Psyllid ID: psy3301

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------61

MVMKVSLRRNVRILLLGDRHVGKTSLILSLVSEEFPELVPSKAEEITIPPDVTPEMVPTHIVDYSEVDQTVDELTEEIQKAHVICLVYSVVDDASIDRLSSHWLPFLRNCLVDTCLPIVLVGNKVDLVDYSTVESSAKTLKNISEMFYYAQKAVLHPMAPIYISDKQELTPECIKALTRIFKVCDLDNDNLLSDKELNAFQRRCFDAPLSRDSLEDVKIVIRKNINDGVSANNCITLNGFLFLHNLFMQRGRSHTTWTVLRKFGYNEDLQISKEFLHPPLNIPATCTAELSDKGQQFLTTLFYRFDKDGDGALSPEEQARLFSLCPPECPPWTDREMRAMVATNSKGWITMQGFLCYWILTTLFNVNKTLEYLAYFGYPITDRENQTSGVLVTREKQVDLLKKQTTRNVYVCHVIGNRSTGKTALCQSILRKHHDSSKTSITSPVECDPPYTINTTTVYGQEKYLVLKEILVRDEQLPVLLPVDVDCDKYFSTSKIPVMLVAGKSDMPRARQDYLMQPDIFCETHKLSPAHSFSAANNDREVFVKLATMAAFPRFHPAWMLFYPDLTSHFYMFNLHDNKAYLWKTGLSVAVITLLGIIFAKFLRPPRK

ccccccccccEEEEEEccccccHHHHHHHHHccccccccccccccccccccccccEEEEEEEEcccccccHHHHHHHHccccEEEEEEEccccHHHHHHHHccHHHHHHHcccccccEEEEEEcccccccHHHHHHHHHcccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHccccccccccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHccccccccccccccccccccEEEEccccccccccHHHHHHEEEEEcHHHHHHHHHHccccccccccccccEEEccccccccccccccccEEEEEEEccccccHHHHHHHHHccccccccccccccccccccEEEEEEEEcccEEEEEEEEcccccccccccccccEEEEcccccccccEEEEEEcccccHHHHcccccHHHHHHHccccccEEEEcccccHHHHHHHHHHHccccccccccccccccccccHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccc

ccccccccccEEEEEEccccccHHHHHHHHHHHHccccccccccccEcccccccccccEEEEEcccccccHHHHHHHHHHccEEEEEEEcccHHHHHHHHHHHHHHHHHHcccccccEEEEEccccccccccEEEcHHHcccHHHHHHHHHHHHHccccccccHHHccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHccccccccccHHcccccccccccccEcccHHHHHHHHHHHHHHcccccccccHHHHHHHHccccccccccccccccccEEEcccccEEHHHHHHHHHHHHHccHHHHHHHHHHHccccccccccccEEEEEccccHHccccccccEEEEEEEEccccccHHHHHHHHHccccccccccccccccccccEEEEEEEEcccEEEEEEEEccccccccHHHccccEEEEEEcccccccEEEEEEccccccccccccccHHHHHHHccccccEEEEcccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccc

MVMKVSLRRNVRILLLGDRHVGKTSLILSLVseefpelvpskaeeitippdvtpemvpthivdysevdQTVDELTEEIQKAHVICLVYSvvddasidrlsshwlpflrnclvdtclpivlvgnkvdlVDYSTVESSAKTLKNISEMFYYAQKavlhpmapiyisdkqelTPECIKALTRIFKVcdldndnllsdKELNAFQRRcfdaplsrdsleDVKIVIRKNindgvsanncitlngFLFLHNLFmqrgrshtTWTVLRkfgynedlqiskeflhpplnipatctaelSDKGQQFLTTLFYRfdkdgdgalspeEQARLfslcppecppwtdREMRAMVATNSKGWITMQGFLCYWILTTLFNVNKTLEYLAyfgypitdrenqtsgvlVTREKQVDLLKKQTTRNVYVCHVignrstgktALCQSILRkhhdssktsitspvecdppytintttvygqEKYLVLKEILvrdeqlpvllpvdvdcdkyfstskipvmlvagksdmprarqdylmqpdifcethklspahsfsaannDREVFVKLATmaafprfhpawmlfypdltshfyMFNLHDNKAYLWKTGLSVAVITLLGIIFAkflrpprk

mvmkvslrRNVRilllgdrhvgkTSLILSLVseefpelvpskaeeitippdvtpeMVPTHIVDYSEVDQTVDELTEEIQKAHVICLVYSVVDDASIDRLSSHWLPFLRNCLVDTCLPIVLVGNKVDLVDYSTVESSAKTLKNISEMFYYAQKAVLHPMAPIYISDKQELTPECIKALTRIFKVCDLDNDNLLSDKELNAFQRRCfdaplsrdsledvKIVIRKnindgvsanNCITLNGFLFLHNLFMQRGRSHTTWTVLRKFGYNEDLQISKEFLHPPLNIPATCTAELSDKGQQFLTTLFYRFDKDGDGALSPEEQARLFSLCPPECPPWTDREMRAMVATNSKGWITMQGFLCYWILTTLFNVNKTLEYLAYFGYPITDRENQTSGVLVTREKQVdllkkqttrnvyvchvignrstgktALCQSILRKhhdssktsitspvecdppytiNTTTVYGQEKYLVLKEILVRDEQLPVLLPVDVDCDKYFSTSKIPVMLVAGKSDMPRARQDYLMQPDIFCETHKLSPAHSFSAANNDREVFVKLATMAAFPRFHPAWMLFYPDLTSHFYMFNLHDNKAYLWKTGLSVAVITLLGIIfakflrpprk

******LRRNVRILLLGDRHVGKTSLILSLVSEEFPELVP***EEITIPPDVTPEMVPTHIVDYSEVDQTVDELTEEIQKAHVICLVYSVVDDASIDRLSSHWLPFLRNCLVDTCLPIVLVGNKVDLVDYSTVESSAKTLKNISEMFYYAQKAVLHPMAPIYISDKQELTPECIKALTRIFKVCDLDNDNLLSDKELNAFQRRCFDAPLSRDSLEDVKIVIRKNINDGVSANNCITLNGFLFLHNLFMQRGRSHTTWTVLRKFGYNEDLQISKEFLHPPLNIPATCTAELSDKGQQFLTTLFYRFDKDG*********ARLFSLCPPECPPWTDREMRAMVATNSKGWITMQGFLCYWILTTLFNVNKTLEYLAYFGYPITDRENQTSGVLVTREKQVDLLKKQTTRNVYVCHVIGNRSTGKTALCQSILRK***********PVECDPPYTINTTTVYGQEKYLVLKEILVRDEQLPVLLPVDVDCDKYFSTSKIPVMLVAGKSDM*RARQDYLMQPDIFCETHKLSPAHSFSAANNDREVFVKLATMAAFPRFHPAWMLFYPDLTSHFYMFNLHDNKAYLWKTGLSVAVITLLGIIFAKFL*****

************ILLLGDRHVGKTSLILSLVSEEFPELVPSKAEEITIPPDVTPEMVPTHIVDYSEVDQTVDELTEEIQKAHVICLVYSVVDDASIDRLSSHWLPFLRNCLVDTCLPIVLVGNKVDLVDYSTVESSA***********YAQKAVLHPMAPIYISDKQELTPECIKALTRIFKVCDLDNDNLLSDKELNAFQRRCFDAPLSRDSLEDVKIVIRKNINDGVSANNCITLNGFLFLHNLFMQRGRSHTTWTVLRKFGYNEDLQISKEFLHPPLNIPATCTAELSDKGQQFLTTLFYRFDKDGDGALSPEEQARLFSLCPPECPPWTDREMRAMVATNSKGWITMQGFLCYWILTTLFNVNKTLEYLAYFGYPITDRENQTSGV******************VYVCHVIGNRSTGKTALCQSILRK**************CDPPYTINTTTVYGQEKYLVLKEILVRDEQLPVLLPVDVDCDKYFSTSKIPVMLVAGKSDMPR***********FCETHKLSPAHSFSAANNDREVFVKLATMAAFPRFHPA**************FNLHDNKAYLWKTGLSVAVITLLGIIFAKFLRP***

MVMKVSLRRNVRILLLGDRHVGKTSLILSLVSEEFPELVPSKAEEITIPPDVTPEMVPTHIVDYSEVDQTVDELTEEIQKAHVICLVYSVVDDASIDRLSSHWLPFLRNCLVDTCLPIVLVGNKVDLVDYSTVESSAKTLKNISEMFYYAQKAVLHPMAPIYISDKQELTPECIKALTRIFKVCDLDNDNLLSDKELNAFQRRCFDAPLSRDSLEDVKIVIRKNINDGVSANNCITLNGFLFLHNLFMQRGRSHTTWTVLRKFGYNEDLQISKEFLHPPLNIPATCTAELSDKGQQFLTTLFYRFDKDGDGALSPEEQARLFSLCPPECPPWTDREMRAMVATNSKGWITMQGFLCYWILTTLFNVNKTLEYLAYFGYPITDRENQTSGVLVTREKQVDLLKKQTTRNVYVCHVIGNRSTGKTALCQSILR***********SPVECDPPYTINTTTVYGQEKYLVLKEILVRDEQLPVLLPVDVDCDKYFSTSKIPVMLVAGKSDMPRARQDYLMQPDIFCETHKLSPAHSFSAANNDREVFVKLATMAAFPRFHPAWMLFYPDLTSHFYMFNLHDNKAYLWKTGLSVAVITLLGIIFAKFLRPPRK

*******RRNVRILLLGDRHVGKTSLILSLVSEEFPELVPSKAEEITIPPDVTPEMVPTHIVDYSEVDQTVDELTEEIQKAHVICLVYSVVDDASIDRLSSHWLPFLRNCLVDTCLPIVLVGNKVDLVDYSTVESSAKTLKNISEMFYYAQKAVLHPMAPIYISDKQELTPECIKALTRIFKVCDLDNDNLLSDKELNAFQRRCFDAPLSRDSLEDVKIVIRKNINDGVSANNCITLNGFLFLHNLFMQRGRSHTTWTVLRKFGYNEDLQISKEFLHPPLNIPATCTAELSDKGQQFLTTLFYRFDKDGDGALSPEEQARLFSLCPPECPPWTDREMRAMVATNSKGWITMQGFLCYWILTTLFNVNKTLEYLAYFGYPITDRENQTSGVLVTREKQV*L*KKQTTRNVYVCHVIGNRSTGKTALCQSILRKHHDSSKTSITSPVECDPPYTINTTTVYGQEKYLVLKEILVRDEQLPVLLPVDVDCDKYFSTSKIPVMLVAGKSDMPRARQDYLMQPDIFCETHKLSPAHSFSAANNDREVFVKLATMAAFPRFHPAWMLFYPDLTSHFYMFNLHDNKAYLWKTGLSVAVITLLGIIFAKFLRPP**

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		608	2.2.26 [Sep-21-2011]
Q298L5		649	Mitochondrial Rho GTPase	yes	N/A	0.950	0.890	0.505	1e-178
Q8IMX7		652	Mitochondrial Rho GTPase	yes	N/A	0.942	0.878	0.499	1e-176
Q2HJF8		631	Mitochondrial Rho GTPase	yes	N/A	0.876	0.844	0.488	1e-152
Q6NVC5		619	Mitochondrial Rho GTPase	no	N/A	0.945	0.928	0.458	1e-152
Q8IXI2		618	Mitochondrial Rho GTPase	no	N/A	0.896	0.881	0.488	1e-151
Q8BG51		631	Mitochondrial Rho GTPase	yes	N/A	0.876	0.844	0.486	1e-151
Q5ZM73		619	Mitochondrial Rho GTPase	yes	N/A	0.896	0.880	0.490	1e-150
Q5ZM83		618	Mitochondrial Rho GTPase	no	N/A	0.935	0.920	0.445	1e-148
Q6DIS1		616	Mitochondrial Rho GTPase	yes	N/A	0.891	0.879	0.471	1e-147
Q32LU1		617	Mitochondrial Rho GTPase	no	N/A	0.896	0.883	0.452	1e-136

>sp\|Q298L5\|MIRO_DROPS Mitochondrial Rho GTPase OS=Drosophila pseudoobscura pseudoobscura GN=Miro PE=3 SV=1	Back alignment and function desciption

 Score =  627 bits (1616), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 332/657 (50%), Positives = 426/657 (64%), Gaps = 79/657 (12%)

Query: 5   VSLRRNVRILLLGDRHVGKTSLILSLVSEEFPELVPSKAEEITIPPDVTPEMVPTHIVDY 64
           VS R+NVRILL+GD  VGKTSLILSLVSEE+PE VP +AEEITIP +VTPE VPT IVD+
Sbjct: 6   VSTRKNVRILLVGDAGVGKTSLILSLVSEEYPEEVPPRAEEITIPANVTPEQVPTSIVDF 65

Query: 65  SEVDQTVDELTEEIQKAHVICLVYSVVDDASIDRLSSHWLPFLRNCLVDTC--------- 115
           S V+QT + L  EI KAHV+C+VYSV DD S+DR++SHWLP +R+    T          
Sbjct: 66  SSVEQTEETLGLEINKAHVVCIVYSVDDDDSLDRITSHWLPLIRSKCNATLEGDAETEAE 125

Query: 116 ---------LPIVLVGNKVDLVDYST-----------------VESSAKTLKNISEMFYY 149
                     PIVLVGNK+DL+DYST                 VE SAKTL NISEMFYY
Sbjct: 126 TEAAGEGLRKPIVLVGNKIDLIDYSTMDSVLAIMEDFPEIESCVECSAKTLHNISEMFYY 185

Query: 150 AQKAVLHPMAPIYISDKQELTPECIKALTRIFKVCDLDNDNLLSDKELNAFQRRCFDAPL 209
           AQKAVLHP +P+YI + QELTP C K+L RIFK+CD D DNLL+D ELN FQRRCF+ PL
Sbjct: 186 AQKAVLHPTSPLYIMEDQELTPACKKSLVRIFKICDTDGDNLLNDYELNLFQRRCFNTPL 245

Query: 210 SRDSLEDVKIVIRKNINDGVSANNCITLNGFLFLHNLFMQRGRSHTTWTVLRKFGYNEDL 269
               L++VK VI+KN+ DG+  N+ +TL GFLFLH LF+QRGR+ TTW VLR+FGYN+ L
Sbjct: 246 QPQILDEVKAVIQKNVPDGI-YNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRFGYNDQL 304

Query: 270 QISKEFLHPPLNIPATCTAELSDKGQQFLTTLFYRFDKDGDGALSPEEQARLFSLCPPEC 329
           ++ +E+L PPL IP   + ELS +GQ+FL ++F R+D+D DGALSPEE   LFS+CP   
Sbjct: 305 EMCQEYLRPPLKIPPGSSTELSHRGQKFLISVFERYDRDCDGALSPEEHKMLFSVCPSS- 363

Query: 330 PPWT-DREMRAMVATNSKGWITMQGFLCYWILTTLFNVNKTLEYLAYFGYPITDRENQTS 388
            PW+   ++R     N KGW+T+ G+LC W L TL +V KT+EYLAY G+ + + ++  +
Sbjct: 364 -PWSYSTDIRKSCPINDKGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHENDSLLA 422

Query: 389 GVLVTREKQVDLLKKQTTRNVYVCHVIGNRSTGKTALCQSILRKHHDSSKTSITSPVECD 448
            + VTRE+++DL K+Q++R+VY CHVIG   +GKT LC+  L    D  +  I    + +
Sbjct: 423 AIHVTRERRIDLAKRQSSRSVYKCHVIGPNGSGKTGLCRGFLV---DEMQKLIGKEFKTN 479

Query: 449 PPYTINTTTVYGQEKYLVLKEILVRDEQLPVLLPVDVDCD-------------------- 488
             + IN+  VYGQEK+L+L++I VR    P L P +V+CD                    
Sbjct: 480 VVHCINSVQVYGQEKHLILRDIDVRHALDP-LQPQEVNCDVACLVYDSSNPRSFEYVARI 538

Query: 489 --KYFSTSKIPVMLVAGKSDMPRARQDYLMQPDIFCETHKLSPAHSFSAANNDREVFVKL 546
             KY++ SKIPVM+V  K DM   RQDYLMQP  FC  +KL P H FS   N +E++ KL
Sbjct: 539 YIKYYAESKIPVMIVGTKCDMDERRQDYLMQPAEFCAKYKLLPPHLFSLRTNKKELYTKL 598

Query: 547 ATMAAFPRFHPAWMLFYPDLTSHFYMFNLHDNKAYLWKTGLSVAVITLLGIIFAKFL 603
           ATMAAFP               HF +  L ++   LWK GL +A  T+LG I  K L
Sbjct: 599 ATMAAFPHLR------------HFGL--LTEDSKLLWKAGLGLAAATMLGFIVLKTL 641

Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution.
Drosophila pseudoobscura pseudoobscura (taxid: 46245)
EC: 3EC: .EC: 6EC: .EC: 5EC: .EC: -

>sp\|Q8IMX7\|MIRO_DROME Mitochondrial Rho GTPase OS=Drosophila melanogaster GN=Miro PE=1 SV=1	Back alignment and function description

>sp\|Q2HJF8\|MIRO1_BOVIN Mitochondrial Rho GTPase 1 OS=Bos taurus GN=RHOT1 PE=2 SV=1	Back alignment and function description

