Psyllid ID: psy3302

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MDALNVPYTICEVLVALGAVIGNSLVIVAFGREKRLRRRTNYYIVSLAVADLLVGLVGIPCALLASVGLPRHLYACLFTISLLVVLCTISIFCLVAVSVDRYWAILFPMGYARNVTTKIAVCK
ccccHHHHHHHHHHHHHHHHHHcEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHEHHHEEEEcccccccccccccEEEEc
MDALNVPYTICEVLVALGAVIGNSLVIVAFGREKRLRRRTNYYIVSLAVADLLVGLVGIPCallasvglprhLYACLFTISLLVVLCTISIFCLVAVSVDRYWAILfpmgyarnvtTKIAVCK
MDALNVPYTICEVLVALGAVIGNSLVIVafgrekrlrrrTNYYIVSLAVADLLVGLVGIPCALLASVGLPRHLYACLFTISLLVVLCTISIFCLVAVSVDRYWAILFpmgyarnvtTKIAVCK
MDALNVPYTICEVLVALGAVIGNSLVIVAFGREKRLRRRTNYYIvslavadllvglvgIPCALLASVGLPRHLYACLFTISLLVVLCTISIFCLVAVSVDRYWAILFPMGYARNVTTKIAVCK
***LNVPYTICEVLVALGAVIGNSLVIVAFGREKRLRRRTNYYIVSLAVADLLVGLVGIPCALLASVGLPRHLYACLFTISLLVVLCTISIFCLVAVSVDRYWAILFPMGYARNVTTKIAVC*
***LNVPYTICEVLVALGAVIGNSLVIVAFGREKRLRRRTNYYIVSLAVADLLVGLVGIPCALLASVGLPRHLYACLFTISLLVVLCTISIFCLVAVSVDRYWAILFPMGYARNVTTKIAVCK
MDALNVPYTICEVLVALGAVIGNSLVIVAFGREKRLRRRTNYYIVSLAVADLLVGLVGIPCALLASVGLPRHLYACLFTISLLVVLCTISIFCLVAVSVDRYWAILFPMGYARNVTTKIAVCK
MDALNVPYTICEVLVALGAVIGNSLVIVAFGREKRLRRRTNYYIVSLAVADLLVGLVGIPCALLASVGLPRHLYACLFTISLLVVLCTISIFCLVAVSVDRYWAILFPMGYARNVTTKIAVCK
oooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
oooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiii
oooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDALNVPYTICEVLVALGAVIGNSLVIVAFGREKRLRRRTNYYIVSLAVADLLVGLVGIPCALLASVGLPRHLYACLFTISLLVVLCTISIFCLVAVSVDRYWAILFPMGYARNVTTKIAVCK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query123 2.2.26 [Sep-21-2011]
O13076 340 Adenosine receptor A2b OS yes N/A 0.975 0.352 0.416 5e-18
Q32ZE2 332 Adenosine receptor A2b OS yes N/A 0.918 0.340 0.456 2e-16
P29275 332 Adenosine receptor A2b OS yes N/A 0.918 0.340 0.456 3e-16
P29276 332 Adenosine receptor A2b OS yes N/A 0.918 0.340 0.456 5e-16
Q60614 332 Adenosine receptor A2b OS yes N/A 0.918 0.340 0.456 6e-16
P33765 318 Adenosine receptor A3 OS= no N/A 0.926 0.358 0.394 9e-16
Q6W3F4 332 Adenosine receptor A2b OS yes N/A 0.918 0.340 0.448 9e-16
P28647 320 Adenosine receptor A3 OS= no N/A 0.926 0.356 0.426 3e-15
Q61618 319 Adenosine receptor A3 OS= no N/A 0.943 0.363 0.418 4e-15
P35342 317 Adenosine receptor A3 OS= N/A N/A 0.918 0.356 0.403 5e-15
>sp|O13076|AA2BR_CHICK Adenosine receptor A2b OS=Gallus gallus GN=ADORA2B PE=2 SV=1 Back     alignment and function desciption
 Score = 89.7 bits (221), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 50/120 (41%), Positives = 74/120 (61%)

Query: 1   MDALNVPYTICEVLVALGAVIGNSLVIVAFGREKRLRRRTNYYIVSLAVADLLVGLVGIP 60
           M+ +   Y + E+++A+ ++ GN LV  A      L+  TNY++VSLAVAD+ VGL+ IP
Sbjct: 1   MNTMKTTYIVLELIIAVLSIAGNVLVCWAVAINSTLKNATNYFLVSLAVADIAVGLLAIP 60

