.0 bits), Expect = 1.1e-98, Sum P(3) = 1.1e-98
 Identities = 151/250 (60%), Positives = 192/250 (76%)

Query:   167 YDPIPPVANDIISKTWLICFDEFQVTDIADAMILKRLFTELFQLGVVVVATSNRAPDDLY 226
             +DP  PVA+ I S++WLICFDEFQVTDIADAM+LKRLFT LF+ G+VVVATSNR P+DLY
Sbjct:   175 FDPTKPVADLIASESWLICFDEFQVTDIADAMVLKRLFTHLFRHGIVVVATSNRHPEDLY 234

Query:   227 KNGLQRSNFLPFIDVLKTYCDVASLNSNIDYRSLKANAEESSTKTYFVKNFAN-EKKLHG 285
             KNGLQR+NFLPFI +L+  C V+ L+S IDYR +   A+   T  YFVK   + +  ++ 
Sbjct:   235 KNGLQRTNFLPFIALLQRRCKVSQLDS-IDYRRI---AQSGDTN-YFVKGQTDADGSMNR 289

Query:   286 IFKLLCSQENDIVRPRVITIMGRNVTFNKTCGQILEATFDELCSRDLGSSDYLHICQIFH 345
             +FK+LC++ENDI+RPR +T  GR++TFN+TCGQ+L++TF ELC R L  SD+L I Q FH
Sbjct:   290 MFKILCAEENDIIRPRTLTHFGRDLTFNRTCGQVLDSTFSELCDRPLAGSDFLQISQFFH 349

Query:   346 TVIIRNVPQLNIKLRSQSRRFITLIDALYDNNIRLVISSDVPLNKLFSNEAVIDTHSDEH 405
             TV+IR+VPQL + +++Q RRFITLID LY+N +R+VISSDV L  LFS      T SD  
Sbjct:   350 TVLIRDVPQLTLDVKAQMRRFITLIDTLYNNRVRVVISSDVALENLFSFTGGSKTLSDSE 409

Query:   406 RMLMDDLNIK 415
             R LMDDLNIK
Sbjct:   410 RTLMDDLNIK 419


GO:0016887 "ATPase activity" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
MGI|MGI:2148801 Lace1 "lactation elevated 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PD84 LACE1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1561501 Lace1 "lactation elevated 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WV93 LACE1 "Lactation elevated protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BQ18 LACE1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-091006-2 lace1a "lactation elevated 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C0S7 LACE1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00016261 C30F12.2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041014-178 lace1b "lactation elevated 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q32PX9LACE1_RATNo assigned EC number0.44190.82640.7541yesN/A
Q3V384LACE1_MOUSENo assigned EC number0.45180.82640.7541yesN/A
P32317AFG1_YEASTNo assigned EC number0.30880.78530.6758yesN/A
O42895YBQ2_SCHPONo assigned EC number0.31590.77620.7488yesN/A
Q8WV93LACE1_HUMANNo assigned EC number0.43450.82640.7525yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query438
COG1485367 COG1485, COG1485, Predicted ATPase [General functi 1e-113
pfam03969361 pfam03969, AFG1_ATPase, AFG1-like ATPase 4e-89
pfam03154979 pfam03154, Atrophin-1, Atrophin-1 family 1e-08
pfam03154979 pfam03154, Atrophin-1, Atrophin-1 family 1e-07
pfam03154979 pfam03154, Atrophin-1, Atrophin-1 family 6e-07
pfam03154979 pfam03154, Atrophin-1, Atrophin-1 family 2e-05
pfam0870180 pfam08701, GN3L_Grn1, GNL3L/Grn1 putative GTPase 5e-05
pfam12757126 pfam12757, DUF3812, Protein of unknown function (D 0.004
>gnl|CDD|224402 COG1485, COG1485, Predicted ATPase [General function prediction only] Back     alignment and domain information
 Score =  337 bits (867), Expect = e-113
 Identities = 131/387 (33%), Positives = 200/387 (51%), Gaps = 57/387 (14%)

Query: 11  PSKQYYEKLSNNEIQEDKHQEQIVKQLDNVYVSIKNYAPQSKSMFSFFQDKVKQPKGLYI 70
           P ++Y + +     Q D  Q      LD +Y  +       K++   F       +GLY+
Sbjct: 11  PVERYAQLVPAGTFQPDPAQPAAAAALDRLYDELVAPRSARKALGWLFGRDHGPVRGLYL 70

Query: 71  YGAVGGGKTMLMDIFYESCETKQKQRVHFNKFMLDVHAKIHEVKKILARDKAKSYDPGVP 130
           +G VG GKTMLMD+FYES   ++K+R+HF++FM  VH ++H ++             G  
Sbjct: 71  WGGVGRGKTMLMDLFYESLPGERKRRLHFHRFMARVHQRLHTLQ-------------GQT 117

Query: 131 NRLDVMKEEEEKEREREREREREREREREREREAKSYDPIPPVANDIISKTWLICFDEFQ 190
           +                                     P+PP+A+++ ++T ++CFDEF+
Sbjct: 118 D-------------------------------------PLPPIADELAAETRVLCFDEFE 140

Query: 191 VTDIADAMILKRLFTELFQLGVVVVATSNRAPDDLYKNGLQRSNFLPFIDVLKTYCDVAS 250
           VTDIADAMIL RL   LF  GVV+VATSN APD+LYK+GLQR  FLP ID++K++ +V +
Sbjct: 141 VTDIADAMILGRLLEALFARGVVLVATSNTAPDNLYKDGLQRERFLPAIDLIKSHFEVVN 200

Query: 251 LNSNIDYRSLKANAEESSTKTYFVK-NFANEKKLHGIFKLLCSQENDIVRPRVITIMGRN 309
           ++  +DYR  K          Y    +   E  L  ++  L     +      + I GR 
Sbjct: 201 VDGPVDYRLRKLEQAP----VYLTPLDAEAEAALDKLWAALSDGAPE--AAANLEIKGRE 254

Query: 310 VTFNKTCGQILEATFDELCSRDLGSSDYLHICQIFHTVIIRNVPQLNIKLRSQSRRFITL 369
           +      G +L   F +LC     +SDYL + + FHTV + +VPQ++   R ++RRFI L
Sbjct: 255 IRVPAVAGGLLWFDFAQLCEAPRSASDYLALAERFHTVFLTDVPQMDPLDRDEARRFIAL 314

Query: 370 IDALYDNNIRLVISSDVPLNKLFSNEA 396
           +D LYD  ++LV S++VPLN+L+    
Sbjct: 315 VDELYDRGVKLVASAEVPLNELYQGGR 341