>sp\|Q6NVC5\|MIRO1_DANRE Mitochondrial Rho GTPase 1-A OS=Danio rerio GN=rhot1a PE=2 SV=1	Back alignment and function description

>sp\|Q8IXI2\|MIRO1_HUMAN Mitochondrial Rho GTPase 1 OS=Homo sapiens GN=RHOT1 PE=1 SV=2	Back alignment and function description

>sp\|Q8BG51\|MIRO1_MOUSE Mitochondrial Rho GTPase 1 OS=Mus musculus GN=Rhot1 PE=2 SV=1	Back alignment and function description

>sp\|Q5ZM73\|MIRO1_CHICK Mitochondrial Rho GTPase 1 OS=Gallus gallus GN=RHOT1 PE=2 SV=1	Back alignment and function description

>sp\|Q5ZM83\|MIRO2_CHICK Mitochondrial Rho GTPase 2 OS=Gallus gallus GN=RHOT2 PE=2 SV=1	Back alignment and function description

>sp\|Q6DIS1\|MIRO2_XENTR Mitochondrial Rho GTPase 2 OS=Xenopus tropicalis GN=rhot2 PE=2 SV=1	Back alignment and function description

>sp\|Q32LU1\|MIRO2_DANRE Mitochondrial Rho GTPase 2 OS=Danio rerio GN=rhot2 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		608
328787278		648	PREDICTED: LOW QUALITY PROTEIN: mitochon	0.980	0.919	0.537	0.0
380016131		640	PREDICTED: mitochondrial Rho GTPase-like	0.976	0.928	0.539	0.0
350408052		640	PREDICTED: mitochondrial Rho GTPase-like	0.976	0.928	0.536	0.0
340721854		640	PREDICTED: mitochondrial Rho GTPase-like	0.976	0.928	0.534	0.0
383849858		648	PREDICTED: LOW QUALITY PROTEIN: mitochon	0.978	0.918	0.530	0.0
380016129		664	PREDICTED: mitochondrial Rho GTPase-like	0.980	0.897	0.523	0.0
270013707		642	hypothetical protein TcasGA2_TC012343 [T	0.985	0.933	0.553	0.0
340721856		664	PREDICTED: mitochondrial Rho GTPase-like	0.980	0.897	0.518	0.0
332020760		627	Mitochondrial Rho GTPase [Acromyrmex ech	0.949	0.920	0.534	0.0
307194096		627	Mitochondrial Rho GTPase [Harpegnathos s	0.955	0.926	0.533	0.0

>gi\|328787278\|ref\|XP_003250915.1\| PREDICTED: LOW QUALITY PROTEIN: mitochondrial Rho GTPase [Apis mellifera]	Back alignment and taxonomy information

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/651 (53%), Positives = 440/651 (67%), Gaps = 55/651 (8%)

Query: 5   VSLRRNVRILLLGDRHVGKTSLILSLVSEEFPELVPSKAEEITIPPDVTPEMVPTHIVDY 64
           V+ RRNVRILL+GDR VGKTSLILSLVSEE+ E VP KAEEITIP DVTPE VPTHIVDY
Sbjct: 6   VAPRRNVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPTHIVDY 65

Query: 65  SEVDQTVDELTEEIQKAHVICLVYSVVDDASIDRLSSHWLPFLRNCLVDTCLPIVLVGNK 124
           S  +QT D+LT+EIQKAHVIC+VYSVVD+ ++DR +++WLP +R C  +   P+VLVGNK
Sbjct: 66  SAAEQTEDQLTDEIQKAHVICVVYSVVDEDTLDRAATYWLPLIRRCSSNNRCPVVLVGNK 125

Query: 125 VDLVDYSTVES-----------------SAKTLKNISEMFYYAQKAVLHPMAPIYISDKQ 167
           +DLVDYST+E+                 SAKTL+N+SE FYYAQKAVLHP  P+Y  D Q
Sbjct: 126 IDLVDYSTIEAVYPIMKEFTEIESCIECSAKTLQNVSETFYYAQKAVLHPTTPLYNYDTQ 185

Query: 168 ELTPECIKALTRIFKVCDLDNDNLLSDKELNAFQRRCFDAPLSRDSLEDVKIVIRKNIND 227
           E+T EC  AL RIFK+CDLDND LL+D ELNAFQ+ CF+ PL    LEDVK V+ KNI D
Sbjct: 186 EVTEECKIALQRIFKICDLDNDGLLNDMELNAFQQWCFNTPLQPQVLEDVKAVLSKNIQD 245

Query: 228 GVSANNCITLNGFLFLHNLFMQRGRSHTTWTVLRKFGYNEDLQISKEFLHPPLNIPATCT 287
           G+    C+T+ GF++L  LF+QRGR+ TTW VLRKFGY+ +LQ+SKE+++PPL IP  CT
Sbjct: 246 GICC-GCVTMKGFMYLQCLFIQRGRNETTWAVLRKFGYDNELQMSKEYIYPPLKIPVGCT 304

Query: 288 AELSDKGQQFLTTLFYRFDKDGDGALSPEEQARLFSLCPPECPPWTDREMRAMVATNSKG 347
            ELS KGQ+FLT LF + D+D DGALSP E   LFS C    PPW D E + +V TN KG
Sbjct: 305 TELSHKGQEFLTLLFMQHDRDRDGALSPLEMESLFSRCLT--PPWGD-EYKYIVPTNEKG 361

Query: 348 WITMQGFLCYWILTTLFNVNKTLEYLAYFGYPITDRENQTSGVLVTREKQVDLLKKQTTR 407
           WIT QG++C W L TL NV KTLEY+AY GY + + E QT+ V+VTREK++DL KKQ++R
Sbjct: 362 WITFQGYMCQWSLLTLTNVRKTLEYMAYLGYNMYNNECQTNAVVVTREKKLDLAKKQSSR 421

Query: 408 NVYVCHVIGNRSTGKTALCQSILRKHHDSSKTSITSPVECDPPYTINTTTVYGQEKYLVL 467
           NVY CHVIG +S+GKT LC++ +    +     I  P       T+NT  VYGQEK ++L
Sbjct: 422 NVYSCHVIGPKSSGKTTLCRTFIDPKLEKLTEEIVPP---SSHITVNTVHVYGQEKTIIL 478

Query: 468 KEILVRDEQLPVLLPVDVDCD----------------------KYFSTSKIPVMLVAGKS 505
           ++I + + Q   L P  + CD                      KYF+ SKIPV+++A KS
Sbjct: 479 RDINILNVQ-DALTPAQIQCDVAALVYDANNPKSFEYIARIYIKYFADSKIPVLIIANKS 537

Query: 506 DMPRARQDYLMQPDIFCETHKLSPAHSFSAANN-DREVFVKLATMAAFPRFHPAWMLFYP 564
           D+   +QDYL+QP  FC  +KL P   +S +    RE+FVKLATMAAFPRF  AW+LFY 
Sbjct: 538 DLSEVKQDYLLQPISFCNKYKLMPPQPYSISRTVRREIFVKLATMAAFPRFQGAWVLFYR 597

Query: 565 D------LTSHFYMFN-LHDNKAYLWKTGLSVAVITLLGIIFAKFLRPPRK 608
           D       TSH   F  L  +    WK GL +AV T+ G +  + L   ++
Sbjct: 598 DRLVXIFATSHINQFGLLQGDSIVWWKAGLGIAVATVAGFVVMRVLNTEKR 648

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|380016131\|ref\|XP_003692042.1\| PREDICTED: mitochondrial Rho GTPase-like isoform 3 [Apis florea]	Back alignment and taxonomy information

>gi\|350408052\|ref\|XP_003488285.1\| PREDICTED: mitochondrial Rho GTPase-like [Bombus impatiens]	Back alignment and taxonomy information

>gi\|340721854\|ref\|XP_003399329.1\| PREDICTED: mitochondrial Rho GTPase-like isoform 1 [Bombus terrestris]	Back alignment and taxonomy information

>gi\|383849858\|ref\|XP_003700552.1\| PREDICTED: LOW QUALITY PROTEIN: mitochondrial Rho GTPase-like [Megachile rotundata]	Back alignment and taxonomy information

>gi\|380016129\|ref\|XP_003692041.1\| PREDICTED: mitochondrial Rho GTPase-like isoform 2 [Apis florea]	Back alignment and taxonomy information

>gi\|270013707\|gb\|EFA10155.1\| hypothetical protein TcasGA2_TC012343 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|340721856\|ref\|XP_003399330.1\| PREDICTED: mitochondrial Rho GTPase-like isoform 2 [Bombus terrestris]	Back alignment and taxonomy information

>gi\|332020760\|gb\|EGI61164.1\| Mitochondrial Rho GTPase [Acromyrmex echinatior]	Back alignment and taxonomy information

>gi\|307194096\|gb\|EFN76557.1\| Mitochondrial Rho GTPase [Harpegnathos saltator]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		608
FB\|FBgn0039140		652	Miro "Mitochondrial Rho" [Dros	0.597	0.556	0.519	3.7e-162
UNIPROTKB\|Q298L5		649	Miro "Mitochondrial Rho GTPase	0.743	0.696	0.495	1.8e-157
ZFIN\|ZDB-GENE-061009-52		660	rhot1b "ras homolog gene famil	0.708	0.653	0.473	1.3e-143
UNIPROTKB\|F1PP14		691	RHOT1 "Mitochondrial Rho GTPas	0.713	0.628	0.475	1.6e-143
UNIPROTKB\|G1K237		631	RHOT1 "Mitochondrial Rho GTPas	0.708	0.683	0.480	3.4e-143
UNIPROTKB\|Q2HJF8		631	RHOT1 "Mitochondrial Rho GTPas	0.708	0.683	0.480	3.4e-143
UNIPROTKB\|F1NSQ4		618	RHOT1 "Mitochondrial Rho GTPas	0.708	0.697	0.474	5.5e-143
UNIPROTKB\|J9NUJ0		720	RHOT1 "Mitochondrial Rho GTPas	0.708	0.598	0.476	5.5e-143
UNIPROTKB\|D4ACN2		663	Rhot1 "Mitochondrial Rho GTPas	0.781	0.716	0.454	7e-143
UNIPROTKB\|J9JIH9		659	RHOT1 "Mitochondrial Rho GTPas	0.708	0.654	0.478	1.4e-142

FB\|FBgn0039140 Miro "Mitochondrial Rho" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 1021 (364.5 bits), Expect = 3.7e-162, Sum P(3) = 3.7e-162
 Identities = 204/393 (51%), Positives = 274/393 (69%)

Query:   117 PIVLVGNKVDLVDYST-----------------VESSAKTLKNISEMFYYAQKAVLHPMA 159
             PIVLVGNK+DL++YST                 VE SAK+L NISEMFYYAQKAVLHP +
Sbjct:   138 PIVLVGNKIDLIEYSTMDSVLAIMEDYPEIESCVECSAKSLHNISEMFYYAQKAVLHPTS 197

Query:   160 PIYISDKQELTPECIKALTRIFKVCDLDNDNLLSDKELNAFQRRCFDAPLSRDSLEDVKI 219
             P+Y+ ++QELT  C K+L RIFK+CD+D DNLL+D ELN FQRRCF+ PL    L++VK 
Sbjct:   198 PLYMMEEQELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQRRCFNTPLQPQILDEVKA 257

Query:   220 VIRKNINDGVSANNCITLNGFLFLHNLFMQRGRSHTTWTVLRKFGYNEDLQISKEFLHPP 279
             VI+KN+ DG+  N+ +TL GFLFLH LF+QRGR+ TTW VLR+FGYN+ L++ +E+L PP
Sbjct:   258 VIQKNVPDGIY-NDAVTLKGFLFLHCLFIQRGRNETTWAVLRRFGYNDQLEMCQEYLRPP 316

Query:   280 LNIPATCTAELSDKGQQFLTTLFYRFDKDGDGALSPEEQARLFSLCPPECPPWT-DREMR 338
             L IP   + ELS +GQQFL  +F R+D+DGDGALSPEE   LFS CP    PW+   ++R
Sbjct:   317 LKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFSTCP--AAPWSYSTDIR 374

Query:   339 AMVATN-SKGWITMQGFLCYWILTTLFNVNKTLEYLAYFGYPITDRENQTSGVLVTREKQ 397
                  N + GW+T+ G+LC W L TL +V KT+EYLAY G+ + + ++Q + + VTRE++
Sbjct:   375 KSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHENDSQLAAIHVTRERR 434

Query:   398 VDLLKKQTTRNVYVCHVIGNRSTGKTALCQSILRK--HHDSSKTSITSPVECDPPYTINT 455
             +DL K+Q++R+VY CHVIG + +GKT +C+  L +  H    K   T+ V C     IN+
Sbjct:   435 IDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFKTNVVNC-----INS 489

Query:   456 TTVYGQEKYLVLKEILVRDEQLPVLLPVDVDCD 488
               VYGQEK+L+L++I VR   L  L P +V+CD
Sbjct:   490 VQVYGQEKHLILRDIDVR-HALDPLQPQEVNCD 521

GO:0005525 "GTP binding" evidence=IEA

GO:0005509 "calcium ion binding" evidence=IEA

GO:0003924 "GTPase activity" evidence=IEA

GO:0007264 "small GTPase mediated signal transduction" evidence=IEA

GO:0031122 "cytoplasmic microtubule organization" evidence=IMP

GO:0007268 "synaptic transmission" evidence=IMP

GO:0000226 "microtubule cytoskeleton organization" evidence=IMP

GO:0048489 "synaptic vesicle transport" evidence=IMP

GO:0051646 "mitochondrion localization" evidence=IMP

GO:0019725 "cellular homeostasis" evidence=ISS

GO:0031307 "integral to mitochondrial outer membrane" evidence=ISS

GO:0047497 "mitochondrion transport along microtubule" evidence=ISS

GO:0006915 "apoptotic process" evidence=ISS

GO:0034643 "establishment of mitochondrion localization, microtubule-mediated" evidence=IMP

UNIPROTKB\|Q298L5 Miro "Mitochondrial Rho GTPase" [Drosophila pseudoobscura pseudoobscura (taxid:46245)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-061009-52 rhot1b "ras homolog gene family, member T1b" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PP14 RHOT1 "Mitochondrial Rho GTPase" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|G1K237 RHOT1 "Mitochondrial Rho GTPase" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q2HJF8 RHOT1 "Mitochondrial Rho GTPase 1" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NSQ4 RHOT1 "Mitochondrial Rho GTPase" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|J9NUJ0 RHOT1 "Mitochondrial Rho GTPase" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|D4ACN2 Rhot1 "Mitochondrial Rho GTPase" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|J9JIH9 RHOT1 "Mitochondrial Rho GTPase" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q8BG51	MIRO1_MOUSE	3, ., 6, ., 5, ., -	0.4865	0.8766	0.8446	yes	N/A
P0CO78	GEM1_CRYNJ	3, ., 6, ., 5, ., -	0.3691	0.8569	0.7594	yes	N/A
Q6FIR8	GEM1_CANGA	3, ., 6, ., 5, ., -	0.2850	0.9391	0.8798	yes	N/A
Q55G45	GEMA_DICDI	3, ., 6, ., 5, ., -	0.3370	0.6907	0.6382	yes	N/A
Q6C2J1	GEM1_YARLI	3, ., 6, ., 5, ., -	0.3097	0.8782	0.8030	yes	N/A
Q5B5L3	GEM1_EMENI	3, ., 6, ., 5, ., -	0.3454	0.8733	0.8375	yes	N/A
Q6CY37	GEM1_KLULA	3, ., 6, ., 5, ., -	0.2829	0.875	0.8072	yes	N/A
Q94263	MIRO_CAEEL	3, ., 6, ., 5, ., -	0.3790	0.9375	0.912	yes	N/A
Q4WN24	GEM1_ASPFU	3, ., 6, ., 5, ., -	0.3504	0.8733	0.8401	yes	N/A
O59781	GEM1_SCHPO	3, ., 6, ., 5, ., -	0.3271	0.8684	0.8380	yes	N/A
Q758X6	GEM1_ASHGO	3, ., 6, ., 5, ., -	0.2884	0.8815	0.8108	yes	N/A
Q298L5	MIRO_DROPS	3, ., 6, ., 5, ., -	0.5053	0.9506	0.8906	yes	N/A
Q4I2W2	GEM1_GIBZE	3, ., 6, ., 5, ., -	0.3355	0.8618	0.8357	yes	N/A
P39722	GEM1_YEAST	3, ., 6, ., 5, ., -	0.2987	0.8717	0.8006	yes	N/A
Q8IMX7	MIRO_DROME	3, ., 6, ., 5, ., -	0.4992	0.9424	0.8788	yes	N/A
Q2HJF8	MIRO1_BOVIN	3, ., 6, ., 5, ., -	0.4882	0.8766	0.8446	yes	N/A
Q5ZM73	MIRO1_CHICK	3, ., 6, ., 5, ., -	0.4907	0.8963	0.8804	yes	N/A
Q6DIS1	MIRO2_XENTR	3, ., 6, ., 5, ., -	0.4719	0.8914	0.8798	yes	N/A
Q2UM43	GEM1_ASPOR	3, ., 6, ., 5, ., -	0.3537	0.8733	0.8388	yes	N/A