Query: 61  CALLASVGLPRHLYACLFTISLLVVLCTISIFCLVAVSVDRYWAILFPMGYARNVTTKIA 120
            A+  S+G     ++CLF    ++VL   SIF L+AV++DRY AI  P+ Y   VT K A
Sbjct: 61  FAITISIGFQVDFHSCLFFACFVLVLTQSSIFSLLAVAIDRYLAIKIPLRYNSLVTGKRA 120
Receptor for adenosine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Gallus gallus (taxid: 9031)
>sp|Q32ZE2|AA2BR_RABIT Adenosine receptor A2b OS=Oryctolagus cuniculus GN=ADORA2B PE=2 SV=1 Back     alignment and function description
>sp|P29275|AA2BR_HUMAN Adenosine receptor A2b OS=Homo sapiens GN=ADORA2B PE=2 SV=1 Back     alignment and function description
>sp|P29276|AA2BR_RAT Adenosine receptor A2b OS=Rattus norvegicus GN=Adora2b PE=1 SV=1 Back     alignment and function description
>sp|Q60614|AA2BR_MOUSE Adenosine receptor A2b OS=Mus musculus GN=Adora2b PE=2 SV=2 Back     alignment and function description
>sp|P33765|AA3R_HUMAN Adenosine receptor A3 OS=Homo sapiens GN=ADORA3 PE=2 SV=2 Back     alignment and function description
>sp|Q6W3F4|AA2BR_CANFA Adenosine receptor A2b OS=Canis familiaris GN=ADORA2B PE=2 SV=1 Back     alignment and function description
>sp|P28647|AA3R_RAT Adenosine receptor A3 OS=Rattus norvegicus GN=Adora3 PE=1 SV=3 Back     alignment and function description
>sp|Q61618|AA3R_MOUSE Adenosine receptor A3 OS=Mus musculus GN=Adora3 PE=2 SV=2 Back     alignment and function description
>sp|P35342|AA3R_SHEEP Adenosine receptor A3 OS=Ovis aries GN=ADORA3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query123
195037405 789 GH18390 [Drosophila grimshawi] gi|193894 0.959 0.149 0.737 1e-46
332030490 531 Adenosine receptor A2b [Acromyrmex echin 0.983 0.227 0.735 2e-46
307167345 519 Adenosine receptor A2b [Camponotus flori 0.959 0.227 0.745 8e-46
328779745 500 PREDICTED: adenosine receptor A2a [Apis 0.959 0.236 0.737 1e-45
380030226 501 PREDICTED: LOW QUALITY PROTEIN: adenosin 0.967 0.237 0.731 2e-45
383860650 506 PREDICTED: adenosine receptor A2b-like [ 0.967 0.235 0.731 1e-44
345493913 566 PREDICTED: adenosine receptor A2a-like [ 0.959 0.208 0.711 1e-44
307214390 528 Adenosine receptor A2b [Harpegnathos sal 0.959 0.223 0.737 3e-44
340711253 508 PREDICTED: adenosine receptor A2b-like [ 0.967 0.234 0.714 3e-44
350411766 508 PREDICTED: adenosine receptor A2b-like [ 0.967 0.234 0.714 4e-44
>gi|195037405|ref|XP_001990151.1| GH18390 [Drosophila grimshawi] gi|193894347|gb|EDV93213.1| GH18390 [Drosophila grimshawi] Back     alignment and taxonomy information
 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 87/118 (73%), Positives = 108/118 (91%)

Query: 4   LNVPYTICEVLVALGAVIGNSLVIVAFGREKRLRRRTNYYIVSLAVADLLVGLVGIPCAL 63
           LN+PYT+ EVLVA+ ++IGN +VI+ F RE++LRRRTNYYIVSLA+AD LVGL+G+P A+
Sbjct: 43  LNIPYTVFEVLVAIVSIIGNLMVIIVFQRERKLRRRTNYYIVSLAMADFLVGLLGVPFAV 102

Query: 64  LASVGLPRHLYACLFTISLLVVLCTISIFCLVAVSVDRYWAILFPMGYARNVTTKIAV 121
           LASVGLP++L+ACLFT+SLLVVLCTISIFCLVAVSVDRYWAIL+PM Y+RNV T+ A+
Sbjct: 103 LASVGLPKNLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAI 160