Length = 367

>gnl|CDD|217821 pfam03969, AFG1_ATPase, AFG1-like ATPase Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|219978 pfam08701, GN3L_Grn1, GNL3L/Grn1 putative GTPase Back     alignment and domain information
>gnl|CDD|221756 pfam12757, DUF3812, Protein of unknown function (DUF3812) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 438
KOG2383|consensus467 100.0
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 100.0
COG1485367 Predicted ATPase [General function prediction only 100.0
PRK08939306 primosomal protein DnaI; Reviewed 99.79
PRK08181269 transposase; Validated 99.76
PRK08116268 hypothetical protein; Validated 99.75
PRK12377248 putative replication protein; Provisional 99.69
COG1484254 DnaC DNA replication protein [DNA replication, rec 99.69
PRK06526254 transposase; Provisional 99.69
PRK09183259 transposase/IS protein; Provisional 99.65
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 99.65
PRK06835329 DNA replication protein DnaC; Validated 99.65
PRK06921266 hypothetical protein; Provisional 99.61
PRK07952244 DNA replication protein DnaC; Validated 99.6
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.57
COG0593408 DnaA ATPase involved in DNA replication initiation 99.55
PRK08084235 DNA replication initiation factor; Provisional 99.49
PRK14087450 dnaA chromosomal replication initiation protein; P 99.47
PRK14086617 dnaA chromosomal replication initiation protein; P 99.45
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.44
PRK08727233 hypothetical protein; Validated 99.44
PRK05642234 DNA replication initiation factor; Validated 99.44
PRK12422445 chromosomal replication initiation protein; Provis 99.42
PRK14088440 dnaA chromosomal replication initiation protein; P 99.41
PRK00149450 dnaA chromosomal replication initiation protein; R 99.37
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.36
PRK06893229 DNA replication initiation factor; Validated 99.33
PRK06620214 hypothetical protein; Validated 99.27
KOG0734|consensus752 99.26
KOG0733|consensus 802 99.24
KOG0727|consensus408 99.24
KOG0733|consensus802 99.23
PRK09087226 hypothetical protein; Validated 99.18
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.08
KOG0730|consensus693 99.06
KOG0651|consensus388 98.95
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.94
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 98.94
KOG0736|consensus953 98.93
KOG0728|consensus404 98.91
PRK08903227 DnaA regulatory inactivator Hda; Validated 98.88
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 98.87
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 98.86
PRK03992389 proteasome-activating nucleotidase; Provisional 98.85
KOG0652|consensus424 98.84
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 98.84
CHL00176638 ftsH cell division protein; Validated 98.84
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 98.82
CHL00206 2281 ycf2 Ycf2; Provisional 98.81
PF00004132 AAA: ATPase family associated with various cellula 98.8
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 98.79
KOG0729|consensus435 98.77
KOG0735|consensus952 98.76
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.74
KOG0731|consensus774 98.72
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 98.72
CHL00195489 ycf46 Ycf46; Provisional 98.71
KOG0726|consensus440 98.7
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 98.68
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 98.67
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 98.5
PLN03025319 replication factor C subunit; Provisional 98.48
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.47
KOG0739|consensus439 98.37
PHA02544316 44 clamp loader, small subunit; Provisional 98.37
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 98.36
PRK12402337 replication factor C small subunit 2; Reviewed 98.35
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 98.29
KOG0732|consensus 1080 98.28
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.28
KOG0738|consensus491 98.25
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 98.23
PRK04195482 replication factor C large subunit; Provisional 98.21
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 98.18
KOG0730|consensus 693 98.17
TIGR02928365 orc1/cdc6 family replication initiation protein. M 98.15
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 98.15
PRK00411394 cdc6 cell division control protein 6; Reviewed 98.13
smart00382148 AAA ATPases associated with a variety of cellular 98.1
PRK00440319 rfc replication factor C small subunit; Reviewed 98.08
PTZ001121164 origin recognition complex 1 protein; Provisional 98.06
KOG0737|consensus386 98.06
PRK13341 725 recombination factor protein RarA/unknown domain f 98.06
PHA02244383 ATPase-like protein 98.05
PRK13342413 recombination factor protein RarA; Reviewed 98.05
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.03
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 98.03
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 98.02
COG2256436 MGS1 ATPase related to the helicase subunit of the 98.02
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 97.98
PHA00729226 NTP-binding motif containing protein 97.96
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 97.96
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 97.91
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 97.88
TIGR00763775 lon ATP-dependent protease La. This protein is ind 97.87
PRK07940394 DNA polymerase III subunit delta'; Validated 97.86
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 97.85
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.84
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 97.82
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.81
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 97.79
PHA02774613 E1; Provisional 97.77
PRK10865857 protein disaggregation chaperone; Provisional 97.77
PRK10865 857 protein disaggregation chaperone; Provisional 97.75
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.73
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 97.73
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 97.72
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 97.71
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 97.71
PF13173128 AAA_14: AAA domain 97.69
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 97.68
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 97.68
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 97.68
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 97.67
KOG0743|consensus457 97.67
cd03216163 ABC_Carb_Monos_I This family represents the domain 97.66
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 97.66
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 97.65
COG2884223 FtsE Predicted ATPase involved in cell division [C 97.65
KOG0744|consensus423 97.64
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 97.63
PRK13531498 regulatory ATPase RavA; Provisional 97.62
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 97.61
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 97.61
COG2255332 RuvB Holliday junction resolvasome, helicase subun 97.6
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 97.6
CHL00095821 clpC Clp protease ATP binding subunit 97.59
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 97.58
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 97.58
CHL00181287 cbbX CbbX; Provisional 97.57
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 97.56
PRK04296190 thymidine kinase; Provisional 97.55
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.55
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 97.53
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 97.53
PF05729166 NACHT: NACHT domain 97.52
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 97.51
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 97.5
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 97.49
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 97.49
KOG2028|consensus554 97.49
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 97.48
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 97.47
KOG0740|consensus428 97.46
PRK13695174 putative NTPase; Provisional 97.45
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 97.42
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 97.42
cd03246173 ABCC_Protease_Secretion This family represents the 97.42
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 97.42
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 97.41
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 97.4
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 97.4
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 97.39
COG0714329 MoxR-like ATPases [General function prediction onl 97.39
KOG0989|consensus346 97.38
PRK06067234 flagellar accessory protein FlaH; Validated 97.38
cd03239178 ABC_SMC_head The structural maintenance of chromos 97.37
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 97.37
cd03215182 ABC_Carb_Monos_II This family represents domain II 97.37
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 97.35
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 97.35
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 97.35
KOG0741|consensus 744 97.34
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 97.33
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 97.32
TIGR02688449 conserved hypothetical protein TIGR02688. Members 97.32
PRK09112351 DNA polymerase III subunit delta'; Validated 97.32
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 97.31
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 97.31
PF1355562 AAA_29: P-loop containing region of AAA domain 97.3
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 97.3
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 97.29
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 97.29
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 97.29
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 97.28
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 97.28
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 97.27
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.27
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 97.26
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 97.25
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 97.24
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 97.23
CHL00095 821 clpC Clp protease ATP binding subunit 97.23
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 97.23
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 97.2
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 97.2
COG1126240 GlnQ ABC-type polar amino acid transport system, A 97.19
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 97.19
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 97.16
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 97.16
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 97.15
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 97.14
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 97.13
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 97.12
smart00487201 DEXDc DEAD-like helicases superfamily. 97.12
PRK13889 988 conjugal transfer relaxase TraA; Provisional 97.12
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 97.12
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 97.12
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 97.11
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 97.1
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 97.09
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 97.08
cd03269210 ABC_putative_ATPase This subfamily is involved in 97.07
COG1136226 SalX ABC-type antimicrobial peptide transport syst 97.07
TIGR02974329 phageshock_pspF psp operon transcriptional activat 97.06
PRK15429686 formate hydrogenlyase transcriptional activator Fh 97.06
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 97.06
KOG0742|consensus630 97.06
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 97.06
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 97.06
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 97.05
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 97.04
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 97.03
PRK11331459 5-methylcytosine-specific restriction enzyme subun 97.02
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 97.01
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 97.01
PRK10619257 histidine/lysine/arginine/ornithine transporter su 97.0
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 96.99
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 96.98
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 96.98
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 96.97
PTZ00293211 thymidine kinase; Provisional 96.97
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 96.97
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 96.95
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 96.94
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 96.94
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 96.93
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 96.93
PRK08058329 DNA polymerase III subunit delta'; Validated 96.92
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 96.91
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 96.9
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 96.9
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 96.9
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 96.89
PRK10536262 hypothetical protein; Provisional 96.89
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 96.88
PRK11608326 pspF phage shock protein operon transcriptional ac 96.88
PRK07471365 DNA polymerase III subunit delta'; Validated 96.88
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 96.88
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 96.86
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 96.86
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 96.85
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 96.85
TIGR01817534 nifA Nif-specific regulatory protein. This model r 96.84
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 96.82
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 96.81
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 96.8
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 96.8
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 96.8
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 96.8
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 96.8
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 96.79
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 96.79
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.79
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 96.79
COG0470325 HolB ATPase involved in DNA replication [DNA repli 96.78