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.6.5	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		608
cd01893		168	cd01893, Miro1, Mitochondrial Rho family 1 (Miro1)	3e-66
cd01892		180	cd01892, Miro2, Mitochondrial Rho family 2 (Miro2)	9e-41
pfam08356		89	pfam08356, EF_assoc_2, EF hand associated	7e-34
pfam08355		75	pfam08355, EF_assoc_1, EF hand associated	1e-26
pfam00071		162	pfam00071, Ras, Ras family	2e-15
cd00876		160	cd00876, Ras, Rat sarcoma (Ras) family of small gu	8e-15
cd00154		159	cd00154, Rab, Ras-related in brain (Rab) family of	8e-15
COG1100		219	COG1100, COG1100, GTPase SAR1 and related small G	9e-15
pfam08477		116	pfam08477, Miro, Miro-like protein	9e-14
cd00882		161	cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s	3e-13
smart00174		174	smart00174, RHO, Rho (Ras homology) subfamily of R	7e-11
cd00157		171	cd00157, Rho, Ras homology family (Rho) of small g	1e-10
smart00010		166	smart00010, small_GTPase, Small GTPase of the Ras	6e-10
cd04130		173	cd04130, Wrch_1, Wnt-1 responsive Cdc42 homolog (W	1e-09
cd04123		162	cd04123, Rab21, Rab GTPase family 21 (Rab21)	1e-09
smart00173		164	smart00173, RAS, Ras subfamily of RAS small GTPase	2e-09
cd04139		163	cd04139, RalA_RalB, Ral (Ras-like) family containi	5e-09
smart00175		164	smart00175, RAB, Rab subfamily of small GTPases	5e-09
cd04101		167	cd04101, RabL4, Rab GTPase-like family 4 (Rab-like	1e-08
cd01861		161	cd01861, Rab6, Rab GTPase family 6 (Rab6)	3e-08
cd04137		180	cd04137, RheB, Ras Homolog Enriched in Brain (RheB	4e-08
cd04106		162	cd04106, Rab23_like, Rab GTPase family 23 (Rab23)-	2e-07
cd04148		219	cd04148, RGK, Rem, Rem2, Rad, Gem/Kir (RGK) subfam	2e-07
cd04135		174	cd04135, Tc10, Rho GTPase TC10 (Tc10)	7e-07
cd01863		161	cd01863, Rab18, Rab GTPase family 18 (Rab18)	9e-07
cd04177		168	cd04177, RSR1, RSR1/Bud1p family GTPase	1e-06
cd01860		163	cd01860, Rab5_related, Rab-related GTPase family i	1e-06
cd04132		197	cd04132, Rho4_like, Ras homology family 4 (Rho4) o	2e-06
cd04147		197	cd04147, Ras_dva, Ras - dorsal-ventral anterior lo	3e-06
cd01870		175	cd01870, RhoA_like, Ras homology family A (RhoA)-l	5e-06
cd01862		172	cd01862, Rab7, Rab GTPase family 7 (Rab7)	7e-06
cd04140		165	cd04140, ARHI_like, A Ras homolog member I (ARHI)	8e-06
cd04136		164	cd04136, Rap_like, Rap-like family consists of Rap	9e-06
cd04109		213	cd04109, Rab28, Rab GTPase family 28 (Rab28)	1e-05
cd04142		198	cd04142, RRP22, Ras-related protein on chromosome	2e-05
cd04146		166	cd04146, RERG_RasL11_like, Ras-related and Estroge	7e-05
cd04144		190	cd04144, Ras2, Rat sarcoma (Ras) family 2 of small	7e-05
PLN03118		211	PLN03118, PLN03118, Rab family protein; Provisiona	1e-04
cd04118		193	cd04118, Rab24, Rab GTPase family 24 (Rab24)	1e-04
cd01867		167	cd01867, Rab8_Rab10_Rab13_like, Rab GTPase familie	1e-04
cd01871		174	cd01871, Rac1_like, Ras-related C3 botulinum toxin	1e-04
cd04138		162	cd04138, H_N_K_Ras_like, Ras GTPase family contain	2e-04
cd04105		202	cd04105, SR_beta, Signal recognition particle rece	2e-04
cd04115		170	cd04115, Rab33B_Rab33A, Rab GTPase family 33 inclu	4e-04
cd01869		166	cd01869, Rab1_Ypt1, Rab GTPase family 1 includes t	4e-04
cd04133		173	cd04133, Rop_like, Rho-related protein from plants	4e-04
cd04145		164	cd04145, M_R_Ras_like, R-Ras2/TC21, M-Ras/R-Ras3	5e-04
cd04175		164	cd04175, Rap1, Rap1 family GTPase consists of Rap1	8e-04
cd04119		168	cd04119, RJL, Rab GTPase family J-like (RabJ-like)	8e-04
cd00882		161	cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s	0.001
cd04131		176	cd04131, Rnd, Rho family GTPase subfamily Rnd incl	0.001
cd04176		163	cd04176, Rap2, Rap2 family GTPase consists of Rap2	0.001
cd04134		185	cd04134, Rho3, Ras homology family 3 (Rho3) of sma	0.002
PTZ00369		189	PTZ00369, PTZ00369, Ras-like protein; Provisional	0.002
cd01875		191	cd01875, RhoG, Ras homolog family, member G (RhoG)	0.002
cd01874		175	cd01874, Cdc42, cell division cycle 42 (Cdc42) is	0.002
cd09914		161	cd09914, RocCOR, Ras of complex proteins (Roc) C-t	0.003
cd04141		172	cd04141, Rit_Rin_Ric, Ras-like protein in all tiss	0.003
cd04114		169	cd04114, Rab30, Rab GTPase family 30 (Rab30)	0.003

>gnl\|CDD\|206680 cd01893, Miro1, Mitochondrial Rho family 1 (Miro1), N-terminal	Back alignment and domain information

 Score =  213 bits (545), Expect = 3e-66
 Identities = 92/170 (54%), Positives = 111/170 (65%), Gaps = 23/170 (13%)

Query: 9   RNVRILLLGDRHVGKTSLILSLVSEEFPELVPSKAEEITIPPDVTPEMVPTHIVDYSEVD 68
           ++VRI+L+GD  VGK+SLI+SLVSEEFPE VP    EITIP DVTPE VPT IVD S   
Sbjct: 1   KDVRIVLIGDEGVGKSSLIMSLVSEEFPENVPRVLPEITIPADVTPERVPTTIVDTSSRP 60

Query: 69  QTVDELTEEIQKAHVICLVYSVVDDASIDRLSSHWLPFLRNCLVDTCLPIVLVGNKVDLV 128
           Q    L  EI+KA+VICLVYSV   ++++R+ + WLP +R   V    PI+LVGNK DL 
Sbjct: 61  QDRANLAAEIRKANVICLVYSVDRPSTLERIRTKWLPLIRRLGVKV--PIILVGNKSDLR 118

Query: 129 DYST---------------------VESSAKTLKNISEMFYYAQKAVLHP 157
           D S+                     VE SAKTL N+SE+FYYAQKAVLHP
Sbjct: 119 DGSSQAGLEEEMLPIMNEFREIETCVECSAKTLINVSEVFYYAQKAVLHP 168

Miro1 subfamily. Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs. Genes encoding Miro-like proteins were found in several eukaryotic organisms. This CD represents the N-terminal GTPase domain of Miro proteins. These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis. Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature. Length = 168

>gnl\|CDD\|206679 cd01892, Miro2, Mitochondrial Rho family 2 (Miro2), C-terminal	Back alignment and domain information

>gnl\|CDD\|192013 pfam08356, EF_assoc_2, EF hand associated	Back alignment and domain information

>gnl\|CDD\|192012 pfam08355, EF_assoc_1, EF hand associated	Back alignment and domain information

>gnl\|CDD\|215692 pfam00071, Ras, Ras family	Back alignment and domain information

>gnl\|CDD\|206642 cd00876, Ras, Rat sarcoma (Ras) family of small guanosine triphosphatases (GTPases)	Back alignment and domain information

>gnl\|CDD\|206640 cd00154, Rab, Ras-related in brain (Rab) family of small guanosine triphosphatases (GTPases)	Back alignment and domain information

>gnl\|CDD\|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|219856 pfam08477, Miro, Miro-like protein	Back alignment and domain information

>gnl\|CDD\|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases)	Back alignment and domain information

>gnl\|CDD\|197554 smart00174, RHO, Rho (Ras homology) subfamily of Ras-like small GTPases	Back alignment and domain information

>gnl\|CDD\|206641 cd00157, Rho, Ras homology family (Rho) of small guanosine triphosphatases (GTPases)	Back alignment and domain information

>gnl\|CDD\|197466 smart00010, small_GTPase, Small GTPase of the Ras superfamily; ill-defined subfamily	Back alignment and domain information

>gnl\|CDD\|133330 cd04130, Wrch_1, Wnt-1 responsive Cdc42 homolog (Wrch-1) is a Rho family GTPase similar to Cdc42	Back alignment and domain information

>gnl\|CDD\|133323 cd04123, Rab21, Rab GTPase family 21 (Rab21)	Back alignment and domain information

>gnl\|CDD\|214541 smart00173, RAS, Ras subfamily of RAS small GTPases	Back alignment and domain information

>gnl\|CDD\|206710 cd04139, RalA_RalB, Ral (Ras-like) family containing highly homologous RalA and RalB	Back alignment and domain information

>gnl\|CDD\|197555 smart00175, RAB, Rab subfamily of small GTPases	Back alignment and domain information

>gnl\|CDD\|206688 cd04101, RabL4, Rab GTPase-like family 4 (Rab-like4)	Back alignment and domain information

>gnl\|CDD\|206654 cd01861, Rab6, Rab GTPase family 6 (Rab6)	Back alignment and domain information

>gnl\|CDD\|206709 cd04137, RheB, Ras Homolog Enriched in Brain (RheB) is a small GTPase	Back alignment and domain information

>gnl\|CDD\|133306 cd04106, Rab23_like, Rab GTPase family 23 (Rab23)-like	Back alignment and domain information

>gnl\|CDD\|206715 cd04148, RGK, Rem, Rem2, Rad, Gem/Kir (RGK) subfamily of Ras GTPases	Back alignment and domain information

>gnl\|CDD\|206707 cd04135, Tc10, Rho GTPase TC10 (Tc10)	Back alignment and domain information

>gnl\|CDD\|206656 cd01863, Rab18, Rab GTPase family 18 (Rab18)	Back alignment and domain information

>gnl\|CDD\|133377 cd04177, RSR1, RSR1/Bud1p family GTPase	Back alignment and domain information

>gnl\|CDD\|206653 cd01860, Rab5_related, Rab-related GTPase family includes Rab5 and Rab22; regulates early endosome fusion	Back alignment and domain information

>gnl\|CDD\|206704 cd04132, Rho4_like, Ras homology family 4 (Rho4) of small guanosine triphosphatases (GTPases)-like	Back alignment and domain information

>gnl\|CDD\|206714 cd04147, Ras_dva, Ras - dorsal-ventral anterior localization (Ras-dva) family	Back alignment and domain information

>gnl\|CDD\|206662 cd01870, RhoA_like, Ras homology family A (RhoA)-like includes RhoA, RhoB and RhoC	Back alignment and domain information

>gnl\|CDD\|206655 cd01862, Rab7, Rab GTPase family 7 (Rab7)	Back alignment and domain information

>gnl\|CDD\|206711 cd04140, ARHI_like, A Ras homolog member I (ARHI)	Back alignment and domain information

>gnl\|CDD\|206708 cd04136, Rap_like, Rap-like family consists of Rap1, Rap2 and RSR1	Back alignment and domain information

>gnl\|CDD\|206694 cd04109, Rab28, Rab GTPase family 28 (Rab28)	Back alignment and domain information

>gnl\|CDD\|133342 cd04142, RRP22, Ras-related protein on chromosome 22 (RRP22) family	Back alignment and domain information

>gnl\|CDD\|206713 cd04146, RERG_RasL11_like, Ras-related and Estrogen-Regulated Growth inhibitor (RERG) and Ras-like 11 (RasL11)-like families	Back alignment and domain information

>gnl\|CDD\|133344 cd04144, Ras2, Rat sarcoma (Ras) family 2 of small guanosine triphosphatases (GTPases)	Back alignment and domain information

>gnl\|CDD\|215587 PLN03118, PLN03118, Rab family protein; Provisional	Back alignment and domain information

>gnl\|CDD\|133318 cd04118, Rab24, Rab GTPase family 24 (Rab24)	Back alignment and domain information

>gnl\|CDD\|206659 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase families 8, 10, 13 (Rab8, Rab10, Rab13)	Back alignment and domain information

>gnl\|CDD\|206663 cd01871, Rac1_like, Ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)-like consists of Rac1, Rac2 and Rac3	Back alignment and domain information

>gnl\|CDD\|133338 cd04138, H_N_K_Ras_like, Ras GTPase family containing H-Ras,N-Ras and K-Ras4A/4B	Back alignment and domain information

>gnl\|CDD\|206691 cd04105, SR_beta, Signal recognition particle receptor, beta subunit (SR-beta), together with SR-alpha, forms the heterodimeric signal recognition particle (SRP)	Back alignment and domain information

>gnl\|CDD\|133315 cd04115, Rab33B_Rab33A, Rab GTPase family 33 includes Rab33A and Rab33B	Back alignment and domain information

>gnl\|CDD\|206661 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes the yeast homolog Ypt1	Back alignment and domain information

>gnl\|CDD\|206705 cd04133, Rop_like, Rho-related protein from plants (Rop)-like	Back alignment and domain information

>gnl\|CDD\|133345 cd04145, M_R_Ras_like, R-Ras2/TC21, M-Ras/R-Ras3	Back alignment and domain information

>gnl\|CDD\|133375 cd04175, Rap1, Rap1 family GTPase consists of Rap1a and Rap1b isoforms	Back alignment and domain information

>gnl\|CDD\|133319 cd04119, RJL, Rab GTPase family J-like (RabJ-like)	Back alignment and domain information

>gnl\|CDD\|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases)	Back alignment and domain information

>gnl\|CDD\|206703 cd04131, Rnd, Rho family GTPase subfamily Rnd includes Rnd1/Rho6, Rnd2/Rho7, and Rnd3/RhoE/Rho8	Back alignment and domain information

>gnl\|CDD\|133376 cd04176, Rap2, Rap2 family GTPase consists of Rap2a, Rap2b, and Rap2c	Back alignment and domain information

>gnl\|CDD\|206706 cd04134, Rho3, Ras homology family 3 (Rho3) of small guanosine triphosphatases (GTPases)	Back alignment and domain information

>gnl\|CDD\|240385 PTZ00369, PTZ00369, Ras-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|133277 cd01875, RhoG, Ras homolog family, member G (RhoG) of small guanosine triphosphatases (GTPases)	Back alignment and domain information

>gnl\|CDD\|206664 cd01874, Cdc42, cell division cycle 42 (Cdc42) is a small GTPase of the Rho family	Back alignment and domain information

>gnl\|CDD\|206741 cd09914, RocCOR, Ras of complex proteins (Roc) C-terminal of Roc (COR) domain family	Back alignment and domain information

>gnl\|CDD\|206712 cd04141, Rit_Rin_Ric, Ras-like protein in all tissues (Rit), Ras-like protein in neurons (Rin) and Ras-related protein which interacts with calmodulin (Ric)	Back alignment and domain information