Source: Drosophila grimshawi

Species: Drosophila grimshawi

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332030490|gb|EGI70178.1| Adenosine receptor A2b [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307167345|gb|EFN60975.1| Adenosine receptor A2b [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328779745|ref|XP_394893.3| PREDICTED: adenosine receptor A2a [Apis mellifera] Back     alignment and taxonomy information
>gi|380030226|ref|XP_003698754.1| PREDICTED: LOW QUALITY PROTEIN: adenosine receptor A2b-like [Apis florea] Back     alignment and taxonomy information
>gi|383860650|ref|XP_003705802.1| PREDICTED: adenosine receptor A2b-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|345493913|ref|XP_001606786.2| PREDICTED: adenosine receptor A2a-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307214390|gb|EFN89461.1| Adenosine receptor A2b [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|340711253|ref|XP_003394193.1| PREDICTED: adenosine receptor A2b-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350411766|ref|XP_003489446.1| PREDICTED: adenosine receptor A2b-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query123
FB|FBgn0039747 774 AdoR "Adenosine receptor" [Dro 0.959 0.152 0.661 1.7e-37
ZFIN|ZDB-GENE-041014-79 377 si:dkey-206f10.5 "si:dkey-206f 0.983 0.320 0.409 7e-22
ZFIN|ZDB-GENE-080723-28 442 adora2aa "adenosine A2a recept 0.983 0.273 0.349 8.2e-14
ZFIN|ZDB-GENE-081105-156 341 adora1 "adenosine A1 receptor" 0.975 0.351 0.35 1.4e-13
UNIPROTKB|F1NMX2 340 ADORA2B "Adenosine receptor A2 0.975 0.352 0.333 1.8e-13
UNIPROTKB|O13076 340 ADORA2B "Adenosine receptor A2 0.975 0.352 0.333 1.8e-13
UNIPROTKB|P29275 332 ADORA2B "Adenosine receptor A2 0.910 0.337 0.382 2.7e-13
ZFIN|ZDB-GENE-060511-1 351 adora2b "adenosine A2b recepto 0.951 0.333 0.358 3.3e-13
RGD|2050 332 Adora2b "adenosine A2B recepto 0.910 0.337 0.382 4.6e-13
UNIPROTKB|P33765 318 ADORA3 "Adenosine receptor A3" 0.910 0.352 0.345 5.1e-13
FB|FBgn0039747 AdoR "Adenosine receptor" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 410 (149.4 bits), Expect = 1.7e-37, P = 1.7e-37
 Identities = 78/118 (66%), Positives = 95/118 (80%)

Query:     4 LNVPYTICEVLVALGAVIGNSLVIVAFGREKRLRRRTNYYIXXXXXXXXXXXXXXIPCAL 63
             LN+PYT+ EVLVA+ ++IGN LVI+ F RE++LRRRTNYYI              IP A+
Sbjct:    40 LNIPYTVFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAI 99

Query:    64 LASVGLPRHLYACLFTISLLVVLCTISIFCLVAVSVDRYWAILFPMGYARNVTTKIAV 121
             LAS+GLPR+L+ACLFT+SLLVVLCTISIFCLVAVSVDRYWAIL+PM Y+RNV T+ A+
Sbjct:   100 LASMGLPRNLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAI 157
GO:0016021 "integral to membrane" evidence=ISM;IEA;ISS
GO:0007186 "G-protein coupled receptor signaling pathway" evidence=ISS
GO:0001609 "G-protein coupled adenosine receptor activity" evidence=ISS;IDA
GO:0001973 "adenosine receptor signaling pathway" evidence=IDA
GO:0008306 "associative learning" evidence=IMP
GO:0007268 "synaptic transmission" evidence=IMP
GO:0090281 "negative regulation of calcium ion import" evidence=IMP
GO:0022008 "neurogenesis" evidence=IMP
ZFIN|ZDB-GENE-041014-79 si:dkey-206f10.5 "si:dkey-206f10.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080723-28 adora2aa "adenosine A2a receptor a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081105-156 adora1 "adenosine A1 receptor" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NMX2 ADORA2B "Adenosine receptor A2b" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|O13076 ADORA2B "Adenosine receptor A2b" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P29275 ADORA2B "Adenosine receptor A2b" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060511-1 adora2b "adenosine A2b receptor" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|2050 Adora2b "adenosine A2B receptor" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P33765 ADORA3 "Adenosine receptor A3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
pfam00001 251 pfam00001, 7tm_1, 7 transmembrane receptor (rhodop 2e-16
pfam10320 257 pfam10320, 7TM_GPCR_Srsx, Serpentine type 7TM GPCR 7e-07
>gnl|CDD|215646 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family) Back     alignment and domain information 
 Score = 72.3 bits (178), Expect = 2e-16
 Identities = 38/96 (39%), Positives = 49/96 (51%), Gaps = 2/96 (2%)