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 96.78
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 96.78
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 96.78
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.77
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 96.77
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 96.75
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 96.75
PRK13537306 nodulation ABC transporter NodI; Provisional 96.75
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 96.75
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 96.74
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 96.74
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 96.74
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 96.74
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 96.74
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 96.73
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 96.73
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 96.73
PRK05564313 DNA polymerase III subunit delta'; Validated 96.72
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 96.7
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 96.7
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 96.69
COG4133209 CcmA ABC-type transport system involved in cytochr 96.68
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 96.68
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 96.67
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 96.67
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 96.66
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 96.65
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 96.64
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 96.64
PRK13826 1102 Dtr system oriT relaxase; Provisional 96.64
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 96.63
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 96.6
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 96.6
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 96.6
PRK05022509 anaerobic nitric oxide reductase transcription reg 96.6
PRK11823446 DNA repair protein RadA; Provisional 96.6
PRK10253265 iron-enterobactin transporter ATP-binding protein; 96.6
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 96.59
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 96.58
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 96.58
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 96.57
KOG0991|consensus333 96.57
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 96.57
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 96.56
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 96.56
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 96.55
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 96.55
PRK10908222 cell division protein FtsE; Provisional 96.55
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 96.54
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 96.52
PRK08699325 DNA polymerase III subunit delta'; Validated 96.51
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 96.51
PRK05707328 DNA polymerase III subunit delta'; Validated 96.49
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 96.49
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 96.49
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 96.48
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 96.48
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 96.48
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 96.47
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 96.46
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 96.46
cd03299235 ABC_ModC_like Archeal protein closely related to M 96.46
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 96.46
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 96.45
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 96.45
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 96.44
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 96.44
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 96.43
KOG1514|consensus767 96.42
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 96.42
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 96.42
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 96.42
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 96.41
TIGR01069 771 mutS2 MutS2 family protein. Function of MutS2 is u 96.41
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 96.41
cd03286218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS 96.41
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 96.39
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 96.38
PRK09361225 radB DNA repair and recombination protein RadB; Pr 96.38
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 96.38
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 96.37
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 96.37
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 96.36
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 96.36
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 96.34
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 96.33
PRK10790592 putative multidrug transporter membrane\ATP-bindin 96.33
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 96.32
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 96.31
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 96.31
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 96.31
PRK15424538 propionate catabolism operon regulatory protein Pr 96.3
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 96.3
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 96.3
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 96.29
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 96.29
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 96.29
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 96.28
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 96.28
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 96.28
PRK05973237 replicative DNA helicase; Provisional 96.27
TIGR02329526 propionate_PrpR propionate catabolism operon regul 96.26
PRK13546264 teichoic acids export protein ATP-binding subunit; 96.26
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 96.25
PRK07399314 DNA polymerase III subunit delta'; Validated 96.24
PRK13536340 nodulation factor exporter subunit NodI; Provision 96.24
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 96.23
KOG1051|consensus898 96.23
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 96.22
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 96.22
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 96.21
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 96.2
PRK11153343 metN DL-methionine transporter ATP-binding subunit 96.2
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 96.19
COG3845501 ABC-type uncharacterized transport systems, ATPase 96.18
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 96.17
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 96.17
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 96.16
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 96.16
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 96.16
PRK09984262 phosphonate/organophosphate ester transporter subu 96.15
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 96.14
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 96.14
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 96.14
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 96.14
PRK10938490 putative molybdenum transport ATP-binding protein 96.13
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 96.13
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 96.12
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 96.12
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 96.11
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 96.11
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 96.1
PRK10789569 putative multidrug transporter membrane\ATP-bindin 96.1
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 96.08
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 96.08
PLN03211 659 ABC transporter G-25; Provisional 96.08
TIGR02237209 recomb_radB DNA repair and recombination protein R 96.08
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 96.07
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 96.07
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 96.07
PRK10070400 glycine betaine transporter ATP-binding subunit; P 96.06
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 96.02
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 96.02
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 96.02
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 96.01
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 96.01
COG4618580 ArpD ABC-type protease/lipase transport system, AT 95.99
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 95.99
PF02572172 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase 95.94
cd01394218 radB RadB. The archaeal protein radB shares simila 95.94
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 95.92
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 95.92
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 95.92
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 95.91
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 95.91
PF04851184 ResIII: Type III restriction enzyme, res subunit; 95.91
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 95.9
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 95.89
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 95.87
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 95.85
PRK10762501 D-ribose transporter ATP binding protein; Provisio 95.85
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 95.84
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.84
PRK11607377 potG putrescine transporter ATP-binding subunit; P 95.82
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 95.82
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 95.82
PRK00409 782 recombination and DNA strand exchange inhibitor pr 95.79
KOG0061|consensus 613 95.79
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 95.79
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 95.79
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 95.79
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 95.77
COG1117253 PstB ABC-type phosphate transport system, ATPase c 95.76
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 95.76
PRK08769319 DNA polymerase III subunit delta'; Validated 95.75
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 95.74
PRK06964342 DNA polymerase III subunit delta'; Validated 95.71
PRK03695248 vitamin B12-transporter ATPase; Provisional 95.71
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 95.7
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 95.68
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 95.67
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 95.67
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 95.65
PRK15064 530 ABC transporter ATP-binding protein; Provisional 95.63
PRK09473330 oppD oligopeptide transporter ATP-binding componen 95.63
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 95.63
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 95.61
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 95.61
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 95.59
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 95.59
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 95.55
COG4988559 CydD ABC-type transport system involved in cytochr 95.55
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 95.53
cd03115173 SRP The signal recognition particle (SRP) mediates 95.53
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 95.53
PRK04040188 adenylate kinase; Provisional 95.52
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 95.52
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 95.51
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 95.51
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 95.5
COG1221403 PspF Transcriptional regulators containing an AAA- 95.49
PRK13409590 putative ATPase RIL; Provisional 95.48
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 95.47
KOG0735|consensus 952 95.47
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 95.46
PF07726131 AAA_3: ATPase family associated with various cellu 95.45
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 95.45
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 95.45
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 95.43
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 95.42
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 95.41
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 95.41
PF1324576 AAA_19: Part of AAA domain 95.37
PRK00131175 aroK shikimate kinase; Reviewed 95.34
PRK13409 590 putative ATPase RIL; Provisional 95.34
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 95.31
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 95.31
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 95.31
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 95.3
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 95.3
PTZ00424401 helicase 45; Provisional 95.29
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 95.28
PLN03210 1153 Resistant to P. syringae 6; Provisional 95.28
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 95.27
PF00488235 MutS_V: MutS domain V C-terminus.; InterPro: IPR00 95.26
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 95.24
PRK10535 648 macrolide transporter ATP-binding /permease protei 95.22
PRK13764602 ATPase; Provisional 95.21
KOG0056|consensus790 95.2
PLN03232 1495 ABC transporter C family member; Provisional 95.18
PRK09862506 putative ATP-dependent protease; Provisional 95.17
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 95.17
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 95.16
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 95.13
PRK04841 903 transcriptional regulator MalT; Provisional 95.11
PRK04328249 hypothetical protein; Provisional 95.1
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 95.09
COG0606490 Predicted ATPase with chaperone activity [Posttran 95.06
COG0410237 LivF ABC-type branched-chain amino acid transport 95.05
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 95.0
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 95.0
COG1129500 MglA ABC-type sugar transport system, ATPase compo 94.99
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 94.98
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 94.97
>KOG2383|consensus Back     alignment and domain information
Probab=100.00  E-value=4.7e-99  Score=760.25  Aligned_cols=382  Identities=46%  Similarity=0.791  Sum_probs=339.9