>gnl\|CDD\|133314 cd04114, Rab30, Rab GTPase family 30 (Rab30)	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		608
KOG1707\|consensus		625		100.0
KOG0092\|consensus		200		99.95
KOG0084\|consensus		205		99.95
PRK03003		472	GTP-binding protein Der; Reviewed	99.95
KOG0094\|consensus		221		99.94
KOG0078\|consensus		207		99.94
PF08356		89	EF_assoc_2: EF hand associated; InterPro: IPR01356	99.94
cd04133		176	Rop_like Rop subfamily. The Rop (Rho-related prote	99.93
KOG0080\|consensus		209		99.93
cd01875		191	RhoG RhoG subfamily. RhoG is a GTPase with high se	99.93
KOG0098\|consensus		216		99.93
cd04172		182	Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE	99.93
cd04121		189	Rab40 Rab40 subfamily. This subfamily contains Rab	99.93
cd04120		202	Rab12 Rab12 subfamily. Rab12 was first identified	99.93
KOG0079\|consensus		198		99.93
cd04174		232	Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb	99.92
cd04131		178	Rnd Rnd subfamily. The Rnd subfamily contains Rnd1	99.92
cd01874		175	Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas	99.92
cd04173		222	Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb	99.92
cd04141		172	Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p	99.92
KOG0394\|consensus		210		99.92
KOG0084\|consensus		205		99.92
KOG0087\|consensus		222		99.92
cd04122		166	Rab14 Rab14 subfamily. Rab14 GTPases are localized	99.91
cd01893		166	Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr	99.91
cd04134		189	Rho3 Rho3 subfamily. Rho3 is a member of the Rho f	99.91
cd01871		174	Rac1_like Rac1-like subfamily. The Rac1-like subfa	99.91
cd04136		163	Rap_like Rap-like subfamily. The Rap subfamily con	99.91
TIGR03594		429	GTPase_EngA ribosome-associated GTPase EngA. EngA	99.91
KOG0078\|consensus		207		99.91
KOG0086\|consensus		214		99.91
PLN03071		219	GTP-binding nuclear protein Ran; Provisional	99.91
cd04175		164	Rap1 Rap1 subgroup. The Rap1 subgroup is part of t	99.91
KOG0095\|consensus		213		99.91
cd04107		201	Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38	99.91
cd04138		162	H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras,	99.91
cd01867		167	Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp	99.91
cd04103		158	Centaurin_gamma Centaurin gamma. The centaurins (a	99.91
cd04176		163	Rap2 Rap2 subgroup. The Rap2 subgroup is part of t	99.9
cd04127		180	Rab27A Rab27a subfamily. The Rab27a subfamily cons	99.9
smart00173		164	RAS Ras subfamily of RAS small GTPases. Similar in	99.9
cd04117		161	Rab15 Rab15 subfamily. Rab15 colocalizes with the	99.9
cd04128		182	Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi	99.9
cd04144		190	Ras2 Ras2 subfamily. The Ras2 subfamily, found exc	99.9
PTZ00369		189	Ras-like protein; Provisional	99.9
cd04119		168	RJL RJL (RabJ-Like) subfamily. RJLs are found in m	99.9
cd04145		164	M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf	99.9
KOG0094\|consensus		221		99.9
cd00877		166	Ran Ran (Ras-related nuclear proteins) /TC4 subfam	99.9
smart00174		174	RHO Rho (Ras homology) subfamily of Ras-like small	99.9
cd04140		165	ARHI_like ARHI subfamily. ARHI (A Ras homolog memb	99.9
cd04124		161	RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily	99.9
KOG0098\|consensus		216		99.9
cd04108		170	Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr	99.9
PRK00093		435	GTP-binding protein Der; Reviewed	99.9
cd01865		165	Rab3 Rab3 subfamily. The Rab3 subfamily contains R	99.9
KOG0093\|consensus		193		99.9
cd04132		187	Rho4_like Rho4-like subfamily. Rho4 is a GTPase th	99.9
cd04109		215	Rab28 Rab28 subfamily. First identified in maize,	99.9
PRK09518		712	bifunctional cytidylate kinase/GTPase Der; Reviewe	99.9
KOG0091\|consensus		213		99.9
cd01864		165	Rab19 Rab19 subfamily. Rab19 proteins are associat	99.9
cd04110		199	Rab35 Rab35 subfamily. Rab35 is one of several Rab	99.89
cd01869		166	Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev	99.89
smart00176		200	RAN Ran (Ras-related nuclear proteins) /TC4 subfam	99.89
cd01873		195	RhoBTB RhoBTB subfamily. Members of the RhoBTB sub	99.89
cd04111		211	Rab39 Rab39 subfamily. Found in eukaryotes, Rab39	99.89
cd04126		220	Rab20 Rab20 subfamily. Rab20 is one of several Rab	99.89
PF00071		162	Ras: Ras family; InterPro: IPR001806 Small GTPases	99.89
cd04149		168	Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor	99.89
KOG0092\|consensus		200		99.89
cd04113		161	Rab4 Rab4 subfamily. Rab4 has been implicated in n	99.89
cd01868		165	Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a	99.89
cd04106		162	Rab23_lke Rab23-like subfamily. Rab23 is a member	99.89
cd04143		247	Rhes_like Rhes_like subfamily. This subfamily incl	99.89
cd04135		174	Tc10 TC10 subfamily. TC10 is a Rho family protein	99.89
cd04116		170	Rab9 Rab9 subfamily. Rab9 is found in late endosom	99.89
KOG0393\|consensus		198		99.89
cd04142		198	RRP22 RRP22 subfamily. RRP22 (Ras-related protein	99.89
KOG0088\|consensus		218		99.89
cd04112		191	Rab26 Rab26 subfamily. First identified in rat pan	99.89
PLN00223		181	ADP-ribosylation factor; Provisional	99.89
cd01866		168	Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg	99.89
smart00177		175	ARF ARF-like small GTPases; ARF, ADP-ribosylation	99.89
cd04177		168	RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the	99.89
cd04150		159	Arf1_5_like Arf1-Arf5-like subfamily. This subfami	99.89
cd04125		188	RabA_like RabA-like subfamily. RabA was first iden	99.89
KOG0087\|consensus		222		99.88
cd04130		173	Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive	99.88
cd01870		175	RhoA_like RhoA-like subfamily. The RhoA subfamily	99.88
COG1160		444	Predicted GTPases [General function prediction onl	99.88
cd04101		164	RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove	99.88
PLN03110		216	Rab GTPase; Provisional	99.88
cd04148		221	RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki	99.88
cd01892		169	Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr	99.88
PTZ00133		182	ADP-ribosylation factor; Provisional	99.88
cd01861		161	Rab6 Rab6 subfamily. Rab6 is involved in microtubu	99.88
cd04146		165	RERG_RasL11_like RERG/RasL11-like subfamily. RERG	99.88
cd04115		170	Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u	99.88
PLN03118		211	Rab family protein; Provisional	99.88
KOG0080\|consensus		209		99.88
cd04118		193	Rab24 Rab24 subfamily. Rab24 is distinct from othe	99.87
cd01860		163	Rab5_related Rab5-related subfamily. This subfamil	99.87
cd04158		169	ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor	99.87
cd04162		164	Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9	99.87
PLN03108		210	Rab family protein; Provisional	99.87
KOG0394\|consensus		210		99.87
cd01863		161	Rab18 Rab18 subfamily. Mammalian Rab18 is implicat	99.87
smart00175		164	RAB Rab subfamily of small GTPases. Rab GTPases ar	99.87
cd04152		183	Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i	99.87
KOG0086\|consensus		214		99.86
cd04123		162	Rab21 Rab21 subfamily. The localization and functi	99.86
PTZ00132		215	GTP-binding nuclear protein Ran; Provisional	99.86
cd04154		173	Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are	99.86
cd04139		164	RalA_RalB RalA/RalB subfamily. The Ral (Ras-like)	99.86
cd04114		169	Rab30 Rab30 subfamily. Rab30 appears to be associa	99.86
cd01862		172	Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th	99.86
cd00157		171	Rho Rho (Ras homology) family. Members of the Rho	99.86
cd04129		187	Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that	99.86
PF08355		76	EF_assoc_1: EF hand associated; InterPro: IPR01356	99.86
KOG0395\|consensus		196		99.85
KOG0097\|consensus		215		99.85
cd04157		162	Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub	99.85
cd04147		198	Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v	99.85
KOG0079\|consensus		198		99.85
cd04151		158	Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t	99.85
cd04153		174	Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a	99.85
KOG0091\|consensus		213		99.85
cd04161		167	Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (	99.84
cd04156		160	ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su	99.84
cd04137		180	RheB Rheb (Ras Homolog Enriched in Brain) subfamil	99.84
cd01892		169	Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr	99.84
cd00876		160	Ras Ras family. The Ras family of the Ras superfam	99.84
cd04133		176	Rop_like Rop subfamily. The Rop (Rho-related prote	99.84
cd04121		189	Rab40 Rab40 subfamily. This subfamily contains Rab	99.83
cd04172		182	Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE	99.83
KOG0093\|consensus		193		99.83
smart00178		184	SAR Sar1p-like members of the Ras-family of small	99.83
cd00878		158	Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik	99.83
cd04102		202	RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove	99.83
cd00879		190	Sar1 Sar1 subfamily. Sar1 is an essential componen	99.83
cd00154		159	Rab Rab family. Rab GTPases form the largest famil	99.83
cd04160		167	Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote	99.82
cd04131		178	Rnd Rnd subfamily. The Rnd subfamily contains Rnd1	99.82
cd04174		232	Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb	99.82
cd01875		191	RhoG RhoG subfamily. RhoG is a GTPase with high se	99.82
COG5126		160	FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S	99.82
KOG0081\|consensus		219		99.82
cd04159		159	Arl10_like Arl10-like subfamily. Arl9/Arl10 was id	99.82
cd04120		202	Rab12 Rab12 subfamily. Rab12 was first identified	99.81
KOG0083\|consensus		192		99.81
KOG0097\|consensus		215		99.81
cd04141		172	Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p	99.81
cd04155		173	Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f	99.8
PRK05291		449	trmE tRNA modification GTPase TrmE; Reviewed	99.8
COG0486		454	ThdF Predicted GTPase [General function prediction	99.8
KOG0095\|consensus		213		99.79
cd01897		168	NOG NOG1 is a nucleolar GTP-binding protein presen	99.79
KOG0027\|consensus		151		99.79
TIGR00450		442	mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE	99.79
cd01890		179	LepA LepA subfamily. LepA belongs to the GTPase fa	99.79
PLN00023		334	GTP-binding protein; Provisional	99.79
cd01874		175	Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas	99.79
PF00025		175	Arf: ADP-ribosylation factor family The prints ent	99.79
KOG0081\|consensus		219		99.78
KOG0088\|consensus		218		99.78
KOG4252\|consensus		246		99.78
cd04173		222	Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb	99.78
cd01898		170	Obg Obg subfamily. The Obg nucleotide binding prot	99.77
cd04122		166	Rab14 Rab14 subfamily. Rab14 GTPases are localized	99.77
cd04117		161	Rab15 Rab15 subfamily. Rab15 colocalizes with the	99.77
COG1100		219	GTPase SAR1 and related small G proteins [General	99.76
cd01878		204	HflX HflX subfamily. A distinct conserved domain w	99.75
KOG0395\|consensus		196		99.75
cd04107		201	Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38	99.75
cd04171		164	SelB SelB subfamily. SelB is an elongation factor	99.75
cd04134		189	Rho3 Rho3 subfamily. Rho3 is a member of the Rho f	99.75
TIGR00231		161	small_GTP small GTP-binding protein domain. This m	99.75
cd04136		163	Rap_like Rap-like subfamily. The Rap subfamily con	99.74
TIGR03156		351	GTP_HflX GTP-binding protein HflX. This protein fa	99.74
TIGR00436		270	era GTP-binding protein Era. Era is an essential G	99.74
cd01871		174	Rac1_like Rac1-like subfamily. The Rac1-like subfa	99.74
cd04128		182	Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi	99.74
cd04127		180	Rab27A Rab27a subfamily. The Rab27a subfamily cons	99.74
PF08477		119	Miro: Miro-like protein; InterPro: IPR013684 Mitoc	99.74
cd04175		164	Rap1 Rap1 subgroup. The Rap1 subgroup is part of t	99.74
PRK15494		339	era GTPase Era; Provisional	99.74
cd04126		220	Rab20 Rab20 subfamily. Rab20 is one of several Rab	99.74
PF00071		162	Ras: Ras family; InterPro: IPR001806 Small GTPases	99.74
KOG0393\|consensus		198		99.74
TIGR02528		142	EutP ethanolamine utilization protein, EutP. This	99.73
cd01887		168	IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo	99.73
smart00174		174	RHO Rho (Ras homology) subfamily of Ras-like small	99.73
KOG0073\|consensus		185		99.73
cd04176		163	Rap2 Rap2 subgroup. The Rap2 subgroup is part of t	99.73
cd04140		165	ARHI_like ARHI subfamily. ARHI (A Ras homolog memb	99.72
PTZ00369		189	Ras-like protein; Provisional	99.72
cd01867		167	Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp	99.72
cd04108		170	Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr	99.72
cd01869		166	Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev	99.72
cd01865		165	Rab3 Rab3 subfamily. The Rab3 subfamily contains R	99.72
cd04111		211	Rab39 Rab39 subfamily. Found in eukaryotes, Rab39	99.71
cd04138		162	H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras,	99.71
cd04110		199	Rab35 Rab35 subfamily. Rab35 is one of several Rab	99.71
cd01873		195	RhoBTB RhoBTB subfamily. Members of the RhoBTB sub	99.71
cd04109		215	Rab28 Rab28 subfamily. First identified in maize,	99.71
PLN03071		219	GTP-binding nuclear protein Ran; Provisional	99.71
PRK12299		335	obgE GTPase CgtA; Reviewed	99.71
cd04144		190	Ras2 Ras2 subfamily. The Ras2 subfamily, found exc	99.71
cd04164		157	trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein	99.71
cd04116		170	Rab9 Rab9 subfamily. Rab9 is found in late endosom	99.71
smart00173		164	RAS Ras subfamily of RAS small GTPases. Similar in	99.71
KOG0075\|consensus		186		99.7
cd01894		157	EngA1 EngA1 subfamily. This CD represents the firs	99.7
cd04135		174	Tc10 TC10 subfamily. TC10 is a Rho family protein	99.7
PRK03003		472	GTP-binding protein Der; Reviewed	99.7
PLN03108		210	Rab family protein; Provisional	99.7
cd01864		165	Rab19 Rab19 subfamily. Rab19 proteins are associat	99.7
PRK04213		201	GTP-binding protein; Provisional	99.7
cd04145		164	M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf	99.7
PRK11058		426	GTPase HflX; Provisional	99.69
cd01868		165	Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a	99.69
PTZ00099		176	rab6; Provisional	99.69
cd04103		158	Centaurin_gamma Centaurin gamma. The centaurins (a	99.69
cd04106		162	Rab23_lke Rab23-like subfamily. Rab23 is a member	99.69
cd04119		168	RJL RJL (RabJ-Like) subfamily. RJLs are found in m	99.69
PLN03110		216	Rab GTPase; Provisional	99.68
cd01881		176	Obg_like The Obg-like subfamily consists of five w	99.68
cd04125		188	RabA_like RabA-like subfamily. RabA was first iden	99.68
cd04105		203	SR_beta Signal recognition particle receptor, beta	99.68
cd01866		168	Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg	99.68
KOG0070\|consensus		181		99.68
cd04115		170	Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u	99.68
cd04130		173	Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive	99.68
cd01895		174	EngA2 EngA2 subfamily. This CD represents the seco	99.68
cd01891		194	TypA_BipA TypA (tyrosine phosphorylated protein A)	99.68
cd04143		247	Rhes_like Rhes_like subfamily. This subfamily incl	99.68
TIGR02729		329	Obg_CgtA Obg family GTPase CgtA. This model descri	99.68
cd04132		187	Rho4_like Rho4-like subfamily. Rho4 is a GTPase th	99.67
cd00877		166	Ran Ran (Ras-related nuclear proteins) /TC4 subfam	99.67
KOG3883\|consensus		198		99.67
cd01879		158	FeoB Ferrous iron transport protein B (FeoB) subfa	99.67
cd04142		198	RRP22 RRP22 subfamily. RRP22 (Ras-related protein	99.67
cd00881		189	GTP_translation_factor GTP translation factor fami	99.67
cd04177		168	RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the	99.66
KOG0096\|consensus		216		99.66
cd04112		191	Rab26 Rab26 subfamily. First identified in rat pan	99.66
cd01889		192	SelB_euk SelB subfamily. SelB is an elongation fac	99.66
cd04113		161	Rab4 Rab4 subfamily. Rab4 has been implicated in n	99.66
PRK15467		158	ethanolamine utilization protein EutP; Provisional	99.65
KOG0028\|consensus		172		99.65
smart00176		200	RAN Ran (Ras-related nuclear proteins) /TC4 subfam	99.65
cd01870		175	RhoA_like RhoA-like subfamily. The RhoA subfamily	99.65
KOG0083\|consensus		192		99.65
TIGR03594		429	GTPase_EngA ribosome-associated GTPase EngA. EngA	99.65
PF02421		156	FeoB_N: Ferrous iron transport protein B; InterPro	99.65
cd00882		157	Ras_like_GTPase Ras-like GTPase superfamily. The R	99.64
COG1159		298	Era GTPase [General function prediction only]	99.64
cd04124		161	RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily	99.64
cd04163		168	Era Era subfamily. Era (E. coli Ras-like protein)	99.64
PRK00089		292	era GTPase Era; Reviewed	99.64
cd04129		187	Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that	99.63
cd04101		164	RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove	99.63
TIGR01393		595	lepA GTP-binding protein LepA. LepA (GUF1 in Sacca	99.63
cd04146		165	RERG_RasL11_like RERG/RasL11-like subfamily. RERG	99.63
cd04148		221	RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki	99.63
cd04118		193	Rab24 Rab24 subfamily. Rab24 is distinct from othe	99.62
PRK12297		424	obgE GTPase CgtA; Reviewed	99.62
PLN03118		211	Rab family protein; Provisional	99.61
cd04168		237	TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T	99.61
cd01860		163	Rab5_related Rab5-related subfamily. This subfamil	99.61
PRK12296		500	obgE GTPase CgtA; Reviewed	99.6
KOG0071\|consensus		180		99.6
KOG1191\|consensus		531		99.6
TIGR00487		587	IF-2 translation initiation factor IF-2. This mode	99.6
PRK12298		390	obgE GTPase CgtA; Reviewed	99.6
cd01861		161	Rab6 Rab6 subfamily. Rab6 is involved in microtubu	99.59
cd01862		172	Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th	99.59
PRK00093		435	GTP-binding protein Der; Reviewed	99.59
PRK05306		787	infB translation initiation factor IF-2; Validated	99.59
cd04139		164	RalA_RalB RalA/RalB subfamily. The Ral (Ras-like)	99.58
cd01896		233	DRG The developmentally regulated GTP-binding prot	99.58
smart00175		164	RAB Rab subfamily of small GTPases. Rab GTPases ar	99.58
cd04102		202	RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove	99.58
PRK00454		196	engB GTP-binding protein YsxC; Reviewed	99.58
cd04123		162	Rab21 Rab21 subfamily. The localization and functi	99.58
PRK09518		712	bifunctional cytidylate kinase/GTPase Der; Reviewe	99.58
cd01888		203	eIF2_gamma eIF2-gamma (gamma subunit of initiation	99.58
TIGR03598		179	GTPase_YsxC ribosome biogenesis GTP-binding protei	99.58
KOG4252\|consensus		246		99.57
CHL00189		742	infB translation initiation factor 2; Provisional	99.57
PLN00223		181	ADP-ribosylation factor; Provisional	99.57
cd04162		164	Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9	99.57
cd01863		161	Rab18 Rab18 subfamily. Mammalian Rab18 is implicat	99.57
PLN00023		334	GTP-binding protein; Provisional	99.56
cd04114		169	Rab30 Rab30 subfamily. Rab30 appears to be associa	99.56
cd04147		198	Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v	99.56
COG1160		444	Predicted GTPases [General function prediction onl	99.55
KOG0031\|consensus		171		99.55
TIGR00475		581	selB selenocysteine-specific elongation factor Sel	99.55
smart00177		175	ARF ARF-like small GTPases; ARF, ADP-ribosylation	99.55
cd04149		168	Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor	99.54
cd04137		180	RheB Rheb (Ras Homolog Enriched in Brain) subfamil	99.54
PF00009		188	GTP_EFTU: Elongation factor Tu GTP binding domain;	99.54
KOG0074\|consensus		185		99.54
PRK05433		600	GTP-binding protein LepA; Provisional	99.53
KOG0076\|consensus		197		99.53
cd00880		163	Era_like Era (E. coli Ras-like protein)-like. This	99.53
cd00157		171	Rho Rho (Ras homology) family. Members of the Rho	99.53
PTZ00133		182	ADP-ribosylation factor; Provisional	99.53
TIGR00491		590	aIF-2 translation initiation factor aIF-2/yIF-2. T	99.52
cd01893		166	Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr	99.51
cd04158		169	ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor	99.51
PTZ00183		158	centrin; Provisional	99.51
cd00876		160	Ras Ras family. The Ras family of the Ras superfam	99.51
PRK09554		772	feoB ferrous iron transport protein B; Reviewed	99.51
TIGR02528		142	EutP ethanolamine utilization protein, EutP. This	99.5
PTZ00132		215	GTP-binding nuclear protein Ran; Provisional	99.5
cd04170		268	EF-G_bact Elongation factor G (EF-G) subfamily. Tr	99.5
TIGR00437		591	feoB ferrous iron transporter FeoB. FeoB (773 amin	99.49
cd01886		270	EF-G Elongation factor G (EF-G) subfamily. Translo	99.49
cd04167		213	Snu114p Snu114p subfamily. Snu114p is one of sever	99.48
KOG1423\|consensus		379		99.48
PTZ00184		149	calmodulin; Provisional	99.48
KOG0072\|consensus		182		99.48
cd04150		159	Arf1_5_like Arf1-Arf5-like subfamily. This subfami	99.48
cd04166		208	CysN_ATPS CysN_ATPS subfamily. CysN, together with	99.48
KOG4423\|consensus		229		99.48
PF10662		143	PduV-EutP: Ethanolamine utilisation - propanediol	99.47
COG2229		187	Predicted GTPase [General function prediction only	99.47
cd04154		173	Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are	99.46
cd04157		162	Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub	99.46
TIGR00483		426	EF-1_alpha translation elongation factor EF-1 alph	99.46
PRK10218		607	GTP-binding protein; Provisional	99.46
TIGR03680		406	eif2g_arch translation initiation factor 2 subunit	99.46
KOG4423\|consensus		229		99.45
cd01884		195	EF_Tu EF-Tu subfamily. This subfamily includes ort	99.45
PRK04000		411	translation initiation factor IF-2 subunit gamma;	99.45
PRK12317		425	elongation factor 1-alpha; Reviewed	99.45
cd04161		167	Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (	99.45
cd01876		170	YihA_EngB The YihA (EngB) subfamily. This subfamil	99.44
cd04152		183	Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i	99.44
cd00154		159	Rab Rab family. Rab GTPases form the largest famil	99.43
KOG0030\|consensus		152		99.43
cd04153		174	Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a	99.43
PF09439		181	SRPRB: Signal recognition particle receptor beta s	99.42
KOG1673\|consensus		205		99.42
PRK04004		586	translation initiation factor IF-2; Validated	99.41
TIGR01394		594	TypA_BipA GTP-binding protein TypA/BipA. This bact	99.41
KOG0037\|consensus		221		99.4
cd04156		160	ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su	99.39
PRK10512		614	selenocysteinyl-tRNA-specific translation factor;	99.39
cd04151		158	Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t	99.39
cd04165		224	GTPBP1_like GTPBP1-like. Mammalian GTP binding pro	99.39
TIGR00484		689	EF-G translation elongation factor EF-G. After pep	99.38
cd01883		219	EF1_alpha Eukaryotic elongation factor 1 (EF1) alp	99.38
cd00879		190	Sar1 Sar1 subfamily. Sar1 is an essential componen	99.38
cd04169		267	RF3 RF3 subfamily. Peptide chain release factor 3	99.37
cd00878		158	Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik	99.37
cd04104		197	p47_IIGP_like p47 (47-kDa) family. The p47 GTPase	99.35
cd01885		222	EF2 EF2 (for archaea and eukarya). Translocation r	99.35
smart00178		184	SAR Sar1p-like members of the Ras-family of small	99.34
COG0370		653	FeoB Fe2+ transport system protein B [Inorganic io	99.34
PRK12736		394	elongation factor Tu; Reviewed	99.34
KOG1489\|consensus		366		99.33
COG1084		346	Predicted GTPase [General function prediction only	99.33
cd04159		159	Arl10_like Arl10-like subfamily. Arl9/Arl10 was id	99.32
cd01899		318	Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg	99.32
PRK12735		396	elongation factor Tu; Reviewed	99.31
COG1100		219	GTPase SAR1 and related small G proteins [General	99.3
COG1163		365	DRG Predicted GTPase [General function prediction	99.3
PRK13351		687	elongation factor G; Reviewed	99.3
COG2262		411	HflX GTPases [General function prediction only]	99.3
COG3596		296	Predicted GTPase [General function prediction only	99.3
PF01926		116	MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I	99.29
KOG0077\|consensus		193		99.28
TIGR00485		394	EF-Tu translation elongation factor TU. This align	99.28
PRK00007		693	elongation factor G; Reviewed	99.28
cd01890		179	LepA LepA subfamily. LepA belongs to the GTPase fa	99.27
CHL00071		409	tufA elongation factor Tu	99.27
cd04155		173	Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f	99.27
PRK04213		201	GTP-binding protein; Provisional	99.27
cd04160		167	Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote	99.26
COG0218		200	Predicted GTPase [General function prediction only	99.23
KOG0090\|consensus		238		99.23
TIGR02034		406	CysN sulfate adenylyltransferase, large subunit. H	99.23
PLN03126		478	Elongation factor Tu; Provisional	99.23
COG0532		509	InfB Translation initiation factor 2 (IF-2; GTPase	99.23
PRK05124		474	cysN sulfate adenylyltransferase subunit 1; Provis	99.22
KOG1673\|consensus		205		99.22
TIGR00231		161	small_GTP small GTP-binding protein domain. This m	99.22
PLN03127		447	Elongation factor Tu; Provisional	99.22
PRK00049		396	elongation factor Tu; Reviewed	99.21
cd01897		168	NOG NOG1 is a nucleolar GTP-binding protein presen	99.21
KOG0034\|consensus		187		99.21
PRK00741		526	prfC peptide chain release factor 3; Provisional	99.2
cd01878		204	HflX HflX subfamily. A distinct conserved domain w	99.19
KOG0096\|consensus		216		99.19
TIGR00503		527	prfC peptide chain release factor 3. This translat	99.19
KOG0462\|consensus		650		99.19
cd01879		158	FeoB Ferrous iron transport protein B (FeoB) subfa	99.18
PLN00043		447	elongation factor 1-alpha; Provisional	99.18
PRK12739		691	elongation factor G; Reviewed	99.18
COG0481		603	LepA Membrane GTPase LepA [Cell envelope biogenesi	99.17
PF00025		175	Arf: ADP-ribosylation factor family The prints ent	99.17
PTZ00327		460	eukaryotic translation initiation factor 2 gamma s	99.16
smart00010		124	small_GTPase Small GTPase of the Ras superfamily;	99.16
PRK05506		632	bifunctional sulfate adenylyltransferase subunit 1	99.15
KOG1145\|consensus		683		99.15
PTZ00141		446	elongation factor 1- alpha; Provisional	99.14
cd04171		164	SelB SelB subfamily. SelB is an elongation factor	99.13
PRK00454		196	engB GTP-binding protein YsxC; Reviewed	99.12
PRK15467		158	ethanolamine utilization protein EutP; Provisional	99.11
PRK09602		396	translation-associated GTPase; Reviewed	99.11
PRK09866		741	hypothetical protein; Provisional	99.11
PTZ00099		176	rab6; Provisional	99.11
COG0536		369	Obg Predicted GTPase [General function prediction	99.1
cd01852		196	AIG1 AIG1 (avrRpt2-induced gene 1). This represent	99.1
cd01887		168	IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo	99.1
KOG0036\|consensus		463		99.09
PF08477		119	Miro: Miro-like protein; InterPro: IPR013684 Mitoc	99.08
KOG0073\|consensus		185		99.08
KOG3883\|consensus		198		99.07
cd01898		170	Obg Obg subfamily. The Obg nucleotide binding prot	99.05
cd01850		276	CDC_Septin CDC/Septin. Septins are a conserved fam	99.03
PF04670		232	Gtr1_RagA: Gtr1/RagA G protein conserved region; I	99.02
PRK12740		668	elongation factor G; Reviewed	99.01
cd01891		194	TypA_BipA TypA (tyrosine phosphorylated protein A)	99.0
TIGR00450		442	mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE	99.0
TIGR03156		351	GTP_HflX GTP-binding protein HflX. This protein fa	99.0
TIGR00490		720	aEF-2 translation elongation factor aEF-2. This mo	98.99
PRK15494		339	era GTPase Era; Provisional	98.99
cd01894		157	EngA1 EngA1 subfamily. This CD represents the firs	98.97
KOG0044\|consensus		193		98.96
cd01853		249	Toc34_like Toc34-like (Translocon at the Outer-env	98.96
PRK05291		449	trmE tRNA modification GTPase TrmE; Reviewed	98.96
TIGR00991		313	3a0901s02IAP34 GTP-binding protein (Chloroplast En	98.93
TIGR00437		591	feoB ferrous iron transporter FeoB. FeoB (773 amin	98.92
KOG0070\|consensus		181		98.92
TIGR00436		270	era GTP-binding protein Era. Era is an essential G	98.92
COG5256		428	TEF1 Translation elongation factor EF-1alpha (GTPa	98.92
cd00881		189	GTP_translation_factor GTP translation factor fami	98.9
COG4917		148	EutP Ethanolamine utilization protein [Amino acid	98.9
KOG1532\|consensus		366		98.9
PF10662		143	PduV-EutP: Ethanolamine utilisation - propanediol	98.89
cd05022		89	S-100A13 S-100A13: S-100A13 domain found in protei	98.88
PRK12299		335	obgE GTPase CgtA; Reviewed	98.88
cd01895		174	EngA2 EngA2 subfamily. This CD represents the seco	98.87
cd04163		168	Era Era subfamily. Era (E. coli Ras-like protein)	98.87
cd00882		157	Ras_like_GTPase Ras-like GTPase superfamily. The R	98.86
cd01882		225	BMS1 Bms1. Bms1 is an essential, evolutionarily co	98.86
PF02421		156	FeoB_N: Ferrous iron transport protein B; InterPro	98.86
cd04164		157	trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein	98.84
KOG0075\|consensus		186		98.84
PRK09435		332	membrane ATPase/protein kinase; Provisional	98.84
PRK00089		292	era GTPase Era; Reviewed	98.83
COG4108		528	PrfC Peptide chain release factor RF-3 [Translatio	98.83
PLN00116		843	translation elongation factor EF-2 subunit; Provis	98.83
KOG1490\|consensus		620		98.82
PRK14845		1049	translation initiation factor IF-2; Provisional	98.82
cd01876		170	YihA_EngB The YihA (EngB) subfamily. This subfamil	98.82
TIGR03598		179	GTPase_YsxC ribosome biogenesis GTP-binding protei	98.82
COG0480		697	FusA Translation elongation factors (GTPases) [Tra	98.81
TIGR02729		329	Obg_CgtA Obg family GTPase CgtA. This model descri	98.81
cd01881		176	Obg_like The Obg-like subfamily consists of five w	98.81
PRK13768		253	GTPase; Provisional	98.8
COG0218		200	Predicted GTPase [General function prediction only	98.8
PTZ00416		836	elongation factor 2; Provisional	98.8
PRK11058		426	GTPase HflX; Provisional	98.78
TIGR01393		595	lepA GTP-binding protein LepA. LepA (GUF1 in Sacca	98.78
COG1217		603	TypA Predicted membrane GTPase involved in stress	98.77
TIGR00487		587	IF-2 translation initiation factor IF-2. This mode	98.75
PF03029		238	ATP_bind_1: Conserved hypothetical ATP binding pro	98.75
TIGR00101		199	ureG urease accessory protein UreG. This model rep	98.74
KOG4223\|consensus		325		98.73
cd05027		88	S-100B S-100B: S-100B domain found in proteins sim	98.72
smart00027		96	EH Eps15 homology domain. Pair of EF hand motifs t	98.72
TIGR00750		300	lao LAO/AO transport system ATPase. Mutations have	98.72
PRK07560		731	elongation factor EF-2; Reviewed	98.71
cd01889		192	SelB_euk SelB subfamily. SelB is an elongation fac	98.71
PF13499		66	EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A	98.71
KOG0461\|consensus		522		98.7
PLN02964		644	phosphatidylserine decarboxylase	98.64
COG0486		454	ThdF Predicted GTPase [General function prediction	98.63
smart00053		240	DYNc Dynamin, GTPase. Large GTPases that mediate v	98.62
COG5257		415	GCD11 Translation initiation factor 2, gamma subun	98.62
PRK09554		772	feoB ferrous iron transport protein B; Reviewed	98.62
COG2895		431	CysN GTPases - Sulfate adenylate transferase subun	98.62
PF00350		168	Dynamin_N: Dynamin family; InterPro: IPR001401 Mem	98.61
cd01896		233	DRG The developmentally regulated GTP-binding prot	98.61
CHL00189		742	infB translation initiation factor 2; Provisional	98.6
TIGR00157		245	ribosome small subunit-dependent GTPase A. The Aqu	98.6
PRK12296		500	obgE GTPase CgtA; Reviewed	98.6
cd00052		67	EH Eps15 homology domain; found in proteins implic	98.59
PRK05306		787	infB translation initiation factor IF-2; Validated	98.59
PRK12297		424	obgE GTPase CgtA; Reviewed	98.59
KOG1707\|consensus		625		98.59
cd05026		93	S-100Z S-100Z: S-100Z domain found in proteins sim	98.58
TIGR00475		581	selB selenocysteine-specific elongation factor Sel	98.57
KOG1144\|consensus		1064		98.57