Query: 28  VAFGREKRLRRRTNYYIVSLAVADLLVGLVGIPCALLASVGLPRHL--YACLFTISLLVV 85
           +   R K+LR  TN ++++LAVADLL  L   P AL   VG         C     L VV
Sbjct: 1   LVILRTKKLRTPTNIFLLNLAVADLLFLLTLPPWALYYLVGGDWPFGDALCKLVGFLFVV 60

Query: 86  LCTISIFCLVAVSVDRYWAILFPMGYARNVTTKIAV 121
               SI  L A+S+DRY AI+ P+ Y R  T + A 
Sbjct: 61  NGYASILLLTAISIDRYLAIVHPLRYRRIRTPRRAK 96

This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins. Length = 251
>gnl|CDD|192535 pfam10320, 7TM_GPCR_Srsx, Serpentine type 7TM GPCR chemoreceptor Srsx Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 123
PHA03234 338 DNA packaging protein UL33; Provisional 99.88
KOG4219|consensus 423 99.87
PHA02834 323 chemokine receptor-like protein; Provisional 99.83
PHA02638 417 CC chemokine receptor-like protein; Provisional 99.82
PHA03087 335 G protein-coupled chemokine receptor-like protein; 99.81
KOG4220|consensus 503 99.79
PF00001 257 7tm_1: 7 transmembrane receptor (rhodopsin family) 99.78
PHA03235 409 DNA packaging protein UL33; Provisional 99.77
PF10320 257 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep 99.68
KOG2087|consensus 363 99.37
PF10328 274 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemorecept 99.17
PF10324 318 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemorecept 98.96
PF10316 273 7TM_GPCR_Srbc: Serpentine type 7TM GPCR chemorecep 98.38
PF11710201 Git3: G protein-coupled glucose receptor regulatin 98.16
PF05462 303 Dicty_CAR: Slime mold cyclic AMP receptor 98.13
PF10323 283 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemorecept 98.09
PF10321 313 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemorecept 97.85
PF05296 303 TAS2R: Mammalian taste receptor protein (TAS2R); I 97.82
PF10292 324 7TM_GPCR_Srab: Serpentine type 7TM GPCR receptor c 97.39
PF10317 292 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemorecept 97.25
PF02118 275 Srg: Srg family chemoreceptor; InterPro: IPR000609 97.22
PF03402 265 V1R: Vomeronasal organ pheromone receptor family, 97.11
PF00002 242 7tm_2: 7 transmembrane receptor (Secretin family); 96.02
PF02117 328 7TM_GPCR_Sra: Serpentine type 7TM GPCR chemorecept 95.11
PF10326 307 7TM_GPCR_Str: Serpentine type 7TM GPCR chemorecept 93.18
PF02175 236 7TM_GPCR_Srb: Serpentine type 7TM GPCR chemorecept 91.69
PF10327 303 7TM_GPCR_Sri: Serpentine type 7TM GPCR chemorecept 90.71
PF02101 405 Ocular_alb: Ocular albinism type 1 protein; InterP 84.94
PF10319 310 7TM_GPCR_Srj: Serpentine type 7TM GPCR chemorecept 84.56
PF03383153 Serpentine_r_xa: Caenorhabditis serpentine recepto 82.1
>PHA03234 DNA packaging protein UL33; Provisional Back     alignment and domain information 
Probab=99.88  E-value=1.5e-22  Score=142.97  Aligned_cols=109  Identities=15%  Similarity=0.133  Sum_probs=92.2