Q ss_pred             CCChHHHHHHHHHcCCCCCCHHHHHHHHHHHHHHHHH-hhcCCCCC---------Ccc----ccccc----------cCC
Q psy318            8 SSLPSKQYYEKLSNNEIQEDKHQEQIVKQLDNVYVSI-KNYAPQSK---------SMF----SFFQD----------KVK   63 (438)
Q Consensus         8 ~~~p~~~Y~~~v~~g~l~~D~~Q~~a~~~L~~l~~~l-~~~~~~~~---------~~~----~~~~~----------~~~   63 (438)
                      ..+|+..|..+|..|.++.|++|+.++..+.+|+.++ +.|.|.-+         +|.    +.|.+          .+.
T Consensus        33 ~~tpl~~y~k~V~~g~l~~d~yq~~~~~~~~~L~~~~~e~y~p~~~~~~~~~e~~r~i~~l~k~~~~~k~~~~~a~~~~~  112 (467)
T KOG2383|consen   33 LLTPLKEYSKLVNTGTLKSDPYQRKTVSAFERLYHELIEYYDPRLKQWSAKREEGRWIFELKKSFDDGKLDTPNASGQPG  112 (467)
T ss_pred             ccCcchHHHhHhccCcccCCchhhhhHHHHHHHHhhhhhhcCccccccccchhhhhHHHHHHHHHhccCCCCcccccCCC
Confidence            4589999999999999999999999999999999954 44555421         111    11111          245


Q ss_pred             CCCceEEEccCCCCHhHHHHHHHHhh-hcccceeeechhhhHHHHHHHHHHHHHhhhcccCCCCCCCCCccccchHHHHH
Q psy318           64 QPKGLYIYGAVGGGKTMLMDIFYESC-ETKQKQRVHFNKFMLDVHAKIHEVKKILARDKAKSYDPGVPNRLDVMKEEEEK  142 (438)
Q Consensus        64 ~pkGlyL~G~vG~GKT~Lmd~f~~~l-~~~~k~R~Hf~~fm~~v~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  142 (438)
                      +||||||||+||||||||||+||+++ ++.+|+|+|||.||+.||++||+++++.+..+.             +      
T Consensus       113 ~PkGlYlYG~VGcGKTmLMDlFy~~~~~i~rkqRvHFh~fM~~VH~r~H~~k~~~~~~~~-------------~------  173 (467)
T KOG2383|consen  113 PPKGLYLYGSVGCGKTMLMDLFYDALPPIWRKQRVHFHGFMLSVHKRMHELKQEQGAEKP-------------G------  173 (467)
T ss_pred             CCceEEEecccCcchhHHHHHHhhcCCchhhhhhhhHHHHHHHHHHHHHHHHHhccccCc-------------c------
Confidence            69999999999999999999999888 578899999999999999999999887632110             0      


Q ss_pred             HHHHHHHHHHHHHHHHHHhhhccCCCCchHHHHHHhhcCCeEEEecCCCCChhhHHHHHHHHHHHHHCCCEEEEecCCCh
Q psy318          143 EREREREREREREREREREREAKSYDPIPPVANDIISKTWLICFDEFQVTDIADAMILKRLFTELFQLGVVVVATSNRAP  222 (438)
Q Consensus       143 ~~~~~~~~~~~~~~~~~r~~~~~~~d~i~~va~~~~~~~~lLc~DEf~v~d~~da~iL~~Lfn~l~~~g~~lV~TSN~~P  222 (438)
                                        ..++...||++.||.+++.++.||||||||++|++|||+|.+||..|+..|+++|+||||+|
T Consensus       174 ------------------~a~~~~~Dpl~~vA~eIa~ea~lLCFDEfQVTDVADAmiL~rLf~~Lf~~GvVlvATSNR~P  235 (467)
T KOG2383|consen  174 ------------------YAKSWEIDPLPVVADEIAEEAILLCFDEFQVTDVADAMILKRLFEHLFKNGVVLVATSNRAP  235 (467)
T ss_pred             ------------------ccccccCCccHHHHHHHhhhceeeeechhhhhhHHHHHHHHHHHHHHHhCCeEEEEeCCCCh
Confidence                              00112469999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhcCCCCcCCcccHHHHHHhhccccccccccchhccccccccCCCceeecCch-hHHHHHHHHHHHHcCCCCCCccCc
Q psy318          223 DDLYKNGLQRSNFLPFIDVLKTYCDVASLNSNIDYRSLKANAEESSTKTYFVKNF-ANEKKLHGIFKLLCSQENDIVRPR  301 (438)
Q Consensus       223 ~~L~~~gl~r~~F~p~I~~L~~~~~vv~ld~g~DyR~~~~~~~~~~~~~~~~~~~-~~~~~~~~~f~~l~~~~~~~~~~~  301 (438)
                      ++||+||+||+.|.|||+.|+++|.|+.|+|+.|||+...    ++++.||++++ +.+..++++|+.+++.+++...++
T Consensus       236 ~dLYknGlQR~~F~PfI~~L~~rc~vi~ldS~vDYR~~~~----~~~~~~yf~~~~d~~~~l~~~fk~~~~dq~d~~~~~  311 (467)
T KOG2383|consen  236 EDLYKNGLQRENFIPFIALLEERCKVIQLDSGVDYRRKAK----SAGENYYFISETDVETVLKEWFKLLAADQNDGTRQR  311 (467)
T ss_pred             HHHhhcchhhhhhhhHHHHHHHhheEEecCCccchhhccC----CCCceeEecChhhHHHHHHHHHHHHhccCCCCCCCc
Confidence            9999999999999999999999999999999999995443    46677887777 889999999999998888777888