>KOG1707\|consensus	Back alignment and domain information

Probab=100.00  E-value=1.1e-113  Score=882.25  Aligned_cols=576  Identities=46%  Similarity=0.796  Sum_probs=525.5

Q ss_pred             ccCCCccEEEEEcCCCCCHHHHHHHHHcCCCCCcCCCCCcceEecCccCCCceeEEEEeCCCCCCChHHHHHHHHhcCcE
Q psy3301           5 VSLRRNVRILLLGDRHVGKTSLILSLVSEEFPELVPSKAEEITIPPDVTPEMVPTHIVDYSEVDQTVDELTEEIQKAHVI   84 (608)
Q Consensus         5 ~~~~~~~kI~lvG~~~vGKTSLi~~l~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~i~Dt~G~~~~~~~~~~~~~~ad~i   84 (608)
                      ...++.+||+|+|+.||||||||.+|+.++|++++|+..++++||.+++++.+++.|+||+..++....+..++++||++
T Consensus         4 ~~t~kdVRIvliGD~G~GKtSLImSL~~eef~~~VP~rl~~i~IPadvtPe~vpt~ivD~ss~~~~~~~l~~EirkA~vi   83 (625)
T KOG1707|consen    4 DETLKDVRIVLIGDEGVGKTSLIMSLLEEEFVDAVPRRLPRILIPADVTPENVPTSIVDTSSDSDDRLCLRKEIRKADVI   83 (625)
T ss_pred             ccCccceEEEEECCCCccHHHHHHHHHhhhccccccccCCccccCCccCcCcCceEEEecccccchhHHHHHHHhhcCEE
Confidence            35678999999999999999999999999999999999999999999999999999999998888888889999999999


Q ss_pred             EEEEEcCChhhHHHHHHhHHHHHhhh-ccCCCCcEEEEEeCcCCCCCCC--------------------cccCcccCcCH
Q psy3301          85 CLVYSVVDDASIDRLSSHWLPFLRNC-LVDTCLPIVLVGNKVDLVDYST--------------------VESSAKTLKNI  143 (608)
Q Consensus        85 ilV~d~~~~~s~~~~~~~~~~~i~~~-~~~~~~piilv~nK~Dl~~~~~--------------------~e~SAk~~~~i  143 (608)
                      ++||+++++++++.+..+|++++++. ....++||||||||+|......                    ++|||++..|+
T Consensus        84 ~lvyavd~~~T~D~ist~WLPlir~~~~~~~~~PVILvGNK~d~~~~~~~s~e~~~~pim~~f~EiEtciecSA~~~~n~  163 (625)
T KOG1707|consen   84 CLVYAVDDESTVDRISTKWLPLIRQLFGDYHETPVILVGNKSDNGDNENNSDEVNTLPIMIAFAEIETCIECSALTLANV  163 (625)
T ss_pred             EEEEecCChHHhhhhhhhhhhhhhcccCCCccCCEEEEeeccCCccccccchhHHHHHHHHHhHHHHHHHhhhhhhhhhh
Confidence            99999999999999999999999964 2338999999999999875433                    99999999999