Q ss_pred             chhHHHHHHHHHHHHHHHhHHhhhhh--eeccccCCchhhHHHHHHHHHHHhhhhchHHHHHHHhcCCCcchhHHHHHHH
Q psy3302           5 NVPYTICEVLVALGAVIGNSLVIVAF--GREKRLRRRTNYYIVSLAVADLLVGLVGIPCALLASVGLPRHLYACLFTISL   82 (123)
Q Consensus         5 ~~~~~~~~~~~~~~g~~~N~~vl~~i--~~~~~l~~~~~~~l~~La~sdl~~~~~~~~~~~~~~~~~~~~~~~C~~~~~~   82 (123)
                      +.....+|.++.++|++||.++++++  .+++++|+++|+++.|||+||++.++...|.......+|++++..|++..++
T Consensus        32 ~~~~~~~y~~vf~~gl~gN~lvl~v~~~~~~~~~rt~tn~fi~NLAvaDLL~~l~lp~~~~~~~~~w~fG~~lCk~~~~~  111 (338)
T PHA03234         32 QILESAINGIMLTLIIPMIIIVICTLIIYHKVAKHNATSFYLITLFASDFLHMLCVFFLTLNREALFNFNQAFCQCVLFI  111 (338)
T ss_pred             HHHhhHHHHHHHHHHhhhHHHHHHHHHHHhccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCccCchhHHHHHHHH
Confidence            35577899999999999999999854  4556678999999999999999997644443333333688999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhHhhccccc
Q psy3302          83 LVVLCTISIFCLVAVSVDRYWAILFPMGYAR  113 (123)
Q Consensus        83 ~~~~~~~s~~~l~~ia~~R~~~v~~p~~~~~  113 (123)
                      .....++|++++++||+|||+||++|.+++.
T Consensus       112 ~~~~~~~Si~~L~~ISiDRY~aIv~p~~~~~  142 (338)
T PHA03234        112 YHASCSYSICMLAIIATIRYKTLHRRKKNDK  142 (338)
T ss_pred             HHHHHHHHHHHHHHHHHHhHeeeechhhhhh
Confidence            9999999999999999999999999987653

>KOG4219|consensus Back     alignment and domain information
>PHA02834 chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA02638 CC chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information
>KOG4220|consensus Back     alignment and domain information
>PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PHA03235 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG2087|consensus Back     alignment and domain information
>PF10328 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemoreceptor Srx; InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10324 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemoreceptor Srw; InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10316 7TM_GPCR_Srbc: Serpentine type 7TM GPCR chemoreceptor Srbc ; InterPro: IPR019420 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF11710 Git3: G protein-coupled glucose receptor regulating Gpa2; InterPro: IPR023041 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor Back     alignment and domain information
>PF05462 Dicty_CAR: Slime mold cyclic AMP receptor Back     alignment and domain information
>PF10323 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemoreceptor Srv; InterPro: IPR019426 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10321 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemoreceptor Srt; InterPro: IPR019425 Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type [] Back     alignment and domain information
>PF05296 TAS2R: Mammalian taste receptor protein (TAS2R); InterPro: IPR007960 This family consists of several forms of mammalian taste receptor proteins (TAS2Rs) Back     alignment and domain information
>PF10292 7TM_GPCR_Srab: Serpentine type 7TM GPCR receptor class ab chemoreceptor; InterPro: IPR019408 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10317 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemoreceptor Srd; InterPro: IPR019421 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF02118 Srg: Srg family chemoreceptor; InterPro: IPR000609 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF03402 V1R: Vomeronasal organ pheromone receptor family, V1R; InterPro: IPR004072 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF00002 7tm_2: 7 transmembrane receptor (Secretin family); InterPro: IPR000832 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF02117 7TM_GPCR_Sra: Serpentine type 7TM GPCR chemoreceptor Sra; InterPro: IPR000344 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10326 7TM_GPCR_Str: Serpentine type 7TM GPCR chemoreceptor Str; InterPro: IPR019428 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF02175 7TM_GPCR_Srb: Serpentine type 7TM GPCR chemoreceptor Srb; InterPro: IPR002184 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10327 7TM_GPCR_Sri: Serpentine type 7TM GPCR chemoreceptor Sri; InterPro: IPR019429 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF02101 Ocular_alb: Ocular albinism type 1 protein; InterPro: IPR001414 Ocular albinism type 1 (OA1) is an X-linked disorder characterised by severe impairment of visual acuity, retinal hypopigmentation and the presence of macromelanosomes Back     alignment and domain information
>PF10319 7TM_GPCR_Srj: Serpentine type 7TM GPCR chemoreceptor Srj; InterPro: IPR019423 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF03383 Serpentine_r_xa: Caenorhabditis serpentine receptor-like protein, class xa; InterPro: IPR005047 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
3pwh_A 329 Thermostabilised Adenosine A2a Receptor Length = 32 2e-09
4eiy_A 447 Crystal Structure Of The Chimeric Protein Of A2aar- 2e-09
3vg9_A 326 Crystal Structure Of Human Adenosine A2a Receptor W 2e-09
2ydo_A 325 Thermostabilised Human A2a Receptor With Adenosine 3e-09
3eml_A 488 The 2.6 A Crystal Structure Of A Human A2a Adenosin 3e-09
3sn6_R 514 Crystal Structure Of The Beta2 Adrenergic Receptor- 4e-07
4gbr_A 309 N-terminal T4 Lysozyme Fusion Facilitates Crystalli 5e-06
3pds_A 458 Irreversible Agonist-Beta2 Adrenoceptor Complex Len 7e-06
3d4s_A 490 Cholesterol Bound Form Of Human Beta2 Adrenergic Re 8e-06
3pbl_A 481 Structure Of The Human Dopamine D3 Receptor In Comp 1e-05
2r4s_A 342 Crystal Structure Of The Human Beta2 Adrenoceptor L 2e-05
2r4r_A 365 Crystal Structure Of The Human Beta2 Adrenoceptor L 2e-05
3kj6_A 366 Crystal Structure Of A Methylated Beta2 Adrenergic 2e-05
2rh1_A 500 High Resolution Crystal Structure Of Human B2-Adren 3e-05
3p0g_A 501 Structure Of A Nanobody-Stabilized Active State Of 3e-05
4daj_A 479 Structure Of The M3 Muscarinic Acetylcholine Recept 2e-04
>pdb|3PWH|A Chain A, Thermostabilised Adenosine A2a Receptor Length = 329 Back     alignment and structure 
Iteration: 1