Q ss_pred             eeccCCceEEeccccCcEEEeeHHHHhcCCCChhhHHHHhhccCEEEEcCCCCCCcCCchHHHHHHHHHHHhhhCCCeEE
Q psy318          302 VITIMGRNVTFNKTCGQILEATFDELCSRDLGSSDYLHICQIFHTVIIRNVPQLNIKLRSQSRRFITLIDALYDNNIRLV  381 (438)
Q Consensus       302 ~l~v~gR~l~v~~~~~~va~f~F~eLC~~plg~aDYl~la~~f~ti~i~~VP~l~~~~~n~arRFI~LID~lYd~~vkL~  381 (438)
                      +++|+||+|.||++|++||+|||+|||++|+||+|||.||++||||+|+|||+|++.++|++||||||||+|||+++||+
T Consensus       312 ~l~v~GR~l~vpk~cg~VA~ftFeeLC~rPlgAaDYL~lak~fhti~v~dIP~lsl~~r~~~rRFITliD~lYd~~~rlv  391 (467)
T KOG2383|consen  312 TLVVFGRKLIVPKACGGVADFTFEELCGRPLGAADYLGLAKNFHTIIVRDIPQLSLENRDQARRFITLIDALYDNHVRLV  391 (467)
T ss_pred             ceeeecceEEecccCCCcccccHHHHhCCccchHHHHHHHhhcceeEeeccchhhhHHHHHHhhHhHHHHHHhhccceEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEeCCChhhhccccccCCCCChHHHHhHhhhccccCCCCCccccccccccccc
Q psy318          382 ISSDVPLNKLFSNEAVIDTHSDEHRMLMDDLNIKANDGTDANLKSNIFTVGTS  434 (438)
Q Consensus       382 ~~a~~~~~~Lf~~~~~~~~~~d~~R~~~~~l~~~~~~~~~~~~~~~~f~~~~~  434 (438)
                      |+|++|+++||.........++..|++|||++++.+.    ..++++|+|+|.
T Consensus       392 ~sa~~p~~~Lf~~~~~~e~ls~s~r~~mddl~iks~~----~~~~~mf~g~EE  440 (467)
T KOG2383|consen  392 CSAATPLEELFQFTGHSEALSDSPRTLMDDLGIKSDS----AGGSPMFSGEEE  440 (467)
T ss_pred             ecCCCCHHHHhcccCcccccccCcccchhhhcccccC----ccccccccchHH
Confidence            9999999999998887677889999999999999766    478889999985



>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>KOG0728|consensus Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG1514|consensus Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>KOG1051|consensus Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>KOG0061|consensus Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF00488 MutS_V: MutS domain V C-terminus Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>KOG0056|consensus Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query438
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-13
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 6e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 4e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 5e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 5e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 72.2 bits (176), Expect = 1e-13
 Identities = 69/478 (14%), Positives = 149/478 (31%), Gaps = 108/478 (22%)

Query: 13  KQY---YEKLSNNEIQEDKHQEQIVKQLDNVYVSIKNYAPQS---KSMFSFFQDKVKQ-- 64
             Y      +   + Q        ++Q D +Y   + +A  +      +   +  + +  
Sbjct: 89  INYKFLMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELR 148

Query: 65  P-KGLYIYGAVGGGKTMLMDIFYESC-ETKQKQRVHFNKFMLDVHAKIHEVKKILARDKA 122
           P K + I G +G GKT +     + C   K + ++ F  F L++    +  + +L   + 
Sbjct: 149 PAKNVLIDGVLGSGKTWVA---LDVCLSYKVQCKMDFKIFWLNL-KNCNSPETVLEMLQK 204

Query: 123 KSY--DPGVPNRLDVMKEEE-EKERERERERERERERERERE-------REAKSYDPIPP 172
             Y  DP   +R D     +      +   R   + +  E         + AK+++    
Sbjct: 205 LLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLNVQNAKAWN---- 260

Query: 173 VANDIISKTWLICFDEFQVTDIADAMILKRL--------FTELFQLGVVVVATSNRAPDD 224
            A ++  K  L    + QVTD   A     +         T      +++     R P D
Sbjct: 261 -AFNLSCKILLTTRFK-QVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCR-PQD 317

Query: 225 L------------------YKNGLQRSNFLPFIDVLKTYCDVASLNSNIDYRSLKANAEE 266
           L                   ++GL   +    ++  K       L + I+  SL    E 
Sbjct: 318 LPREVLTTNPRRLSIIAESIRDGLATWDNWKHVNCDK-------LTTIIE-SSLN-VLEP 368

Query: 267 SSTKTYFVKNFANEKKLHGIFKLLCSQENDIVRPRVITIMGRNVTFNKTCGQILEATFDE 326
           +  +  F    +       +F       +  +   +++++  +V  +     ++    ++
Sbjct: 369 AEYRKMF-DRLS-------VF-----PPSAHIPTILLSLIWFDVIKS-DVMVVV----NK 410

Query: 327 LCSRDLGSSD------YLHICQIFHTVIIRNVPQLNIKLRSQSRRFITLIDALYDNNIRL 380
           L    L           +    +   V + N   L+  +          I   +D++  +
Sbjct: 411 LHKYSLVEKQPKESTISIPSIYLELKVKLENEYALHRSIVDHYN-----IPKTFDSDDLI 465

Query: 381 VISSDVPLNKLFS------NEAVIDTHSDEHRMLMDDLN-IKA---NDGTDANLKSNI 428
               D      +S                  RM+  D   ++    +D T  N   +I
Sbjct: 466 PPYLD---QYFYSHIGHHLKNIEHPERMTLFRMVFLDFRFLEQKIRHDSTAWNASGSI 520