Q ss_pred             HHHHHHHHHHHhCCCCCccccccccChHHHHHHHHHHHHhccCCCCCccCHHHHHHHhhcccCCCCChhhHHHHHHHHHH
Q psy3301         144 SEMFYYAQKAVLHPMAPIYISDKQELTPECIKALTRIFKVCDLDNDNLLSDKELNAFQRRCFDAPLSRDSLEDVKIVIRK  223 (608)
Q Consensus       144 ~~lf~~l~~~i~~~~~~l~~~~~~~l~~~~~~~L~~~f~~~D~d~dg~l~~~El~~~~~~~~g~~~~~~el~~i~~~~~~  223 (608)
                      .|+|++++++++||..|+|++..+++++.|+.+|.|+|.++|.|+||.+++.|++.++++||+.+++..+++.++..++.
T Consensus       164 ~e~fYyaqKaVihPt~PLyda~~qelkp~~v~al~RIFki~D~d~D~~Lsd~Eln~fQ~~CF~~pl~p~~l~~vk~vv~e  243 (625)
T KOG1707|consen  164 SELFYYAQKAVIHPTSPLYDAEEQELKPRCVKALKRIFKISDSDNDGALSDAELNDFQKKCFNTPLDPQELEDVKNVVQE  243 (625)
T ss_pred             HhhhhhhhheeeccCccccccccccccHHHHHHHHHHHhhhccccccccchhhhhHHHHHhcCCCCCHHHHHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcCCCccCCCCcchhhHHHHHHHHHhcCCCcchhHHhhhccCCCCccccccccCCCCCCCCCCccccCHhHHHHHHHHHh
Q psy3301         224 NINDGVSANNCITLNGFLFLHNLFMQRGRSHTTWTVLRKFGYNEDLQISKEFLHPPLNIPATCTAELSDKGQQFLTTLFY  303 (608)
Q Consensus       224 ~~~~~~~~~~~i~~~~F~~l~~~~~~~~~~e~~w~~lr~f~y~~~l~~~~~~~~p~~~~~~~~~~eLs~~~~~~l~~~F~  303 (608)
                      .+|+|+. +.++|..||++||.+|+++|||||||+|||+|||+|+|+|+++|++|.+.+|+++++||++.+++||..+|.
T Consensus       244 ~~p~gv~-~~~ltl~GFLfL~~lfiergr~EttW~iLR~fgY~DsleL~~~~l~p~~~~~p~~s~ELs~~~~~Fl~~~f~  322 (625)
T KOG1707|consen  244 ICPDGVY-ERGLTLPGFLFLNTLFIERGRHETTWTILRKFGYTDSLELTDEYLPPRLKVPPDQSVELSPKGYRFLVDVFE  322 (625)
T ss_pred             hcCchhh-hccccccchHHHHHHHHHhccccchhhhhhhcCCcchhhhhhhhcCccccCCCCcceeccHHHHHHHHHHHH
Confidence            9999999 999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhcCCCCCCCCHHHHHHhhccCCCCCCCCCccccccceecCCCCccchhhHHhHhhhhhccCHHHHHHHHHhcCCCCCCC
Q psy3301         304 RFDKDGDGALSPEEQARLFSLCPPECPPWTDREMRAMVATNSKGWITMQGFLCYWILTTLFNVNKTLEYLAYFGYPITDR  383 (608)
Q Consensus       304 ~fD~d~dG~ls~~El~~~~~~~~~~~~~~~~~~~~~~~d~~~~g~i~~~ef~~~w~~~~~~~~~~~~~~l~y~g~~~~~~  383 (608)
                      +||.|+||.|+++||..+|+++|  ..||...........+..|+++|++|+++|+|||++||.+|++||+|+||+.. .
T Consensus       323 ~~D~d~Dg~L~p~El~~LF~~~P--~~pW~~~~~~~~t~~~~~G~ltl~g~l~~WsL~Tlld~~~t~~~L~Ylgf~~~-~  399 (625)
T KOG1707|consen  323 KFDRDNDGALSPEELKDLFSTAP--GSPWTSSPYKDSTVKNERGWLTLNGFLSQWSLMTLLDPRRTLEYLAYLGFPTD-A  399 (625)
T ss_pred             hccCCCCCCcCHHHHHHHhhhCC--CCCCCCCcccccceecccceeehhhHHHHHHHHhhccHHHHHHHHHhcCCccc-c
Confidence            99999999999999999999999  99997666666777779999999999999999999999999999999999932 2


Q ss_pred             CCCceeeEecchhhhhhhcccCCCceEEEEEEccCCCchHHHHHHHhcCCCCCCCCCCCCCCcCCCceEecceEeCCcce
Q psy3301         384 ENQTSGVLVTREKQVDLLKKQTTRNVYVCHVIGNRSTGKTALCQSILRKHHDSSKTSITSPVECDPPYTINTTTVYGQEK  463 (608)
Q Consensus       384 ~~~~~a~~vtr~~~~~~~~~~~~r~~~k~~viG~~gvGKTsll~~f~~~~~~~~~~~t~~~~~~~~~~~i~~~~v~Gqe~  463 (608)
                      ++|++|++|||.|+.++++++++|+||+|+|+|+.++|||+||++|+++.+...+  +...   ...+++|.+.+.|+++
T Consensus       400 ~~~~~ai~vtRkr~~d~~~~~~~R~Vf~C~V~G~k~~GKs~lL~sflgr~~~~~~--~~~~---~~~~avn~v~~~g~~k  474 (625)
T KOG1707|consen  400 GSQASAIRVTRKRKLDRKKKQTDRKVFQCFVVGPKNCGKSALLQSFLGRSMSDNN--TGTT---KPRYAVNSVEVKGQQK  474 (625)
T ss_pred             cccccceehhhhhhhhhccccccceeeeEEEEcCCcCchHHHHHHHhcccccccc--ccCC---CCceeeeeeeeccccc
Confidence            3899999999999999999999999999999999999999999999999998854  3444   7899999999999999


Q ss_pred             eEeeeecccccccccCCCCcccccc----------------------cccCCCCCcEEEEEeCCCCCcchhcccccHHHH
Q psy3301         464 YLVLKEILVRDEQLPVLLPVDVDCD----------------------KYFSTSKIPVMLVAGKSDMPRARQDYLMQPDIF  521 (608)
Q Consensus       464 ~~~l~~~~~~~v~d~~l~~~~~~~~----------------------~~~~~~~~p~ilVgnK~DL~~~~~~~~~~~~~~  521 (608)
                      |++|+++... ..+ .+++.+..||                      +++....+||++|++|+||++..|+++.++.+|
T Consensus       475 ~LiL~ei~~~-~~~-~l~~ke~~cDv~~~~YDsS~p~sf~~~a~v~~~~~~~~~~Pc~~va~K~dlDe~~Q~~~iqpde~  552 (625)
T KOG1707|consen  475 YLILREIGED-DQD-FLTSKEAACDVACLVYDSSNPRSFEYLAEVYNKYFDLYKIPCLMVATKADLDEVPQRYSIQPDEF  552 (625)
T ss_pred             eEEEeecCcc-ccc-cccCccceeeeEEEecccCCchHHHHHHHHHHHhhhccCCceEEEeeccccchhhhccCCChHHH
Confidence            9999999875 333 3444555555                      444568999999999999999999999999999


Q ss_pred             HHHcCCCCceEEccC-CCHHHHHHHHHHHHcCCCCCCcccccCCCcccccccccccCchhHHHH--HHHHHHHHHHHHHH
Q psy3301         522 CETHKLSPAHSFSAA-NNDREVFVKLATMAAFPRFHPAWMLFYPDLTSHFYMFNLHDNKAYLWK--TGLSVAVITLLGII  598 (608)
Q Consensus       522 ~~~~~~~~~~~~S~~-~~v~e~F~~l~~~a~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~g~~~~~~~~~~  598 (608)
                      |+++++++|.++|+. .+-.++|.+|+.+|.+||        +|+++++.++        .|.+  ++..+|+++++|+.
T Consensus       553 ~~~~~i~~P~~~S~~~~~s~~lf~kL~~~A~~Ph--------~~~~~~~~~~--------~~~~~l~~~~~g~~~~~g~~  616 (625)
T KOG1707|consen  553 CRQLGLPPPIHISSKTLSSNELFIKLATMAQYPH--------IPRIEEEKSS--------LQNRLLMAVSGGAVAVAGLA  616 (625)
T ss_pred             HHhcCCCCCeeeccCCCCCchHHHHHHHhhhCCC--------ccccccccch--------hhHHHHHHHHHHHHHHhhHH
Confidence            999999999999932 444999999999999999        5666555322        3322  23333499999999


Q ss_pred             HHHHhCCCC
Q psy3301         599 FAKFLRPPR  607 (608)
Q Consensus       599 ~~~~~~~~~  607 (608)
                      .||..+.++
T Consensus       617 ~~~~~~~~k  625 (625)
T KOG1707|consen  617 LYKLYKARK  625 (625)
T ss_pred             HHhhhhccC
Confidence            999987653

>KOG0092\|consensus	Back alignment and domain information

>KOG0084\|consensus	Back alignment and domain information

>PRK03003 GTP-binding protein Der; Reviewed	Back alignment and domain information

>KOG0094\|consensus	Back alignment and domain information

>KOG0078\|consensus	Back alignment and domain information

>PF08356 EF_assoc_2: EF hand associated; InterPro: IPR013567 This region predominantly appears near EF-hands (IPR002048 from INTERPRO) in GTP-binding proteins	Back alignment and domain information

>cd04133 Rop_like Rop subfamily	Back alignment and domain information

>KOG0080\|consensus	Back alignment and domain information

>cd01875 RhoG RhoG subfamily	Back alignment and domain information

>KOG0098\|consensus	Back alignment and domain information

>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily	Back alignment and domain information

>cd04121 Rab40 Rab40 subfamily	Back alignment and domain information

>cd04120 Rab12 Rab12 subfamily	Back alignment and domain information

>KOG0079\|consensus	Back alignment and domain information

>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily	Back alignment and domain information

>cd04131 Rnd Rnd subfamily	Back alignment and domain information

>cd01874 Cdc42 Cdc42 subfamily	Back alignment and domain information

>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily	Back alignment and domain information

>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily	Back alignment and domain information

>KOG0394\|consensus	Back alignment and domain information

>KOG0084\|consensus	Back alignment and domain information

>KOG0087\|consensus	Back alignment and domain information

>cd04122 Rab14 Rab14 subfamily	Back alignment and domain information

>cd01893 Miro1 Miro1 subfamily	Back alignment and domain information

>cd04134 Rho3 Rho3 subfamily	Back alignment and domain information

>cd01871 Rac1_like Rac1-like subfamily	Back alignment and domain information

>cd04136 Rap_like Rap-like subfamily	Back alignment and domain information

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA	Back alignment and domain information

>KOG0078\|consensus	Back alignment and domain information

>KOG0086\|consensus	Back alignment and domain information

>PLN03071 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>cd04175 Rap1 Rap1 subgroup	Back alignment and domain information

>KOG0095\|consensus	Back alignment and domain information

>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily	Back alignment and domain information

>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily	Back alignment and domain information

>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2	Back alignment and domain information

>cd04103 Centaurin_gamma Centaurin gamma	Back alignment and domain information

>cd04176 Rap2 Rap2 subgroup	Back alignment and domain information

>cd04127 Rab27A Rab27a subfamily	Back alignment and domain information

>smart00173 RAS Ras subfamily of RAS small GTPases	Back alignment and domain information

>cd04117 Rab15 Rab15 subfamily	Back alignment and domain information

>cd04128 Spg1 Spg1p	Back alignment and domain information

>cd04144 Ras2 Ras2 subfamily	Back alignment and domain information

>PTZ00369 Ras-like protein; Provisional	Back alignment and domain information

>cd04119 RJL RJL (RabJ-Like) subfamily	Back alignment and domain information

>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily	Back alignment and domain information

>KOG0094\|consensus	Back alignment and domain information

>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases	Back alignment and domain information

>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases	Back alignment and domain information

>cd04140 ARHI_like ARHI subfamily	Back alignment and domain information

>cd04124 RabL2 RabL2 subfamily	Back alignment and domain information

>KOG0098\|consensus	Back alignment and domain information

>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily	Back alignment and domain information

>PRK00093 GTP-binding protein Der; Reviewed	Back alignment and domain information

>cd01865 Rab3 Rab3 subfamily	Back alignment and domain information

>KOG0093\|consensus	Back alignment and domain information

>cd04132 Rho4_like Rho4-like subfamily	Back alignment and domain information

>cd04109 Rab28 Rab28 subfamily	Back alignment and domain information

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>KOG0091\|consensus	Back alignment and domain information

>cd01864 Rab19 Rab19 subfamily	Back alignment and domain information

>cd04110 Rab35 Rab35 subfamily	Back alignment and domain information

>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily	Back alignment and domain information

>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases	Back alignment and domain information

>cd01873 RhoBTB RhoBTB subfamily	Back alignment and domain information

>cd04111 Rab39 Rab39 subfamily	Back alignment and domain information

>cd04126 Rab20 Rab20 subfamily	Back alignment and domain information

>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>cd04149 Arf6 Arf6 subfamily	Back alignment and domain information

>KOG0092\|consensus	Back alignment and domain information

>cd04113 Rab4 Rab4 subfamily	Back alignment and domain information

>cd01868 Rab11_like Rab11-like	Back alignment and domain information

>cd04106 Rab23_lke Rab23-like subfamily	Back alignment and domain information

>cd04143 Rhes_like Rhes_like subfamily	Back alignment and domain information

>cd04135 Tc10 TC10 subfamily	Back alignment and domain information

>cd04116 Rab9 Rab9 subfamily	Back alignment and domain information

>KOG0393\|consensus	Back alignment and domain information

>cd04142 RRP22 RRP22 subfamily	Back alignment and domain information

>KOG0088\|consensus	Back alignment and domain information

>cd04112 Rab26 Rab26 subfamily	Back alignment and domain information

>PLN00223 ADP-ribosylation factor; Provisional	Back alignment and domain information

>cd01866 Rab2 Rab2 subfamily	Back alignment and domain information

>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor	Back alignment and domain information

>cd04177 RSR1 RSR1 subgroup	Back alignment and domain information

>cd04150 Arf1_5_like Arf1-Arf5-like subfamily	Back alignment and domain information

>cd04125 RabA_like RabA-like subfamily	Back alignment and domain information

>KOG0087\|consensus	Back alignment and domain information

>cd04130 Wrch_1 Wrch-1 subfamily	Back alignment and domain information

>cd01870 RhoA_like RhoA-like subfamily	Back alignment and domain information

>COG1160 Predicted GTPases [General function prediction only]	Back alignment and domain information

>cd04101 RabL4 RabL4 (Rab-like4) subfamily	Back alignment and domain information

>PLN03110 Rab GTPase; Provisional	Back alignment and domain information

>cd04148 RGK RGK subfamily	Back alignment and domain information

>cd01892 Miro2 Miro2 subfamily	Back alignment and domain information

>PTZ00133 ADP-ribosylation factor; Provisional	Back alignment and domain information

>cd01861 Rab6 Rab6 subfamily	Back alignment and domain information

>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily	Back alignment and domain information

>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily	Back alignment and domain information

>PLN03118 Rab family protein; Provisional	Back alignment and domain information

>KOG0080\|consensus	Back alignment and domain information

>cd04118 Rab24 Rab24 subfamily	Back alignment and domain information

>cd01860 Rab5_related Rab5-related subfamily	Back alignment and domain information

>cd04158 ARD1 ARD1 subfamily	Back alignment and domain information

>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily	Back alignment and domain information

>PLN03108 Rab family protein; Provisional	Back alignment and domain information

>KOG0394\|consensus	Back alignment and domain information

>cd01863 Rab18 Rab18 subfamily	Back alignment and domain information

>smart00175 RAB Rab subfamily of small GTPases	Back alignment and domain information

>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily	Back alignment and domain information

>KOG0086\|consensus	Back alignment and domain information

>cd04123 Rab21 Rab21 subfamily	Back alignment and domain information

>PTZ00132 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>cd04154 Arl2 Arl2 subfamily	Back alignment and domain information

>cd04139 RalA_RalB RalA/RalB subfamily	Back alignment and domain information

>cd04114 Rab30 Rab30 subfamily	Back alignment and domain information

>cd01862 Rab7 Rab7 subfamily	Back alignment and domain information

>cd00157 Rho Rho (Ras homology) family	Back alignment and domain information

>cd04129 Rho2 Rho2 subfamily	Back alignment and domain information

>PF08355 EF_assoc_1: EF hand associated; InterPro: IPR013566 This region typically appears on the C terminus of EF hands in GTP-binding proteins such as Arht/Rhot (may be involved in mitochondrial homeostasis and apoptosis[])	Back alignment and domain information