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 58/120 (48%), Gaps = 5/120 (4%)
Query: 8   YTICEVLVALGAVIGNSLVIVAFGREKRLRRRTNYYIXXXXXXXXXXXXXXIPCALLASV 67
           Y   E+ +A+ A++GN LV  A      L+  TNY++              IP A+  S 
Sbjct: 9   YITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPFAITIST 68
Query: 68  GLPRHLYACLFTISLLVVLCTISIFCLVAVSVDRYWAILFPMGYARNVTTK-----IAVC 122
           G     + CLF    ++VL   SIF L+A+++DRY AI  P+ Y   VT       IA+C
Sbjct: 69  GFCAACHGCLFIACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGLVTGTRAAGIIAIC 128
>pdb|4EIY|A Chain A, Crystal Structure Of The Chimeric Protein Of A2aar-Bril In Complex With Zm241385 At 1.8a Resolution Length = 447 Back     alignment and structure
>pdb|3VG9|A Chain A, Crystal Structure Of Human Adenosine A2a Receptor With An Allosteric Inverse-Agonist Antibody At 2.7 A Resolution Length = 326 Back     alignment and structure
>pdb|2YDO|A Chain A, Thermostabilised Human A2a Receptor With Adenosine Bound Length = 325 Back     alignment and structure
>pdb|3EML|A Chain A, The 2.6 A Crystal Structure Of A Human A2a Adenosine Receptor Bound To Zm241385. Length = 488 Back     alignment and structure
>pdb|3SN6|R Chain R, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 514 Back     alignment and structure
>pdb|4GBR|A Chain A, N-terminal T4 Lysozyme Fusion Facilitates Crystallization Of A G Protein Coupled Receptor Length = 309 Back     alignment and structure
>pdb|3PDS|A Chain A, Irreversible Agonist-Beta2 Adrenoceptor Complex Length = 458 Back     alignment and structure
>pdb|3D4S|A Chain A, Cholesterol Bound Form Of Human Beta2 Adrenergic Receptor. Length = 490 Back     alignment and structure
>pdb|3PBL|A Chain A, Structure Of The Human Dopamine D3 Receptor In Complex With Eticlopride Length = 481 Back     alignment and structure
>pdb|2R4S|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 342 Back     alignment and structure
>pdb|2R4R|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 365 Back     alignment and structure
>pdb|3KJ6|A Chain A, Crystal Structure Of A Methylated Beta2 Adrenergic Receptor- Fab Complex Length = 366 Back     alignment and structure
>pdb|2RH1|A Chain A, High Resolution Crystal Structure Of Human B2-Adrenergic G Protein- Coupled Receptor Length = 500 Back     alignment and structure
>pdb|3P0G|A Chain A, Structure Of A Nanobody-Stabilized Active State Of The Beta2 Adrenoceptor Length = 501 Back     alignment and structure
>pdb|4DAJ|A Chain A, Structure Of The M3 Muscarinic Acetylcholine Receptor Length = 479 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 8e-40
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 9e-39
3sn6_R 514 Lysozyme, beta-2 adrenergic receptor; seven transm 1e-31
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 2e-31
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 5e-31
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 1e-30
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 5e-30
4amj_A 315 Beta-1 adrenergic receptor; membrane protein, 7TMR 7e-30
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 6e-29
2ks9_A 364 Substance-P receptor; water, autodock, NK1, neurop 4e-20
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 4e-18
1u19_A 349 Rhodopsin; G protein-coupled receptor, membrane pr 9e-18
4ea3_A 434 Fusion protein of nociceptin receptor and cytochr; 2e-16
3odu_A 502 C-X-C chemokine receptor type 4, lysozyme chimera; 1e-15
4dkl_A 464 MU-type opioid receptor, lysozyme chimera; G-prote 1e-15
1hll_A32 Alpha-2A adrenergic receptor; helix-linker-helix, 4e-06
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Length = 447 Back     alignment and structure
 Score =  136 bits (344), Expect = 8e-40
 Identities = 46/119 (38%), Positives = 67/119 (56%)