>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query438
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 99.71
2qgz_A308 Helicase loader, putative primosome component; str 99.7
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 99.66
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 99.28
2kjq_A149 DNAA-related protein; solution structure, NESG, st 99.27
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 99.24
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.2
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 99.18
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 99.17
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 99.17
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 99.16
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 99.13
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.01
3bos_A242 Putative DNA replication factor; P-loop containing 98.98
3co5_A143 Putative two-component system transcriptional RES 98.97
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 98.9
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 98.89
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 98.86
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 98.82
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 98.79
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 98.79
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 98.76
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 98.75
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 98.74
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 98.72
2r62_A268 Cell division protease FTSH homolog; ATPase domain 98.69
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 98.63
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.58
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 98.58
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 98.55
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.54
2chg_A226 Replication factor C small subunit; DNA-binding pr 98.54
2v1u_A387 Cell division control protein 6 homolog; DNA repli 98.54
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 98.53
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 98.51
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 98.5
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 98.47
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 98.46
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 98.46
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 98.46
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 98.43
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 98.43
3pvs_A447 Replication-associated recombination protein A; ma 98.41
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 98.4
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 98.38
1ojl_A304 Transcriptional regulatory protein ZRAR; response 98.38
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 98.36
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 98.34
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 98.33
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 98.33
1tue_A212 Replication protein E1; helicase, replication, E1E 98.32
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 98.3
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 98.3
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 98.28
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 98.22
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 98.22
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 98.2
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 98.15
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 98.15
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 98.15
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 98.14
2r44_A331 Uncharacterized protein; putative ATPase, structur 98.12
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 98.09
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 98.06
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 98.04
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 98.03
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 98.03
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 97.97
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 97.92
2chq_A319 Replication factor C small subunit; DNA-binding pr 97.88
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 97.87
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 97.87
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 97.87
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 97.86
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 97.82
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 97.82
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 97.81
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 97.81
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 97.8
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 97.76
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.76
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 97.72
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 97.68
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 97.67
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.66
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 97.66
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 97.6
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 97.57
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.49
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 97.41
2fna_A357 Conserved hypothetical protein; structural genomic 97.39
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 97.31
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.28
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 97.27
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 97.26
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 97.23
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 97.23
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.21
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 97.19
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 97.18
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 97.16
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 97.12
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.1
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 97.03
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 97.01
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 96.96
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 96.96
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 96.95
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 96.95
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 96.9
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 96.87
1sgw_A214 Putative ABC transporter; structural genomics, P p 96.81
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 96.8
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 96.76
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 96.73
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 96.72
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 96.71
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 96.67
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 96.66
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 96.66
2cvh_A220 DNA repair and recombination protein RADB; filamen 96.65
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 96.63
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 96.56
4a74_A231 DNA repair and recombination protein RADA; hydrola 96.5
3cmw_A1706 Protein RECA, recombinase A; homologous recombinat 96.49
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 96.42
1u94_A356 RECA protein, recombinase A; homologous recombinat 96.42
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 96.41
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 96.41
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 96.33
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 96.31
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 96.3
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 96.29
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 96.26
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 96.25
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 96.24
2eyu_A261 Twitching motility protein PILT; pilus retraction 96.23
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 96.2
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 96.19
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 96.18
2gno_A305 DNA polymerase III, gamma subunit-related protein; 96.17
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 96.12
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 96.1
2z43_A324 DNA repair and recombination protein RADA; archaea 96.1
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 96.09
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 96.03
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 95.99
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 95.97
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 95.96
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 95.95
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 95.93
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 95.91
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 95.9
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 95.89
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 95.86
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 95.84
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 95.83
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 95.83
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 95.82
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 95.81
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 95.81
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 95.78
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 95.78
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 95.77
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 95.76
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 95.73
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 95.66
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 95.61
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 95.57
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 95.54
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 95.53
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 95.52
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 95.51
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 95.49
1xp8_A366 RECA protein, recombinase A; recombination, radior 95.45
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 95.45
2r6a_A454 DNAB helicase, replicative helicase; replication, 95.42
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 95.37
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 95.34
2ewv_A372 Twitching motility protein PILT; pilus retraction 95.34
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 95.18
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 95.18
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 95.14
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 95.12
3bor_A237 Human initiation factor 4A-II; translation initiat 95.1
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 95.09
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 95.04
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 95.02
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 94.96
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 94.94
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 94.9
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 94.79
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 94.76
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 94.74
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 94.72
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 94.64
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 94.63
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 94.61
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 94.61
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 94.58
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 94.55
1kag_A173 SKI, shikimate kinase I; transferase, structural g 94.51
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 94.49
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 94.39
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 94.38
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 94.28
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 94.28
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 94.23
3vaa_A199 Shikimate kinase, SK; structural genomics, center 94.03
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 94.01
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 93.98
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 93.96
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 93.89
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 93.82
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 93.75
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 93.75
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 93.71
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 93.7
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 93.62
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 93.62
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 93.58
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 93.57
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 93.49
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 93.46
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 93.42
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 93.4
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 93.35
1yks_A440 Genome polyprotein [contains: flavivirin protease 93.31
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 93.31
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 93.31
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 93.3
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 93.29
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 93.29
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 93.28
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 93.27
2vli_A183 Antibiotic resistance protein; transferase, tunica 93.22
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 93.15
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 93.06
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 93.05
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 93.04
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 93.03
1via_A175 Shikimate kinase; structural genomics, transferase 93.01
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 93.01
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 92.99
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 92.97
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 92.95
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 92.9
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 92.9
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 92.89
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 92.89
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 92.88
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 92.85
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 92.83
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 92.79
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 92.78
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 92.75
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 92.74
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 92.73
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 92.67
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 92.67
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 92.57
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 92.56
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 92.56
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 92.55
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 92.52
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 92.5
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 92.43
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 92.42
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 92.4
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 92.31
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 92.24
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 92.24
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 92.23
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 92.23
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 92.18
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 92.17
3kta_A182 Chromosome segregation protein SMC; structural mai 92.14
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 92.12
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 92.12
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 92.1
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 91.99
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 91.98
3b6e_A216 Interferon-induced helicase C domain-containing P; 91.94
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 91.91
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 91.84
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 91.8
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 91.79
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 91.79
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 91.74
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 91.72
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 91.66
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 91.59
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 91.58
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 91.57
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 91.49
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 91.48
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 91.4
1vma_A306 Cell division protein FTSY; TM0570, structural gen 91.28
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 91.27
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 91.26
3tlx_A243 Adenylate kinase 2; structural genomics, structura 91.17
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 91.15
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 91.14
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 91.08
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 91.01
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 91.0
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 90.98
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 90.97
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 90.95
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 90.88
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 90.87
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 90.86
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 90.85
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 90.74
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 90.69
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 90.57
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 90.55
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 90.42
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 90.1
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 90.01
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 90.0
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 89.95
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 89.87
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 89.66
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 89.6
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 89.44
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 89.44
2oap_1511 GSPE-2, type II secretion system protein; hexameri 89.44
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 89.37
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 89.34
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 89.28
2ged_A193 SR-beta, signal recognition particle receptor beta 89.13
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 89.05
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 89.04
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 88.9
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 88.89
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 88.85
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 88.79
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 88.61
1p9r_A418 General secretion pathway protein E; bacterial typ 88.48
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 88.47
1ji0_A240 ABC transporter; ATP binding protein, structural g 88.46
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 88.44
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 88.4
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 88.36
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 88.34
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 88.34
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 88.21
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 88.18
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 88.15
1g6h_A257 High-affinity branched-chain amino acid transport 88.13
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 88.1
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 88.1
3r20_A233 Cytidylate kinase; structural genomics, seattle st 87.89
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 87.88
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 87.88
1b0u_A262 Histidine permease; ABC transporter, transport pro 87.84
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 87.82
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 87.82
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 87.8
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 87.78
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 87.76
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 87.75
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 87.65
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 87.64
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 87.62
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 87.59
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 87.58
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 87.56
1g6h_A257 High-affinity branched-chain amino acid transport 87.55
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 87.5
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 87.47
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 87.42
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 87.41
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 87.36
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 87.28
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 87.26
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 87.24
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 87.18
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 87.13
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 87.13
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 87.08
2wji_A165 Ferrous iron transport protein B homolog; membrane 87.08
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 87.08
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 87.06
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 87.04
2ghi_A260 Transport protein; multidrug resistance protein, M 87.03
1e69_A322 Chromosome segregation SMC protein; structural mai 86.95
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 86.94
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 86.89
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 86.88
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 86.85
1nrj_B218 SR-beta, signal recognition particle receptor beta 86.81
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 86.8
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 86.77
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 86.72
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 86.71
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 86.65
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 86.63
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 86.57
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 86.54
3h1t_A590 Type I site-specific restriction-modification syst 86.49
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 86.32
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 86.31
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 86.29
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 86.27
1b0u_A262 Histidine permease; ABC transporter, transport pro 86.27
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 86.26
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 86.21
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 86.2
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 86.18
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 86.17
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 86.08
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 86.07
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 86.07
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 86.03
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 86.02
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 85.97
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 85.96
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 85.82
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 85.81
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 85.8
1ji0_A240 ABC transporter; ATP binding protein, structural g 85.79
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 85.71
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 85.64
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 85.56
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 85.55
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 85.54
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 85.53
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 85.51
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 85.5
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 85.5
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 85.44
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 85.37
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 85.36
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 85.33
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 85.28
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 85.23
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 85.18
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 85.1
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 85.05
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 85.02
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 84.95
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 84.88
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 84.81
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 84.73
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 84.66
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 84.56
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 84.54
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 84.49
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 84.48
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 84.33
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 84.32
1xjc_A169 MOBB protein homolog; structural genomics, midwest 84.31
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 84.26
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 84.22
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 84.17
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 84.12
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 84.07
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 84.06
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 84.03
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 83.94
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 83.93
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 83.9
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 83.79
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 83.77
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 83.75
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 83.7
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 83.66
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 83.6
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 83.59
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 83.58
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 83.55
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 83.53
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 83.51
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 83.46
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 83.46
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 83.45
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 83.38
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 83.29
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 83.29
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 83.28
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 83.28
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 83.27
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 83.18
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 83.13
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 83.12
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 83.11
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 83.1
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 83.01
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 82.95
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 82.93
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 82.86
2www_A349 Methylmalonic aciduria type A protein, mitochondri 82.85
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 82.85
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 82.82
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 82.8
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 82.79
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 82.71
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 82.67
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
Probab=99.71  E-value=4.5e-17  Score=149.19  Aligned_cols=159  Identities=14%  Similarity=0.202  Sum_probs=106.2