>KOG0395\|consensus	Back alignment and domain information

>KOG0097\|consensus	Back alignment and domain information

>cd04157 Arl6 Arl6 subfamily	Back alignment and domain information

>cd04147 Ras_dva Ras-dva subfamily	Back alignment and domain information

>KOG0079\|consensus	Back alignment and domain information

>cd04151 Arl1 Arl1 subfamily	Back alignment and domain information

>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily	Back alignment and domain information

>KOG0091\|consensus	Back alignment and domain information

>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily	Back alignment and domain information

>cd04156 ARLTS1 ARLTS1 subfamily	Back alignment and domain information

>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily	Back alignment and domain information

>cd01892 Miro2 Miro2 subfamily	Back alignment and domain information

>cd00876 Ras Ras family	Back alignment and domain information

>cd04133 Rop_like Rop subfamily	Back alignment and domain information

>cd04121 Rab40 Rab40 subfamily	Back alignment and domain information

>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily	Back alignment and domain information

>KOG0093\|consensus	Back alignment and domain information

>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases	Back alignment and domain information

>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases	Back alignment and domain information

>cd04102 RabL3 RabL3 (Rab-like3) subfamily	Back alignment and domain information

>cd00879 Sar1 Sar1 subfamily	Back alignment and domain information

>cd00154 Rab Rab family	Back alignment and domain information

>cd04160 Arfrp1 Arfrp1 subfamily	Back alignment and domain information

>cd04131 Rnd Rnd subfamily	Back alignment and domain information

>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily	Back alignment and domain information

>cd01875 RhoG RhoG subfamily	Back alignment and domain information

>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only]	Back alignment and domain information

>KOG0081\|consensus	Back alignment and domain information

>cd04159 Arl10_like Arl10-like subfamily	Back alignment and domain information

>cd04120 Rab12 Rab12 subfamily	Back alignment and domain information

>KOG0083\|consensus	Back alignment and domain information

>KOG0097\|consensus	Back alignment and domain information

>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily	Back alignment and domain information

>cd04155 Arl3 Arl3 subfamily	Back alignment and domain information

>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed	Back alignment and domain information

>COG0486 ThdF Predicted GTPase [General function prediction only]	Back alignment and domain information

>KOG0095\|consensus	Back alignment and domain information

>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans	Back alignment and domain information

>KOG0027\|consensus	Back alignment and domain information

>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE	Back alignment and domain information

>cd01890 LepA LepA subfamily	Back alignment and domain information

>PLN00023 GTP-binding protein; Provisional	Back alignment and domain information

>cd01874 Cdc42 Cdc42 subfamily	Back alignment and domain information

>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>KOG0081\|consensus	Back alignment and domain information

>KOG0088\|consensus	Back alignment and domain information

>KOG4252\|consensus	Back alignment and domain information

>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily	Back alignment and domain information

>cd01898 Obg Obg subfamily	Back alignment and domain information

>cd04122 Rab14 Rab14 subfamily	Back alignment and domain information

>cd04117 Rab15 Rab15 subfamily	Back alignment and domain information

>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]	Back alignment and domain information

>cd01878 HflX HflX subfamily	Back alignment and domain information

>KOG0395\|consensus	Back alignment and domain information

>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily	Back alignment and domain information

>cd04171 SelB SelB subfamily	Back alignment and domain information

>cd04134 Rho3 Rho3 subfamily	Back alignment and domain information

>TIGR00231 small_GTP small GTP-binding protein domain	Back alignment and domain information

>cd04136 Rap_like Rap-like subfamily	Back alignment and domain information

>TIGR03156 GTP_HflX GTP-binding protein HflX	Back alignment and domain information

>TIGR00436 era GTP-binding protein Era	Back alignment and domain information

>cd01871 Rac1_like Rac1-like subfamily	Back alignment and domain information

>cd04128 Spg1 Spg1p	Back alignment and domain information

>cd04127 Rab27A Rab27a subfamily	Back alignment and domain information

>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases	Back alignment and domain information

>cd04175 Rap1 Rap1 subgroup	Back alignment and domain information

>PRK15494 era GTPase Era; Provisional	Back alignment and domain information

>cd04126 Rab20 Rab20 subfamily	Back alignment and domain information

>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>KOG0393\|consensus	Back alignment and domain information

>TIGR02528 EutP ethanolamine utilization protein, EutP	Back alignment and domain information

>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily	Back alignment and domain information

>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases	Back alignment and domain information

>KOG0073\|consensus	Back alignment and domain information

>cd04176 Rap2 Rap2 subgroup	Back alignment and domain information

>cd04140 ARHI_like ARHI subfamily	Back alignment and domain information

>PTZ00369 Ras-like protein; Provisional	Back alignment and domain information

>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2	Back alignment and domain information

>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily	Back alignment and domain information

>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily	Back alignment and domain information

>cd01865 Rab3 Rab3 subfamily	Back alignment and domain information

>cd04111 Rab39 Rab39 subfamily	Back alignment and domain information

>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily	Back alignment and domain information

>cd04110 Rab35 Rab35 subfamily	Back alignment and domain information

>cd01873 RhoBTB RhoBTB subfamily	Back alignment and domain information

>cd04109 Rab28 Rab28 subfamily	Back alignment and domain information

>PLN03071 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>PRK12299 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd04144 Ras2 Ras2 subfamily	Back alignment and domain information

>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes	Back alignment and domain information

>cd04116 Rab9 Rab9 subfamily	Back alignment and domain information

>smart00173 RAS Ras subfamily of RAS small GTPases	Back alignment and domain information

>KOG0075\|consensus	Back alignment and domain information

>cd01894 EngA1 EngA1 subfamily	Back alignment and domain information

>cd04135 Tc10 TC10 subfamily	Back alignment and domain information

>PRK03003 GTP-binding protein Der; Reviewed	Back alignment and domain information

>PLN03108 Rab family protein; Provisional	Back alignment and domain information

>cd01864 Rab19 Rab19 subfamily	Back alignment and domain information

>PRK04213 GTP-binding protein; Provisional	Back alignment and domain information

>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily	Back alignment and domain information

>PRK11058 GTPase HflX; Provisional	Back alignment and domain information

>cd01868 Rab11_like Rab11-like	Back alignment and domain information

>PTZ00099 rab6; Provisional	Back alignment and domain information

>cd04103 Centaurin_gamma Centaurin gamma	Back alignment and domain information

>cd04106 Rab23_lke Rab23-like subfamily	Back alignment and domain information

>cd04119 RJL RJL (RabJ-Like) subfamily	Back alignment and domain information

>PLN03110 Rab GTPase; Provisional	Back alignment and domain information

>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1	Back alignment and domain information

>cd04125 RabA_like RabA-like subfamily	Back alignment and domain information

>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta)	Back alignment and domain information

>cd01866 Rab2 Rab2 subfamily	Back alignment and domain information

>KOG0070\|consensus	Back alignment and domain information

>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily	Back alignment and domain information

>cd04130 Wrch_1 Wrch-1 subfamily	Back alignment and domain information

>cd01895 EngA2 EngA2 subfamily	Back alignment and domain information

>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily	Back alignment and domain information

>cd04143 Rhes_like Rhes_like subfamily	Back alignment and domain information

>TIGR02729 Obg_CgtA Obg family GTPase CgtA	Back alignment and domain information

>cd04132 Rho4_like Rho4-like subfamily	Back alignment and domain information

>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases	Back alignment and domain information

>KOG3883\|consensus	Back alignment and domain information

>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily	Back alignment and domain information

>cd04142 RRP22 RRP22 subfamily	Back alignment and domain information

>cd00881 GTP_translation_factor GTP translation factor family	Back alignment and domain information

>cd04177 RSR1 RSR1 subgroup	Back alignment and domain information

>KOG0096\|consensus	Back alignment and domain information

>cd04112 Rab26 Rab26 subfamily	Back alignment and domain information

>cd01889 SelB_euk SelB subfamily	Back alignment and domain information

>cd04113 Rab4 Rab4 subfamily	Back alignment and domain information

>PRK15467 ethanolamine utilization protein EutP; Provisional	Back alignment and domain information

>KOG0028\|consensus	Back alignment and domain information

>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases	Back alignment and domain information

>cd01870 RhoA_like RhoA-like subfamily	Back alignment and domain information

>KOG0083\|consensus	Back alignment and domain information

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA	Back alignment and domain information

>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions	Back alignment and domain information

>cd00882 Ras_like_GTPase Ras-like GTPase superfamily	Back alignment and domain information

>COG1159 Era GTPase [General function prediction only]	Back alignment and domain information

>cd04124 RabL2 RabL2 subfamily	Back alignment and domain information

>cd04163 Era Era subfamily	Back alignment and domain information

>PRK00089 era GTPase Era; Reviewed	Back alignment and domain information

>cd04129 Rho2 Rho2 subfamily	Back alignment and domain information

>cd04101 RabL4 RabL4 (Rab-like4) subfamily	Back alignment and domain information

>TIGR01393 lepA GTP-binding protein LepA	Back alignment and domain information

>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily	Back alignment and domain information

>cd04148 RGK RGK subfamily	Back alignment and domain information

>cd04118 Rab24 Rab24 subfamily	Back alignment and domain information

>PRK12297 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>PLN03118 Rab family protein; Provisional	Back alignment and domain information

>cd04168 TetM_like Tet(M)-like subfamily	Back alignment and domain information

>cd01860 Rab5_related Rab5-related subfamily	Back alignment and domain information

>PRK12296 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>KOG0071\|consensus	Back alignment and domain information

>KOG1191\|consensus	Back alignment and domain information

>TIGR00487 IF-2 translation initiation factor IF-2	Back alignment and domain information

>PRK12298 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd01861 Rab6 Rab6 subfamily	Back alignment and domain information

>cd01862 Rab7 Rab7 subfamily	Back alignment and domain information

>PRK00093 GTP-binding protein Der; Reviewed	Back alignment and domain information

>PRK05306 infB translation initiation factor IF-2; Validated	Back alignment and domain information

>cd04139 RalA_RalB RalA/RalB subfamily	Back alignment and domain information

>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins	Back alignment and domain information

>smart00175 RAB Rab subfamily of small GTPases	Back alignment and domain information

>cd04102 RabL3 RabL3 (Rab-like3) subfamily	Back alignment and domain information

>PRK00454 engB GTP-binding protein YsxC; Reviewed	Back alignment and domain information

>cd04123 Rab21 Rab21 subfamily	Back alignment and domain information

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2)	Back alignment and domain information

>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB	Back alignment and domain information

>KOG4252\|consensus	Back alignment and domain information

>CHL00189 infB translation initiation factor 2; Provisional	Back alignment and domain information

>PLN00223 ADP-ribosylation factor; Provisional	Back alignment and domain information

>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily	Back alignment and domain information

>cd01863 Rab18 Rab18 subfamily	Back alignment and domain information

>PLN00023 GTP-binding protein; Provisional	Back alignment and domain information

>cd04114 Rab30 Rab30 subfamily	Back alignment and domain information

>cd04147 Ras_dva Ras-dva subfamily	Back alignment and domain information

>COG1160 Predicted GTPases [General function prediction only]	Back alignment and domain information

>KOG0031\|consensus	Back alignment and domain information

>TIGR00475 selB selenocysteine-specific elongation factor SelB	Back alignment and domain information

>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor	Back alignment and domain information

>cd04149 Arf6 Arf6 subfamily	Back alignment and domain information

>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily	Back alignment and domain information

>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site	Back alignment and domain information

>KOG0074\|consensus	Back alignment and domain information

>PRK05433 GTP-binding protein LepA; Provisional	Back alignment and domain information

>KOG0076\|consensus	Back alignment and domain information

>cd00880 Era_like Era (E	Back alignment and domain information

>cd00157 Rho Rho (Ras homology) family	Back alignment and domain information

>PTZ00133 ADP-ribosylation factor; Provisional	Back alignment and domain information

>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2	Back alignment and domain information

>cd01893 Miro1 Miro1 subfamily	Back alignment and domain information

>cd04158 ARD1 ARD1 subfamily	Back alignment and domain information

>PTZ00183 centrin; Provisional	Back alignment and domain information

>cd00876 Ras Ras family	Back alignment and domain information

>PRK09554 feoB ferrous iron transport protein B; Reviewed	Back alignment and domain information

>TIGR02528 EutP ethanolamine utilization protein, EutP	Back alignment and domain information

>PTZ00132 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily	Back alignment and domain information

>TIGR00437 feoB ferrous iron transporter FeoB	Back alignment and domain information

>cd01886 EF-G Elongation factor G (EF-G) subfamily	Back alignment and domain information

>cd04167 Snu114p Snu114p subfamily	Back alignment and domain information

>KOG1423\|consensus	Back alignment and domain information

>PTZ00184 calmodulin; Provisional	Back alignment and domain information

>KOG0072\|consensus	Back alignment and domain information

>cd04150 Arf1_5_like Arf1-Arf5-like subfamily	Back alignment and domain information

>cd04166 CysN_ATPS CysN_ATPS subfamily	Back alignment and domain information

>KOG4423\|consensus	Back alignment and domain information

>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways	Back alignment and domain information

>COG2229 Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd04154 Arl2 Arl2 subfamily	Back alignment and domain information

>cd04157 Arl6 Arl6 subfamily	Back alignment and domain information

>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha	Back alignment and domain information

>PRK10218 GTP-binding protein; Provisional	Back alignment and domain information

>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma	Back alignment and domain information

>KOG4423\|consensus	Back alignment and domain information

>cd01884 EF_Tu EF-Tu subfamily	Back alignment and domain information

>PRK04000 translation initiation factor IF-2 subunit gamma; Validated	Back alignment and domain information

>PRK12317 elongation factor 1-alpha; Reviewed	Back alignment and domain information

>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily	Back alignment and domain information

>cd01876 YihA_EngB The YihA (EngB) subfamily	Back alignment and domain information

>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily	Back alignment and domain information

>cd00154 Rab Rab family	Back alignment and domain information

>KOG0030\|consensus	Back alignment and domain information

>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily	Back alignment and domain information

>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>KOG1673\|consensus	Back alignment and domain information

>PRK04004 translation initiation factor IF-2; Validated	Back alignment and domain information

>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA	Back alignment and domain information

>KOG0037\|consensus	Back alignment and domain information

>cd04156 ARLTS1 ARLTS1 subfamily	Back alignment and domain information

>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional	Back alignment and domain information

>cd04151 Arl1 Arl1 subfamily	Back alignment and domain information

>cd04165 GTPBP1_like GTPBP1-like	Back alignment and domain information

>TIGR00484 EF-G translation elongation factor EF-G	Back alignment and domain information

>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily	Back alignment and domain information

>cd00879 Sar1 Sar1 subfamily	Back alignment and domain information

>cd04169 RF3 RF3 subfamily	Back alignment and domain information

>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases	Back alignment and domain information

>cd04104 p47_IIGP_like p47 (47-kDa) family	Back alignment and domain information

>cd01885 EF2 EF2 (for archaea and eukarya)	Back alignment and domain information

>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases	Back alignment and domain information

>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK12736 elongation factor Tu; Reviewed	Back alignment and domain information

>KOG1489\|consensus	Back alignment and domain information

>COG1084 Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd04159 Arl10_like Arl10-like subfamily	Back alignment and domain information

>cd01899 Ygr210 Ygr210 subfamily	Back alignment and domain information

>PRK12735 elongation factor Tu; Reviewed	Back alignment and domain information

>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]	Back alignment and domain information

>COG1163 DRG Predicted GTPase [General function prediction only]	Back alignment and domain information

>PRK13351 elongation factor G; Reviewed	Back alignment and domain information

>COG2262 HflX GTPases [General function prediction only]	Back alignment and domain information

>COG3596 Predicted GTPase [General function prediction only]	Back alignment and domain information

>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse	Back alignment and domain information

>KOG0077\|consensus	Back alignment and domain information

>TIGR00485 EF-Tu translation elongation factor TU	Back alignment and domain information

>PRK00007 elongation factor G; Reviewed	Back alignment and domain information

>cd01890 LepA LepA subfamily	Back alignment and domain information

>CHL00071 tufA elongation factor Tu	Back alignment and domain information

>cd04155 Arl3 Arl3 subfamily	Back alignment and domain information

>PRK04213 GTP-binding protein; Provisional	Back alignment and domain information

>cd04160 Arfrp1 Arfrp1 subfamily	Back alignment and domain information

>COG0218 Predicted GTPase [General function prediction only]	Back alignment and domain information

>KOG0090\|consensus	Back alignment and domain information

>TIGR02034 CysN sulfate adenylyltransferase, large subunit	Back alignment and domain information

>PLN03126 Elongation factor Tu; Provisional	Back alignment and domain information

>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional	Back alignment and domain information

>KOG1673\|consensus	Back alignment and domain information

>TIGR00231 small_GTP small GTP-binding protein domain	Back alignment and domain information

>PLN03127 Elongation factor Tu; Provisional	Back alignment and domain information

>PRK00049 elongation factor Tu; Reviewed	Back alignment and domain information

>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans	Back alignment and domain information

>KOG0034\|consensus	Back alignment and domain information

>PRK00741 prfC peptide chain release factor 3; Provisional	Back alignment and domain information

>cd01878 HflX HflX subfamily	Back alignment and domain information

>KOG0096\|consensus	Back alignment and domain information

>TIGR00503 prfC peptide chain release factor 3	Back alignment and domain information