Query: 5   NVPYTICEVLVALGAVIGNSLVIVAFGREKRLRRRTNYYIVSLAVADLLVGLVGIPCALL 64
           +  Y   E+ +A+ A++GN LV  A      L+  TNY++VSLA AD+ VG++ IP A+ 
Sbjct: 31  SSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAIT 90

Query: 65  ASVGLPRHLYACLFTISLLVVLCTISIFCLVAVSVDRYWAILFPMGYARNVTTKIAVCK 123
            S G     + CLF    ++VL   SIF L+A+++DRY AI  P+ Y   VT   A   
Sbjct: 91  ISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGI 149
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Length = 488 Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A Length = 514 Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Length = 520 Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Length = 500 Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Length = 452 Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Length = 467 Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Length = 315 Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, protein structure initiative, AC technologies center for gene to 3D structure; HET: ETQ MAL; 2.89A {Homo sapiens} Length = 481 Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Length = 364 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Length = 349 Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Length = 502 Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Length = 464 Back     alignment and structure
>1hll_A Alpha-2A adrenergic receptor; helix-linker-helix, membrane protein; NMR {Synthetic} SCOP: j.94.1.1 PDB: 1hof_A 1ho9_A 1hod_A Length = 32 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query123
2lnl_A 296 C-X-C chemokine receptor type 1; G protein coupled 99.91
4grv_A 510 Neurotensin receptor type 1, lysozyme chimera; G-p 99.91
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 99.9
4amj_A 315 Beta-1 adrenergic receptor; membrane protein, 7TMR 99.89
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 99.89
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 99.89
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 99.89
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 99.89
3vw7_A 484 Proteinase-activated receptor 1, lysozyme; high re 99.89
4dkl_A 464 MU-type opioid receptor, lysozyme chimera; G-prote 99.88
3odu_A 502 C-X-C chemokine receptor type 4, lysozyme chimera; 99.88
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 99.88
3sn6_R 514 Lysozyme, beta-2 adrenergic receptor; seven transm 99.87
1u19_A 349 Rhodopsin; G protein-coupled receptor, membrane pr 99.87
4ea3_A 434 Fusion protein of nociceptin receptor and cytochr; 99.87
2ks9_A 364 Substance-P receptor; water, autodock, NK1, neurop 99.87
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 99.86
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 99.86
1hll_A32 Alpha-2A adrenergic receptor; helix-linker-helix, 99.09
2lot_A64 Apelin receptor; membrane protein; NMR {Homo sapie 94.68
>2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} Back     alignment and structure
Probab=99.91  E-value=3.2e-24  Score=146.77  Aligned_cols=111  Identities=30%  Similarity=0.331  Sum_probs=98.7