Q ss_pred             CHHHHHHHHHHHHHHHHHhhcCCCCCCccccccccCCCCCceEEEccCCCCHhHHHHHHHHhhhcccceee---echhhh
Q psy318           27 DKHQEQIVKQLDNVYVSIKNYAPQSKSMFSFFQDKVKQPKGLYIYGAVGGGKTMLMDIFYESCETKQKQRV---HFNKFM  103 (438)
Q Consensus        27 D~~Q~~a~~~L~~l~~~l~~~~~~~~~~~~~~~~~~~~pkGlyL~G~vG~GKT~Lmd~f~~~l~~~~k~R~---Hf~~fm  103 (438)
                      ++.|..++..+..+...   +.            ....++++||||++|+|||+|+.++++.+... ..++   +...++
T Consensus        31 ~~~~~~~~~~~~~~~~~---~~------------~~~~~~~~~l~G~~GtGKT~la~~i~~~~~~~-~~~~~~~~~~~~~   94 (202)
T 2w58_A           31 DDGRIKAIRFAERFVAE---YE------------PGKKMKGLYLHGSFGVGKTYLLAAIANELAKR-NVSSLIVYVPELF   94 (202)
T ss_dssp             SHHHHHHHHHHHHHHHH---CC------------SSCCCCEEEEECSTTSSHHHHHHHHHHHHHTT-TCCEEEEEHHHHH
T ss_pred             ChhHHHHHHHHHHHHHH---hh------------hccCCCeEEEECCCCCCHHHHHHHHHHHHHHc-CCeEEEEEhHHHH
Confidence            55777777776665442   10            01124899999999999999999999988533 2333   334333


Q ss_pred             HHHHHHHHHHHHHhhhcccCCCCCCCCCccccchHHHHHHHHHHHHHHHHHHHHHHHhhhccCCCCchHHHHHHhhcCCe
Q psy318          104 LDVHAKIHEVKKILARDKAKSYDPGVPNRLDVMKEEEEKEREREREREREREREREREREAKSYDPIPPVANDIISKTWL  183 (438)
Q Consensus       104 ~~v~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~d~i~~va~~~~~~~~l  183 (438)
                      ..+...+   .                                                    .+.+..+. ..+.++++
T Consensus        95 ~~~~~~~---~----------------------------------------------------~~~~~~~~-~~~~~~~~  118 (202)
T 2w58_A           95 RELKHSL---Q----------------------------------------------------DQTMNEKL-DYIKKVPV  118 (202)
T ss_dssp             HHHHHC----------------------------------------------------------CCCHHHH-HHHHHSSE
T ss_pred             HHHHHHh---c----------------------------------------------------cchHHHHH-HHhcCCCE
Confidence            3322110   0                                                    00112222 23456789


Q ss_pred             EEEecCCCCCh---hhHHHHHHHHHHHHHCCCEEEEecCCChhhhhcCC-------CCcCCcccHHHHHHhhcccccccc
Q psy318          184 ICFDEFQVTDI---ADAMILKRLFTELFQLGVVVVATSNRAPDDLYKNG-------LQRSNFLPFIDVLKTYCDVASLNS  253 (438)
Q Consensus       184 Lc~DEf~v~d~---~da~iL~~Lfn~l~~~g~~lV~TSN~~P~~L~~~g-------l~r~~F~p~I~~L~~~~~vv~ld~  253 (438)
                      |||||++....   ..+.++..+++..+..+..+|+|||.+|.+|...-       .+.....++++||.++|.++.++ 
T Consensus       119 lilDei~~~~~~~~~~~~ll~~~l~~~~~~~~~~i~tsn~~~~~l~~~~~~~~~~~~~~~~~~~~~~Rl~~~~~~~~~~-  197 (202)
T 2w58_A          119 LMLDDLGAEAMSSWVRDDVFGPILQYRMFENLPTFFTSNFDMQQLAHHLTYSQRGEEEKVKAARIMERIRYLAYPIEIT-  197 (202)
T ss_dssp             EEEEEECCC---CCGGGTTHHHHHHHHHHTTCCEEEEESSCHHHHHHHSCCCC-----CCHHHHHHHHHHHHEEEEECC-
T ss_pred             EEEcCCCCCcCCHHHHHHHHHHHHHHHHhCCCCEEEEcCCCHHHHHHHHhhhccCcchhHHHHHHHHHHHHhceEEeec-
Confidence            99999987532   22335667888888888899999999999998731       23445788999999999999999 


Q ss_pred             ccchh
Q psy318          254 NIDYR  258 (438)
Q Consensus       254 g~DyR  258 (438)
                      |.|||
T Consensus       198 g~~~R  202 (202)
T 2w58_A          198 GPNRR  202 (202)
T ss_dssp             SCCCC
T ss_pred             CCCCC
Confidence            89998