>KOG0462\|consensus	Back alignment and domain information

>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily	Back alignment and domain information

>PLN00043 elongation factor 1-alpha; Provisional	Back alignment and domain information

>PRK12739 elongation factor G; Reviewed	Back alignment and domain information

>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional	Back alignment and domain information

>smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily	Back alignment and domain information

>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional	Back alignment and domain information

>KOG1145\|consensus	Back alignment and domain information

>PTZ00141 elongation factor 1- alpha; Provisional	Back alignment and domain information

>cd04171 SelB SelB subfamily	Back alignment and domain information

>PRK00454 engB GTP-binding protein YsxC; Reviewed	Back alignment and domain information

>PRK15467 ethanolamine utilization protein EutP; Provisional	Back alignment and domain information

>PRK09602 translation-associated GTPase; Reviewed	Back alignment and domain information

>PRK09866 hypothetical protein; Provisional	Back alignment and domain information

>PTZ00099 rab6; Provisional	Back alignment and domain information

>COG0536 Obg Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1)	Back alignment and domain information

>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily	Back alignment and domain information

>KOG0036\|consensus	Back alignment and domain information

>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases	Back alignment and domain information

>KOG0073\|consensus	Back alignment and domain information

>KOG3883\|consensus	Back alignment and domain information

>cd01898 Obg Obg subfamily	Back alignment and domain information

>cd01850 CDC_Septin CDC/Septin	Back alignment and domain information

>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1	Back alignment and domain information

>PRK12740 elongation factor G; Reviewed	Back alignment and domain information

>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily	Back alignment and domain information

>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE	Back alignment and domain information

>TIGR03156 GTP_HflX GTP-binding protein HflX	Back alignment and domain information

>TIGR00490 aEF-2 translation elongation factor aEF-2	Back alignment and domain information

>PRK15494 era GTPase Era; Provisional	Back alignment and domain information

>cd01894 EngA1 EngA1 subfamily	Back alignment and domain information

>KOG0044\|consensus	Back alignment and domain information

>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts)	Back alignment and domain information

>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed	Back alignment and domain information

>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase)	Back alignment and domain information

>TIGR00437 feoB ferrous iron transporter FeoB	Back alignment and domain information

>KOG0070\|consensus	Back alignment and domain information

>TIGR00436 era GTP-binding protein Era	Back alignment and domain information

>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd00881 GTP_translation_factor GTP translation factor family	Back alignment and domain information

>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism]	Back alignment and domain information

>KOG1532\|consensus	Back alignment and domain information

>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways	Back alignment and domain information

>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13	Back alignment and domain information

>PRK12299 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd01895 EngA2 EngA2 subfamily	Back alignment and domain information

>cd04163 Era Era subfamily	Back alignment and domain information

>cd00882 Ras_like_GTPase Ras-like GTPase superfamily	Back alignment and domain information

>cd01882 BMS1 Bms1	Back alignment and domain information

>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions	Back alignment and domain information

>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes	Back alignment and domain information

>KOG0075\|consensus	Back alignment and domain information

>PRK09435 membrane ATPase/protein kinase; Provisional	Back alignment and domain information

>PRK00089 era GTPase Era; Reviewed	Back alignment and domain information

>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PLN00116 translation elongation factor EF-2 subunit; Provisional	Back alignment and domain information

>KOG1490\|consensus	Back alignment and domain information

>PRK14845 translation initiation factor IF-2; Provisional	Back alignment and domain information

>cd01876 YihA_EngB The YihA (EngB) subfamily	Back alignment and domain information

>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB	Back alignment and domain information

>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR02729 Obg_CgtA Obg family GTPase CgtA	Back alignment and domain information

>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1	Back alignment and domain information

>PRK13768 GTPase; Provisional	Back alignment and domain information

>COG0218 Predicted GTPase [General function prediction only]	Back alignment and domain information

>PTZ00416 elongation factor 2; Provisional	Back alignment and domain information

>PRK11058 GTPase HflX; Provisional	Back alignment and domain information

>TIGR01393 lepA GTP-binding protein LepA	Back alignment and domain information

>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms]	Back alignment and domain information

>TIGR00487 IF-2 translation initiation factor IF-2	Back alignment and domain information

>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity	Back alignment and domain information

>TIGR00101 ureG urease accessory protein UreG	Back alignment and domain information

>KOG4223\|consensus	Back alignment and domain information

>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B	Back alignment and domain information

>smart00027 EH Eps15 homology domain	Back alignment and domain information

>TIGR00750 lao LAO/AO transport system ATPase	Back alignment and domain information

>PRK07560 elongation factor EF-2; Reviewed	Back alignment and domain information

>cd01889 SelB_euk SelB subfamily	Back alignment and domain information

>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E	Back alignment and domain information

>KOG0461\|consensus	Back alignment and domain information

>PLN02964 phosphatidylserine decarboxylase	Back alignment and domain information

>COG0486 ThdF Predicted GTPase [General function prediction only]	Back alignment and domain information

>smart00053 DYNc Dynamin, GTPase	Back alignment and domain information

>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK09554 feoB ferrous iron transport protein B; Reviewed	Back alignment and domain information

>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another	Back alignment and domain information

>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins	Back alignment and domain information

>CHL00189 infB translation initiation factor 2; Provisional	Back alignment and domain information

>TIGR00157 ribosome small subunit-dependent GTPase A	Back alignment and domain information

>PRK12296 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction	Back alignment and domain information

>PRK05306 infB translation initiation factor IF-2; Validated	Back alignment and domain information

>PRK12297 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>KOG1707\|consensus	Back alignment and domain information

>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z	Back alignment and domain information

>TIGR00475 selB selenocysteine-specific elongation factor SelB	Back alignment and domain information

>KOG1144\|consensus	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		608
2j0v_A		212	The Crystal Structure Of Arabidopsis Thaliana Rac7-		4e-08
2nty_C		180	Rop4-Gdp-Prone8 Length = 180		1e-07
3bwd_D		182	Crystal Structure Of The Plant Rho Protein Rop5 Len		3e-07
2wbl_C		180	Three-Dimensional Structure Of A Binary Rop-Prone C		3e-06
2nzj_A		175	The Crystal Structure Of Rem1 In Complex With Gdp L		8e-06
2j1l_A		214	Crystal Structure Of Human Rho-Related Gtp-Binding		1e-05
3cph_A		213	Crystal Structure Of Sec4 In Complex With Rab-Gdi L		2e-05
4gzl_A		204	Crystal Structure Of Rac1 Q61l Mutant Length = 204		3e-05
2efc_B		181	Ara7-GdpATVPS9A Length = 181		3e-05
3ryt_C		180	The Plexin A1 Intracellular Region In Complex With		3e-05
3th5_A		204	Crystal Structure Of Wild-Type Rac1 Length = 204		3e-05
1i4t_D		192	Crystal Structure Analysis Of Rac1-Gmppnp In Comple		3e-05
1i4d_D		192	Crystal Structure Analysis Of Rac1-Gdp Complexed Wi		3e-05
2h7v_A		188	Co-crystal Structure Of Ypka-rac1 Length = 188		3e-05
1e96_A		192	Structure Of The RacP67PHOX COMPLEX Length = 192		4e-05
2q3h_A		201	The Crystal Structure Of Rhoua In The Gdp-bound Sta		4e-05
2vrw_A		184	Critical Structural Role For The Ph And C1 Domains		4e-05
3sua_A		184	Crystal Structure Of The Intracellular Domain Of Pl		4e-05
1he1_C		176	Crystal Structure Of The Complex Between The Gap Do		4e-05
2fju_A		178	Activated Rac1 Bound To Its Effector Phospholipase		4e-05
1foe_B		177	Crystal Structure Of Rac1 In Complex With The Guani		4e-05
2yin_C		196	Structure Of The Complex Between Dock2 And Rac1. Le		5e-05
1ds6_A		192	Crystal Structure Of A Rac-Rhogdi Complex Length =		5e-05
3brw_D		167	Structure Of The Rap-Rapgap Complex Length = 167		5e-05
1aje_A		194	Cdc42 From Human, Nmr, 20 Structures Length = 194		5e-05
1z06_A		189	Gppnhp-Bound Rab33 Gtpase Length = 189		5e-05
4dxa_A		169	Co-Crystal Structure Of Rap1 In Complex With Krit1		5e-05
3tkl_A		196	Crystal Structure Of The Gtp-Bound Rab1a In Complex		6e-05
1hh4_A		192	Rac1-Rhogdi Complex Involved In Nadph Oxidase Activ		6e-05
1g17_A		170	Crystal Structure Of Sec4-Guanosine-5'-(Beta,Gamma)		6e-05
2atx_A		194	Crystal Structure Of The Tc10 Gppnhp Complex Length		6e-05
1mh1_A		186	Small G-Protein Length = 186		7e-05
2w2t_A		185	Rac2 (G12v) In Complex With Gdp Length = 185		7e-05
1g4u_R		184	Crystal Structure Of The Salmonella Tyrosine Phosph		7e-05
1nf3_A		195	Structure Of Cdc42 In A Complex With The Gtpase-Bin		7e-05
2p5s_A		199	Rab Domain Of Human Rasef In Complex With Gdp Lengt		8e-05
1ky2_A		182	Gppnhp-Bound Ypt7p At 1.6 A Resolution Length = 182		8e-05
1cf4_A		184	Cdc42ACK GTPASE-Binding Domain Complex Length = 184		8e-05
2w2v_A		184	Rac2 (G12v) In Complex With Gtpgs Length = 184		8e-05
1an0_A		190	Cdc42hs-Gdp Complex Length = 190		8e-05
2eqb_A		174	Crystal Structure Of The Rab Gtpase Sec4p, The Sec2		8e-05
2wkp_A		332	Structure Of A Photoactivatable Rac1 Containing Lov		1e-04
2wkr_A		332	Structure Of A Photoactivatable Rac1 Containing The		1e-04
1x86_B		196	Crystal Structure Of The DhPH DOMAINS OF LEUKEMIA-A		1e-04
1lb1_B		192	Crystal Structure Of The Dbl And Pleckstrin Homolog		1e-04
2kb0_A		178	Cdc42(T35a) Length = 178		1e-04
3b13_B		184	Crystal Structure Of The Dhr-2 Domain Of Dock2 In C		1e-04
2wkq_A		332	Structure Of A Photoactivatable Rac1 Containing The		1e-04
1am4_D		177	Complex Between Cdc42hs.Gmppnp And P50 Rhogap (H. S		1e-04
1ees_A		178	Solution Structure Of Cdc42hs Complexed With A Pept		1e-04
3tvd_A		193	Crystal Structure Of Mouse Rhoa-Gtp Complex Length		1e-04
1gzs_A		180	Crystal Structure Of The Complex Between The Gef Do		1e-04
4f38_A		195	Crystal Structure Of Geranylgeranylated Rhoa In Com		1e-04
3eg5_A		178	Crystal Structure Of Mdia1-Tsh Gbd-Fh3 In Complex W		1e-04
1cee_A		179	Solution Structure Of Cdc42 In Complex With The Gtp		1e-04
3ref_B		194	Crystal Structure Of Ehrho1 Bound To Gdp And Magnes		1e-04
3gcg_A		182	Crystal Structure Of Map And Cdc42 Complex Length =		1e-04
2wm9_B		190	Structure Of The Complex Between Dock9 And Cdc42. L		1e-04
2dfk_B		194	Crystal Structure Of The Cdc42-Collybistin Ii Compl		1e-04
1gua_A		167	Human Rap1a, Residues 1-167, Double Mutant (E30d,K3		1e-04
4dvg_A		188	Crystal Structure Of E. Histolytica Formin1 Bound T		1e-04
2g77_B		198	Crystal Structure Of Gyp1 Tbc Domain In Complex Wit		1e-04
1doa_A		191	Structure Of The Rho Family Gtp-Binding Protein Cdc		1e-04
2odb_A		192	The Crystal Structure Of Human Cdc42 In Complex Wit		1e-04
1grn_A		191	Crystal Structure Of The Cdc42CDC42GAPALF3 COMPLEX.		1e-04
3lw8_A		185	Shigella Ipgb2 In Complex With Human Rhoa, Gdp And		1e-04
2qrz_A		189	Cdc42 Bound To Gmp-Pcp: Induced Fit By Effector Is		1e-04
4did_A		193	Crystal Structure Of Salmonella Effector N-Terminal		1e-04
3kz1_E		182	Crystal Structure Of The Complex Of Pdz-Rhogef DhPH		1e-04
1c1y_A		167	Crystal Structure Of Rap.Gmppnp In Complex With The		2e-04
2ic5_A		180	Crystal Structure Of Human Rac3 Grown In The Presen		2e-04
2c2h_A		192	Crystal Structure Of The Human Rac3 In Complex With		2e-04
2g0n_A		179	The Crystal Structure Of The Human Rac3 In Complex		2e-04
1s1c_A		183	Crystal Structure Of The Complex Between The Human		2e-04
1kz7_B		188	Crystal Structure Of The DhPH FRAGMENT OF MURINE DB		2e-04
1g16_A		170	Crystal Structure Of Sec4-Gdp Length = 170		2e-04
4gzm_A		204	Crystal Structure Of Rac1 F28l Mutant Length = 204		2e-04
2fv8_A		207	The Crystal Structure Of Rhob In The Gdp-Bound Stat		2e-04
1s8f_A		177	Crystal Structure Of Rab9 Complexed To Gdp Reveals		2e-04
1kmq_A		184	Crystal Structure Of A Constitutively Activated Rho		2e-04
1wms_A		177	High Resolution Crystal Structure Of Human Rab9 Gtp		2e-04
1a4r_B		191	G12v Mutant Of Human Placental Cdc42 Gtpase In The		2e-04
3mjh_A		168	Crystal Structure Of Human Rab5a In Complex With Th		2e-04
2kwi_A		178	Ralb-Rlip76 (Ralbp1) Complex Length = 178		2e-04
1n6n_A		170	Crystal Structure Of Human Rab5a A30r Mutant Comple		2e-04
3qbv_A		178	Structure Of Designed Orthogonal Interaction Betwee		3e-04
2ocy_C		170	Complex Of The Guanine Exchange Factor Sec2p And Th		3e-04
1cxz_A		182	Crystal Structure Of Human Rhoa Complexed With The		3e-04
1n6p_A		170	Crystal Structure Of Human Rab5a A30e Mutant Comple		3e-04
2ke5_A		174	Solution Structure And Dynamics Of The Small Gtpase		3e-04
1ryf_A		203	Alternative Splicing Of Rac1 Generates Rac1b, A Sel		3e-04
1n6o_A		170	Crystal Structure Of Human Rab5a A30k Mutant Comple		3e-04
1cc0_A		190	Crystal Structure Of The Rhoa.Gdp-Rhogdi Complex Le		3e-04
2fol_A		191	Crystal Structure Of Human Rab1a In Complex With Gd		3e-04
3sbd_A		187	Crystal Structure Of Rac1 P29s Mutant Length = 187		3e-04
1tu3_A		171	Crystal Structure Of Rab5 Complex With Rabaptin5 C-		3e-04
1ow3_B		193	Crystal Structure Of Rhoa.Gdp.Mgf3-In Complex With		4e-04
4fmc_B		171	Espg-Rab1 Complex Length = 171		4e-04
1n6h_A		170	Crystal Structure Of Human Rab5a Length = 170		4e-04
4fmd_F		164	Espg-Rab1 Complex Structure At 3.05 A Length = 164		4e-04
2bov_A		206	Molecular Recognition Of An Adp-Ribosylating Clostr		4e-04
4fmb_B		171	Vira-Rab1 Complex Structure Length = 171		4e-04
3vhl_B		195	Crystal Structure Of The Dhr-2 Domain Of Dock8 In C		5e-04
2gcn_A		201	Crystal Structure Of The Human Rhoc-Gdp Complex Len		5e-04
1xcg_B		178	Crystal Structure Of Human Rhoa In Complex With DhP		5e-04
3sfv_A		181	Crystal Structure Of The Gdp-Bound Rab1a S25n Mutan		5e-04
3msx_A		180	Crystal Structure Of Rhoa.Gdp.Mgf3 In Complex With		5e-04
2gco_A		201	Crystal Structure Of The Human Rhoc-gppnhp Complex		5e-04
1z0f_A		179	Gdp-Bound Rab14 Gtpase Length = 179		5e-04
1tx4_B		177	RhoRHOGAPGDP(DOT)ALF4 COMPLEX Length = 177		7e-04
1n6r_A		170	Crystal Structure Of Human Rab5a A30l Mutant Comple		7e-04
1n6i_A		170	Crystal Structure Of Human Rab5a A30p Mutant Comple		7e-04
4drz_A		196	Crystal Structure Of Human Rab14 Length = 196		7e-04
1yzl_A		179	Gppnhp-Bound Rab9 Gtpase Length = 179		7e-04
1dpf_A		180	Crystal Structure Of A Mg-Free Form Of Rhoa Complex		7e-04
2ase_A		178	Nmr Structure Of The F28l Mutant Of Cdc42hs Length		8e-04
1z2c_A		193	Crystal Structure Of Mdia1 Gbd-Fh3 In Complex With		8e-04

>pdb|2J0V|A Chain A, The Crystal Structure Of Arabidopsis Thaliana Rac7-Rop9: The First Ras Superfamily Gtpase From The Plant Kingdom Length = 212