Q ss_pred             hhHHHHHHHHHHHHHHHhHHhhhhheeccccCCchhhHHHHHHHHHHHhhhhchHHHHH-HHhcCCCcchhHHHHHHHHH
Q psy3302           6 VPYTICEVLVALGAVIGNSLVIVAFGREKRLRRRTNYYIVSLAVADLLVGLVGIPCALL-ASVGLPRHLYACLFTISLLV   84 (123)
Q Consensus         6 ~~~~~~~~~~~~~g~~~N~~vl~~i~~~~~l~~~~~~~l~~La~sdl~~~~~~~~~~~~-~~~~~~~~~~~C~~~~~~~~   84 (123)
                      .+..++|.++.++|++||.+++.++.+++++|+++|+++.|||++|++.++. .|.... ...+|..++..|+...+...
T Consensus        12 ~i~~i~y~ii~i~gv~gN~lvi~vi~~~~~lrt~~n~~i~nLAvaDll~~l~-~p~~~~~~~~~~~~~~~~c~~~~~~~~   90 (296)
T 2lnl_A           12 YVVIIAYALVFLLSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALT-LPIWAASKVNGWIFGTFLCKVVSLLKE   90 (296)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHCTTCCSTTHHHHHHHHHHHHHHHHH-HHHHHHHHHSSSCCSSHHHHHHHHHHH
T ss_pred             HhHHHHHHHHHHHHHHHHHHHHHHHHHccCCCChHHHHHHHHHHHHHHHHHh-hhHHHhhccCCCccchhHHHHHhhhhh
Confidence            4667889999999999999999999999999999999999999999998754 454443 33478899999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHhHhhcccccceee
Q psy3302          85 VLCTISIFCLVAVSVDRYWAILFPMGYARNVTT  117 (123)
Q Consensus        85 ~~~~~s~~~l~~ia~~R~~~v~~p~~~~~~~~~  117 (123)
                      .+..+|.+++++||+|||.+|++|++|+...++
T Consensus        91 ~~~~~s~~~l~~isidRy~aI~~P~~~~~~~~~  123 (296)
T 2lnl_A           91 VNFYSGILLLACISVDRYLAIVHATRTLTQKRH  123 (296)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHSSSCSSSSCCHHH
T ss_pred             hhHHHHHHHHHHHHhhhhhhhhhccccchhhhh
Confidence            999999999999999999999999999886654
>4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Back     alignment and structure
>3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Back     alignment and structure
>1hll_A Alpha-2A adrenergic receptor; helix-linker-helix, membrane protein; NMR {Synthetic} SCOP: j.94.1.1 PDB: 1hof_A 1ho9_A 1hod_A Back     alignment and structure
>2lot_A Apelin receptor; membrane protein; NMR {Homo sapiens} PDB: 2lou_A 2lov_A 2low_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 123
d1u19a_ 348 f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 4e-10
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Length = 348 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 53.8 bits (128), Expect = 4e-10
 Identities = 15/50 (30%), Positives = 24/50 (48%)

Query: 13 VLVALGAVIGNSLVIVAFGREKRLRRRTNYYIVSLAVADLLVGLVGIPCA 62
           L+ +     N L +    + K+LR   NY +++LAVADL +   G    
Sbjct: 45 FLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTT 94

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query123
d1u19a_ 348 Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} 99.82
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.82  E-value=3.8e-20  Score=126.89  Aligned_cols=112  Identities=23%  Similarity=0.273  Sum_probs=99.8

Q ss_pred             hHHHHHHHHHHHHHHHhHHhhhhheeccccCCchhhHHHHHHHHHHHhhhhchHHHHHHHh--cCCCcchhHHHHHHHHH
Q psy3302           7 PYTICEVLVALGAVIGNSLVIVAFGREKRLRRRTNYYIVSLAVADLLVGLVGIPCALLASV--GLPRHLYACLFTISLLV   84 (123)
Q Consensus         7 ~~~~~~~~~~~~g~~~N~~vl~~i~~~~~l~~~~~~~l~~La~sdl~~~~~~~~~~~~~~~--~~~~~~~~C~~~~~~~~   84 (123)
                      ....++.++.++|++||++++.++.+++++|++.|+++.|||++|++.++...|..+....  .+..++..|+...+...
T Consensus        39 ~~~~~~~ii~v~gi~gN~lvi~vi~~~k~lr~~~~~~l~nLaiaDll~~~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~  118 (348)
T d1u19a_          39 MLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFAT  118 (348)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHSTTCCSHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHTSCTTHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHeehhhhccCCCCCHhHHHHHHHHHHHHHHHHHHHHHhhhhhccCccccCchhhhhhhhccc
Confidence            5567888899999999999999999999999999999999999999998888887766554  46667899999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHhHhhcccccceeee
Q psy3302          85 VLCTISIFCLVAVSVDRYWAILFPMGYARNVTTK  118 (123)
Q Consensus        85 ~~~~~s~~~l~~ia~~R~~~v~~p~~~~~~~~~~  118 (123)
                      .+..++.++++++++|||.++++|++|+...+++
T Consensus       119 ~~~~~s~~~l~~is~~R~~~i~~p~~~~~~~~~~  152 (348)
T d1u19a_         119 LGGEIALWSLVVLAIERYVVVCKPMSNFRFGENH  152 (348)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTCCSSSCCCCHHH
T ss_pred             cceeeecchhhhhhcccceeeecccccccccccc
Confidence            9999999999999999999999999988765543