>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query438
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.57
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.02
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 98.96
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 98.95
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 98.85
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.77
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 98.55
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 98.51
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 98.48
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 98.29
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 98.28
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.19
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 98.1
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 98.1
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.08
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.07
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 98.05
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 97.99
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 97.96
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 97.89
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.82
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 97.77
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.74
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.62
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.43
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 97.23
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 97.1
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 97.1
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 97.09
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 97.02
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 97.02
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.01
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.01
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 96.98
d2awna2232 Maltose transport protein MalK, N-terminal domain 96.97
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 96.96
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 96.93
d1g2912240 Maltose transport protein MalK, N-terminal domain 96.92
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 96.92
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 96.91
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 96.81
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 96.79
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.75
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 96.75
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.72
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 96.69
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 96.68
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.67
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 96.66
d1svma_362 Papillomavirus large T antigen helicase domain {Si 96.51
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.46
d2hyda1255 Putative multidrug export ATP-binding/permease pro 96.39
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 96.38
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.34
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 96.25
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.24
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 96.1
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.08
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.01
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 95.88
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 95.86
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.78
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.75
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 95.73
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 95.69
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 95.6
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.51
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 95.5
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 95.43
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 95.41
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 95.4
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 95.38
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.27
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 95.26
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.22
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.0
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 94.88
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 94.85
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 94.83
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 94.82
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 94.75
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.74
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 94.74
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.73
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 94.59
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 94.58
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 94.53
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 94.52
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 94.48
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 94.34
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.31
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 94.28
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 94.25
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 94.24
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.12
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.08
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 94.04
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 93.99
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 93.96
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 93.77
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 93.74
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 93.5
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 93.24
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 93.18
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 93.03
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 93.0
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 92.93
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 92.87
d1tuea_205 Replication protein E1 helicase domain {Human papi 92.73
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 92.66
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 92.62
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 92.29
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 92.28
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 92.26
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 92.13
d1j8yf2211 GTPase domain of the signal sequence recognition p 91.92
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 91.85
d2qy9a2211 GTPase domain of the signal recognition particle r 91.64
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 91.48
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 91.44
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 91.4
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 91.4
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 91.3
d1ls1a2207 GTPase domain of the signal sequence recognition p 91.16
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 91.15
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 91.11
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 91.01
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 91.0
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 90.97
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 90.94
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 90.9
d1okkd2207 GTPase domain of the signal recognition particle r 90.76
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 90.53
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 90.32
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 90.19
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 90.14
d2fh5b1207 Signal recognition particle receptor beta-subunit 90.01
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 89.95
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 89.85
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 89.82
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 89.72
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 89.61
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 88.91
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 88.64
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 88.45
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 88.14
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 88.03
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 87.91
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 87.77
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 87.47
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 87.32
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 87.28
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 87.27
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 87.16
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 87.09
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 87.02
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 86.99
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 86.92
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 86.76
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 86.71
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 86.68
d1vmaa2213 GTPase domain of the signal recognition particle r 86.64
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 86.57
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 86.4
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 86.04
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 85.94
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 85.83
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 85.79
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 85.65
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 85.56
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 85.52
d1nrjb_209 Signal recognition particle receptor beta-subunit 85.5
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 85.29
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 85.28
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 85.25
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 85.25
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 85.11
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 85.08
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 85.05
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 84.96
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 84.96
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 84.93
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 84.74
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 84.59
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 84.58
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 84.52
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 84.44
d1f9va_342 Kinesin motor Ncd (non-claret disjunctional) {Bake 84.06
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 83.99
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 83.86
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 83.72
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 83.59
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 83.57
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 83.46
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 83.43
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 83.41
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 83.31
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 83.26
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 83.25
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 83.2
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 83.06
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 83.06
d1sdma_364 Kinesin heavy chain-like protein {Potato (Solanum 83.02
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 82.51
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 82.39
d2ncda_368 Kinesin motor Ncd (non-claret disjunctional) {Frui 82.38
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 82.18
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 82.01
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 81.91
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 81.84
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 81.74
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 81.63
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 81.57
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 81.49
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 81.44
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 81.39
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 81.38
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 81.29
d1x88a1345 Kinesin {Human (Homo sapiens), mitotic kinesin eg5 81.28
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 81.26
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 81.13
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 81.11
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 81.02
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 80.77
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 80.29
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 80.11
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 80.06
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Chromosomal replication initiation factor DnaA
species: Aquifex aeolicus [TaxId: 63363]
Probab=99.57  E-value=1.2e-14  Score=134.80  Aligned_cols=126  Identities=20%  Similarity=0.302  Sum_probs=88.0

Q ss_pred             CceEEEccCCCCHhHHHHHHHHhhhcccceeeechhhhHHHHHHHHHHHHHhhhcccCCCCCCCCCccccchHHHHHHHH
Q psy318           66 KGLYIYGAVGGGKTMLMDIFYESCETKQKQRVHFNKFMLDVHAKIHEVKKILARDKAKSYDPGVPNRLDVMKEEEEKERE  145 (438)
Q Consensus        66 kGlyL~G~vG~GKT~Lmd~f~~~l~~~~k~R~Hf~~fm~~v~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  145 (438)
                      +++||||++|+|||||+.++.+.+..+ ..++.|-..-....+........                             
T Consensus        37 n~l~l~G~~G~GKTHLl~A~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~-----------------------------   86 (213)
T d1l8qa2          37 NPIFIYGSVGTGKTHLLQAAGNEAKKR-GYRVIYSSADDFAQAMVEHLKKG-----------------------------   86 (213)
T ss_dssp             SSEEEECSSSSSHHHHHHHHHHHHHHT-TCCEEEEEHHHHHHHHHHHHHHT-----------------------------
T ss_pred             CcEEEECCCCCcHHHHHHHHHHHhccC-ccceEEechHHHHHHHHHHHHcc-----------------------------
Confidence            569999999999999999999988533 45666644322222111111111                             


Q ss_pred             HHHHHHHHHHHHHHHhhhccCCCCchHHHHHHhhcCCeEEEecCCCC--ChhhHHHHHHHHHHHHHCCCEEEEecCCChh
Q psy318          146 REREREREREREREREREAKSYDPIPPVANDIISKTWLICFDEFQVT--DIADAMILKRLFTELFQLGVVVVATSNRAPD  223 (438)
Q Consensus       146 ~~~~~~~~~~~~~~r~~~~~~~d~i~~va~~~~~~~~lLc~DEf~v~--d~~da~iL~~Lfn~l~~~g~~lV~TSN~~P~  223 (438)
                                             .... ..+.+..+++|||||++..  ...++..||+++|.+.+.|+.+|+||+.+|.
T Consensus        87 -----------------------~~~~-~~~~~~~~dll~iDDi~~i~~~~~~~~~lf~lin~~~~~~~~iiits~~~p~  142 (213)
T d1l8qa2          87 -----------------------TINE-FRNMYKSVDLLLLDDVQFLSGKERTQIEFFHIFNTLYLLEKQIILASDRHPQ  142 (213)
T ss_dssp             -----------------------CHHH-HHHHHHTCSEEEEECGGGGTTCHHHHHHHHHHHHHHHHTTCEEEEEESSCGG
T ss_pred             -----------------------chhh-HHHHHhhccchhhhhhhhhcCchHHHHHHHHHHHHHhhccceEEEecCCcch
Confidence                                   0111 3455679999999999986  4667888999999999999999999999999


Q ss_pred             hhhcCCCCcCCcccHHHHHHhhccccccc
Q psy318          224 DLYKNGLQRSNFLPFIDVLKTYCDVASLN  252 (438)
Q Consensus       224 ~L~~~gl~r~~F~p~I~~L~~~~~vv~ld  252 (438)
                      +|..  +.    ..+.+||.. +.++.++
T Consensus       143 ~l~~--~~----~dL~SRL~~-g~~~~i~  164 (213)
T d1l8qa2         143 KLDG--VS----DRLVSRFEG-GILVEIE  164 (213)
T ss_dssp             GCTT--SC----HHHHHHHHT-SEEEECC
T ss_pred             hccc--cc----hHHHHHhhC-ceEEEEC
Confidence            9952  21    135666654 4455554



>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure