Psyllid ID: psy3331

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210----
MSHKLDEWVEIAQQCKYLPENELKSKKFVKGGTYYTALAKMKILNFPPHVKLDNIVHRSLETLCDFVCSILNEESNVQHVSTPVTVCGDIHGQYIYMGAFCDLVWSDPAEVETWTVSPRGAGWLFGAKVTHEFIHINHLKLICRAHQLVHEGYKYMFDGNLVTIWSAPNYCYRCGNIASILKFNSVDNRTPALFQAVPNEERVIPDRVITPYFL
ccccHHHHHHHHHHcccccccccccEEEEEccccccccccccccccccccccHHHHHHHHHHHcccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccEEccHHHHHHHHHHccccEEEEcccccccccEEEccccEEEEEEccccccccccEEEEEEEccccccccEEEEccccccccccccccccccc
ccccccEEEEEcccccHEccEEEEcccHHHHHHccccHHHHHHHHHHccccEEEEEcccEEEEcccccHHHHHcccEEEEcccEEEEccccccHcccccHHHHccccccccccEEEccccccEEEcHHHHHHHHHHHcccEEEEccccccccEEEEccccEEEEEccccccccccccEEEEEEcccccccEEEEcccccccccccccccccccc
MSHKLDEWVEIAQQCkylpenelkskkfvkggTYYTALAKMKilnfpphvkldnivHRSLETLCDFVCSILNeesnvqhvstpvtvcgdihgqYIYMGAFcdlvwsdpaevetwtvsprgagwlfgakvthefIHINHLKLICRAHQLVHEGYKymfdgnlvtiwsapnycyrcgniasilkfnsvdnrtpalfqavpneervipdrvitpyfl
MSHKLDEWVEIAQQckylpenelkskkfVKGGTYYTALAKMKILNFPPHVKLDNIVHRSLETLCDFVCSILNEESNVQHVSTPVTVCGDIHGQYIYMGAFCDLVWSDPAEVETWTVSPRGAGWLFGAKVTHEFIHINHLKLICRAHQLVHEGYKYMFDGNLVTIWSAPNYCYRCGNIASILKFNSVDNRTPAlfqavpneervipdrvitpyfl
MSHKLDEWVEIAQQCKYLPENELKSKKFVKGGTYYTALAKMKILNFPPHVKLDNIVHRSLETLCDFVCSILNEESNVQHVSTPVTVCGDIHGQYIYMGAFCDLVWSDPAEVETWTVSPRGAGWLFGAKVTHEFIHINHLKLICRAHQLVHEGYKYMFDGNLVTIWSAPNYCYRCGNIASILKFNSVDNRTPALFQAVPNEERVIPDRVITPYFL
******EWVEIAQQCKYLPENELKSKKFVKGGTYYTALAKMKILNFPPHVKLDNIVHRSLETLCDFVCSILNEESNVQHVSTPVTVCGDIHGQYIYMGAFCDLVWSDPAEVETWTVSPRGAGWLFGAKVTHEFIHINHLKLICRAHQLVHEGYKYMFDGNLVTIWSAPNYCYRCGNIASILKFNSVDNRTPALFQAVPNEERVIPDRVITPY**
**HKLDEWVEIAQQCKYLPENELKSKKFVKGGTYYTALAKMKILNFPPHVKLDNIVHRSLETLCDFVCSILNEESNVQHVSTPVTVCGDIHGQYIYMGAFCDLVWSDPAEVETWTVSPRGAGWLFGAKVTHEFIHINHLKLICRAHQLVHEGYKYMFDGNLVTIWSAPNYCYRCGNIASILKFNSVDNRTPAL**************VITPYFL
MSHKLDEWVEIAQQCKYLPENELKSKKFVKGGTYYTALAKMKILNFPPHVKLDNIVHRSLETLCDFVCSILNEESNVQHVSTPVTVCGDIHGQYIYMGAFCDLVWSDPAEVETWTVSPRGAGWLFGAKVTHEFIHINHLKLICRAHQLVHEGYKYMFDGNLVTIWSAPNYCYRCGNIASILKFNSVDNRTPALFQAVPNEERVIPDRVITPYFL
***KLDEWVEIAQQCKYLPENELKSKKFVKGGTYYTALAKMKILNFPPHVKLDNIVHRSLETLCDFVCSILNEESNVQHVSTPVTVCGDIHGQYIYMGAFCDLVWSDPAEVETWTVSPRGAGWLFGAKVTHEFIHINHLKLICRAHQLVHEGYKYMFDGNLVTIWSAPNYCYRCGNIASILKFNSVDNRTPALFQAVPNEERVIPDRVI*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSHKLDEWVEIAQQCKYLPENELKSKKFVKGGTYYTALAKMKILNFPPHVKLDNIVHRSLETLCDFVCSILNEESNVQHVSTPVTVCGDIHGQYIYMGAFCDLVWSDPAEVETWTVSPRGAGWLFGAKVTHEFIHINHLKLICRAHQLVHEGYKYMFDGNLVTIWSAPNYCYRCGNIASILKFNSVDNRTPALFQAVPNEERVIPDRVITPYFL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query214 2.2.26 [Sep-21-2011]
Q64620305 Serine/threonine-protein yes N/A 0.289 0.203 0.777 4e-53
Q9CQR6305 Serine/threonine-protein yes N/A 0.289 0.203 0.777 4e-53
O00743305 Serine/threonine-protein no N/A 0.289 0.203 0.777 4e-53
Q27884303 Serine/threonine-protein yes N/A 0.331 0.234 0.658 1e-46
Q9U9A3305 Serine/threonine-protein yes N/A 0.542 0.380 0.675 3e-42
Q8LSN3303 Phytochrome-associated se N/A N/A 0.546 0.386 0.627 2e-39
Q9SX52303 Phytochrome-associated se yes N/A 0.546 0.386 0.627 2e-39
Q9LHE7303 Phytochrome-associated se yes N/A 0.546 0.386 0.627 3e-39
P36614305 Serine/threonine-protein yes N/A 0.546 0.383 0.621 5e-39
Q09496331 Putative serine/threonine yes N/A 0.542 0.350 0.576 9e-37
>sp|Q64620|PPP6_RAT Serine/threonine-protein phosphatase 6 catalytic subunit OS=Rattus norvegicus GN=Ppp6c PE=2 SV=2 Back     alignment and function desciption
 Score =  207 bits (527), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 91/117 (77%), Positives = 103/117 (88%)

Query: 98  GAFCDLVWSDPAEVETWTVSPRGAGWLFGAKVTHEFIHINHLKLICRAHQLVHEGYKYMF 157
           GAFCDLVWSDP +V+TW +SPRGAGWLFGAKVT+EF+HIN+LKLICRAHQLVHEGYK+MF
Sbjct: 189 GAFCDLVWSDPEDVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMF 248

Query: 158 DGNLVTIWSAPNYCYRCGNIASILKFNSVDNRTPALFQAVPNEERVIPDRVITPYFL 214
           D  LVT+WSAPNYCYRCGNIASI+ F  V+ R P LF+AVP+ ERVIP R  TPYFL
Sbjct: 249 DEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL 305
Catalytic subunit of protein phosphatase 6 (PP6). PP6 is a component of a signaling pathway regulating cell cycle progression in response to IL2 receptor stimulation. N-terminal domain restricts G1 to S phase progression in cancer cells, in part through control of cyclin D1. Downregulates MAP3K7 kinase activation of the IL1 signaling pathway by dephosphorylation of MAP3K7.
Rattus norvegicus (taxid: 10116)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 6
>sp|Q9CQR6|PPP6_MOUSE Serine/threonine-protein phosphatase 6 catalytic subunit OS=Mus musculus GN=Ppp6c PE=2 SV=1 Back     alignment and function description
>sp|O00743|PPP6_HUMAN Serine/threonine-protein phosphatase 6 catalytic subunit OS=Homo sapiens GN=PPP6C PE=1 SV=1 Back     alignment and function description
>sp|Q27884|PPP6_DROME Serine/threonine-protein phosphatase 6 catalytic subunit OS=Drosophila melanogaster GN=PpV PE=2 SV=1 Back     alignment and function description
>sp|Q9U9A3|PPP6_DICDI Serine/threonine-protein phosphatase 6 catalytic subunit OS=Dictyostelium discoideum GN=ppp6c PE=2 SV=2 Back     alignment and function description
>sp|Q8LSN3|FYPP_PEA Phytochrome-associated serine/threonine-protein phosphatase OS=Pisum sativum GN=FYPP PE=1 SV=1 Back     alignment and function description
>sp|Q9SX52|FYPP1_ARATH Phytochrome-associated serine/threonine-protein phosphatase 1 OS=Arabidopsis thaliana GN=FYPP1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LHE7|FYPP3_ARATH Phytochrome-associated serine/threonine-protein phosphatase 3 OS=Arabidopsis thaliana GN=FYPP3 PE=1 SV=1 Back     alignment and function description
>sp|P36614|PPE1_SCHPO Serine/threonine-protein phosphatase ppe1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppe1 PE=1 SV=1 Back     alignment and function description
>sp|Q09496|PPH6_CAEEL Putative serine/threonine-protein phosphatase pph-6 OS=Caenorhabditis elegans GN=pph-6 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query214
431898826209 Serine/threonine-protein phosphatase 6 c 0.808 0.827 0.551 8e-67
354492880 669 PREDICTED: hypothetical protein LOC10075 0.471 0.150 0.764 6e-55
260794991304 hypothetical protein BRAFLDRAFT_113834 [ 0.373 0.263 0.820 2e-53
442760105180 Putative serine/threonine specific prote 0.556 0.661 0.773 6e-52
156344614146 hypothetical protein NEMVEDRAFT_v1g23143 0.588 0.863 0.753 6e-52
340728076 322 PREDICTED: serine/threonine-protein phos 0.289 0.192 0.777 6e-52
350424403303 PREDICTED: serine/threonine-protein phos 0.289 0.204 0.777 9e-52
444707265289 Serine/threonine-protein phosphatase 6 c 0.528 0.391 0.777 2e-51
355567912305 Serine/threonine-protein phosphatase 6 c 0.313 0.219 0.745 2e-51
327292194304 PREDICTED: LOW QUALITY PROTEIN: serine/t 0.462 0.325 0.777 2e-51
>gi|431898826|gb|ELK07196.1| Serine/threonine-protein phosphatase 6 catalytic subunit [Pteropus alecto] Back     alignment and taxonomy information
 Score =  258 bits (660), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 133/241 (55%), Positives = 152/241 (63%), Gaps = 68/241 (28%)

Query: 5   LDEWVEIAQQCKYLPENELKSKKFVKGGTYYTALAKMKILNFPPHVKLDNIVHRSLETLC 64
           LD++VEIA+ CKYLPEN+LK                                      LC
Sbjct: 6   LDKYVEIARLCKYLPENDLKR-------------------------------------LC 28

Query: 65  DFVCSILNEESNVQHVSTPVTVCGDIHGQYI----------------------------- 95
           D+VC +L EESNVQ VSTPVTVCGDIHGQ I                             
Sbjct: 29  DYVCDLLLEESNVQPVSTPVTVCGDIHGQLIDEQILCVHGGLSPDIKTLDQIRTIERNQE 88

Query: 96  --YMGAFCDLVWSDPAEVETWTVSPRGAGWLFGAKVTHEFIHINHLKLICRAHQLVHEGY 153
             + GAFCDLVWSDP +V+TW +SPRGAGWLFGAKVT+EF+HIN+LKLICRAHQLVHEGY
Sbjct: 89  IPHKGAFCDLVWSDPEDVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGY 148

Query: 154 KYMFDGNLVTIWSAPNYCYRCGNIASILKFNSVDNRTPALFQAVPNEERVIPDRVITPYF 213
           K+MFD  LVT+WSAPNYCYRCGNIASI+ F  V+ R P LF+AVP+ ERVIP R  TPYF
Sbjct: 149 KFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYF 208

Query: 214 L 214
           L
Sbjct: 209 L 209

Source: Pteropus alecto

Species: Pteropus alecto

Genus: Pteropus

Family: Pteropodidae

Order: Chiroptera

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota
>gi|354492880|ref|XP_003508572.1| PREDICTED: hypothetical protein LOC100752643 [Cricetulus griseus] Back     alignment and taxonomy information
>gi|260794991|ref|XP_002592490.1| hypothetical protein BRAFLDRAFT_113834 [Branchiostoma floridae] gi|229277710|gb|EEN48501.1| hypothetical protein BRAFLDRAFT_113834 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|442760105|gb|JAA72211.1| Putative serine/threonine specific protein phosphatase involved in cell cycle control [Ixodes ricinus] Back     alignment and taxonomy information
>gi|156344614|ref|XP_001621251.1| hypothetical protein NEMVEDRAFT_v1g231431 [Nematostella vectensis] gi|156206995|gb|EDO29151.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|340728076|ref|XP_003402357.1| PREDICTED: serine/threonine-protein phosphatase 6 catalytic subunit-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350424403|ref|XP_003493784.1| PREDICTED: serine/threonine-protein phosphatase 6 catalytic subunit-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|444707265|gb|ELW48549.1| Serine/threonine-protein phosphatase 6 catalytic subunit [Tupaia chinensis] Back     alignment and taxonomy information
>gi|355567912|gb|EHH24253.1| Serine/threonine-protein phosphatase 6 catalytic subunit [Macaca mulatta] Back     alignment and taxonomy information
>gi|327292194|ref|XP_003230805.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 6 catalytic subunit-like [Anolis carolinensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query214
MGI|MGI:1915107305 Ppp6c "protein phosphatase 6, 0.556 0.390 0.764 7.7e-73
RGD|708460305 Ppp6c "protein phosphatase 6, 0.556 0.390 0.764 7.7e-73
ZFIN|ZDB-GENE-040426-949305 ppp6c "protein phosphatase 6, 0.556 0.390 0.764 7.7e-73
UNIPROTKB|Q2KIC7305 PPP6C "Serine/threonine-protei 0.556 0.390 0.764 4.2e-72
UNIPROTKB|O00743305 PPP6C "Serine/threonine-protei 0.556 0.390 0.764 4.2e-72
UNIPROTKB|F2Z5N6305 PPP6C "Serine/threonine-protei 0.556 0.390 0.764 4.2e-72
UNIPROTKB|J9P6W4305 PPP6C "Serine/threonine-protei 0.556 0.390 0.739 5.2e-70
UNIPROTKB|F1NZJ8308 PPP6C "Serine/threonine-protei 0.556 0.386 0.764 2.3e-64
UNIPROTKB|F1P1S8281 PPP6C "Serine/threonine-protei 0.556 0.423 0.764 2.3e-64
DICTYBASE|DDB_G0272118305 ppp6c "protein phosphatase 6 c 0.537 0.377 0.681 5.9e-60
MGI|MGI:1915107 Ppp6c "protein phosphatase 6, catalytic subunit" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 528 (190.9 bits), Expect = 7.7e-73, Sum P(3) = 7.7e-73
 Identities = 91/119 (76%), Positives = 104/119 (87%)

Query:    96 YMGAFCDLVWSDPAEVETWTVSPRGAGWLFGAKVTHEFIHINHLKLICRAHQLVHEGYKY 155
             + GAFCDLVWSDP +V+TW +SPRGAGWLFGAKVT+EF+HIN+LKLICRAHQLVHEGYK+
Sbjct:   187 HKGAFCDLVWSDPEDVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKF 246

Query:   156 MFDGNLVTIWSAPNYCYRCGNIASILKFNSVDNRTPALFQAVPNEERVIPDRVITPYFL 214
             MFD  LVT+WSAPNYCYRCGNIASI+ F  V+ R P LF+AVP+ ERVIP R  TPYFL
Sbjct:   247 MFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL 305
GO:0004721 "phosphoprotein phosphatase activity" evidence=IEA
GO:0004722 "protein serine/threonine phosphatase activity" evidence=ISO
GO:0005737 "cytoplasm" evidence=IEA
GO:0005829 "cytosol" evidence=ISO
GO:0006470 "protein dephosphorylation" evidence=ISO
GO:0007049 "cell cycle" evidence=IEA
GO:0016787 "hydrolase activity" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
RGD|708460 Ppp6c "protein phosphatase 6, catalytic subunit" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-949 ppp6c "protein phosphatase 6, catalytic subunit" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KIC7 PPP6C "Serine/threonine-protein phosphatase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O00743 PPP6C "Serine/threonine-protein phosphatase 6 catalytic subunit" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5N6 PPP6C "Serine/threonine-protein phosphatase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J9P6W4 PPP6C "Serine/threonine-protein phosphatase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NZJ8 PPP6C "Serine/threonine-protein phosphatase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P1S8 PPP6C "Serine/threonine-protein phosphatase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0272118 ppp6c "protein phosphatase 6 catalytic subunit" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P36614PPE1_SCHPO3, ., 1, ., 3, ., 1, 60.62180.54670.3836yesN/A
Q9LHE7FYPP3_ARATH3, ., 1, ., 3, ., 1, 60.62710.54670.3861yesN/A
Q6CNT6PP4C_KLULA3, ., 1, ., 3, ., 1, 60.56140.52330.3636yesN/A
Q9SX52FYPP1_ARATH3, ., 1, ., 3, ., 1, 60.62710.54670.3861yesN/A
Q74ZR2PP4C_ASHGO3, ., 1, ., 3, ., 1, 60.60570.48590.3354yesN/A
Q09496PPH6_CAEEL3, ., 1, ., 3, ., 1, 60.57620.54200.3504yesN/A
Q6FM81PP4C_CANGA3, ., 1, ., 3, ., 1, 60.60370.41120.2847yesN/A
P32345PP4C_YEAST3, ., 1, ., 3, ., 1, 60.59430.41120.2857yesN/A
Q9U9A3PPP6_DICDI3, ., 1, ., 3, ., 1, 60.67520.54200.3803yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3.160.824
3rd Layer3.1.30.766

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
cd07415285 cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phos 2e-59
PTZ00239303 PTZ00239, PTZ00239, serine/threonine protein phosp 4e-59
smart00156271 smart00156, PP2Ac, Protein phosphatase 2A homologu 3e-34
cd07414293 cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-li 4e-22
cd07417316 cd07417, MPP_PP5_C, PP5, C-terminal metallophospha 6e-22
PTZ00480320 PTZ00480, PTZ00480, serine/threonine-protein phosp 2e-19
PTZ00244294 PTZ00244, PTZ00244, serine/threonine-protein phosp 1e-18
cd00144225 cd00144, MPP_PPP_family, phosphoprotein phosphatas 2e-17
cd07415285 cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phos 4e-15
cd07416305 cd07416, MPP_PP2B, PP2B, metallophosphatase domain 4e-14
cd07419311 cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 pho 1e-13
cd07420321 cd07420, MPP_RdgC, Drosophila melanogaster RdgC an 2e-12
COG0639155 COG0639, ApaH, Diadenosine tetraphosphatase and re 1e-11
PTZ00239 303 PTZ00239, PTZ00239, serine/threonine protein phosp 2e-09
cd07418377 cd07418, MPP_PP7, PP7, metallophosphatase domain 1e-08
smart00156 271 smart00156, PP2Ac, Protein phosphatase 2A homologu 3e-08
cd07416 305 cd07416, MPP_PP2B, PP2B, metallophosphatase domain 1e-05
cd07419 311 cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 pho 0.001
>gnl|CDD|163658 cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information 
 Score =  187 bits (478), Expect = 2e-59
 Identities = 62/101 (61%), Positives = 77/101 (76%)

Query: 98  GAFCDLVWSDPAEVETWTVSPRGAGWLFGAKVTHEFIHINHLKLICRAHQLVHEGYKYMF 157
           G  CDL+WSDP ++E W +SPRGAG+LFG  V  EF H N L LICRAHQLV EGY++MF
Sbjct: 185 GPMCDLLWSDPDDIEGWGISPRGAGYLFGQDVVEEFNHNNGLTLICRAHQLVMEGYQWMF 244

Query: 158 DGNLVTIWSAPNYCYRCGNIASILKFNSVDNRTPALFQAVP 198
           D  LVT+WSAPNYCYRCGN+ASI++ +    R+  +F+A P
Sbjct: 245 DDKLVTVWSAPNYCYRCGNVASIMELDEHLKRSFKVFEAAP 285

PP2A-like family of phosphoprotein phosphatases (PPP's) including PP4 and PP6. PP2A (Protein phosphatase 2A) is a critical regulator of many cellular activities. PP2A comprises about 1% of total cellular proteins. PP2A, together with protein phosphatase 1 (PP1), accounts for more than 90% of all serine/threonine phosphatase activities in most cells and tissues. The PP2A subunit in addition to having a catalytic domain homologous to PP1, has a unique C-terminal tail, containing a motif that is conserved in the catalytic subunits of all PP2A-like phosphatases including PP4 and PP6, and has an important role in PP2A regulation. The PP2A-like family of phosphatases all share a similar heterotrimeric architecture, that includes: a 65kDa scaffolding subunit (A), a 36kDa catalytic subunit (C), and one of 18 regulatory subunits (B). The PPP (phosphoprotein phosphatase) family, to which PP2A belongs, is one of two known protein phosphatase families specific for serine and threonine. The PPP family also includes: PP1, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-). The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes. Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cellular processes. PPPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 285
>gnl|CDD|173488 PTZ00239, PTZ00239, serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>gnl|CDD|197547 smart00156, PP2Ac, Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>gnl|CDD|163657 cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163660 cd07417, MPP_PP5_C, PP5, C-terminal metallophosphatase domain Back     alignment and domain information
>gnl|CDD|185658 PTZ00480, PTZ00480, serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140271 PTZ00244, PTZ00244, serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>gnl|CDD|163613 cd00144, MPP_PPP_family, phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163658 cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163659 cd07416, MPP_PP2B, PP2B, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163662 cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163663 cd07420, MPP_RdgC, Drosophila melanogaster RdgC and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|223712 COG0639, ApaH, Diadenosine tetraphosphatase and related serine/threonine protein phosphatases [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|173488 PTZ00239, PTZ00239, serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>gnl|CDD|163661 cd07418, MPP_PP7, PP7, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|197547 smart00156, PP2Ac, Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>gnl|CDD|163659 cd07416, MPP_PP2B, PP2B, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163662 cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 214
KOG0372|consensus303 100.0
KOG0373|consensus306 100.0
PTZ00239303 serine/threonine protein phosphatase 2A; Provision 100.0
KOG0371|consensus319 100.0
cd07415285 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein 100.0
PTZ00480320 serine/threonine-protein phosphatase; Provisional 100.0
PTZ00244294 serine/threonine-protein phosphatase PP1; Provisio 100.0
cd07417316 MPP_PP5_C PP5, C-terminal metallophosphatase domai 100.0
cd07414293 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzyme 100.0
cd07420321 MPP_RdgC Drosophila melanogaster RdgC and related 100.0
cd07416305 MPP_PP2B PP2B, metallophosphatase domain. PP2B (ca 100.0
KOG0374|consensus331 100.0
smart00156271 PP2Ac Protein phosphatase 2A homologues, catalytic 100.0
cd07418377 MPP_PP7 PP7, metallophosphatase domain. PP7 is a p 100.0
cd07419311 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase a 100.0
KOG0375|consensus 517 100.0
KOG0377|consensus 631 99.98
KOG0376|consensus476 99.96
cd00144225 MPP_PPP_family phosphoprotein phosphatases of the 99.46
KOG0373|consensus306 98.26
KOG0372|consensus303 98.18
COG0639155 ApaH Diadenosine tetraphosphatase and related seri 98.14
cd07425208 MPP_Shelphs Shewanella-like phosphatases, metallop 97.76
cd07420321 MPP_RdgC Drosophila melanogaster RdgC and related 97.56
KOG0371|consensus319 97.4
KOG0375|consensus 517 97.08
KOG0374|consensus331 97.0
cd07418377 MPP_PP7 PP7, metallophosphatase domain. PP7 is a p 96.92
cd07415285 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein 96.81
cd07417316 MPP_PP5_C PP5, C-terminal metallophosphatase domai 96.81
PTZ00239303 serine/threonine protein phosphatase 2A; Provision 96.76
smart00156271 PP2Ac Protein phosphatase 2A homologues, catalytic 96.64
PTZ00480320 serine/threonine-protein phosphatase; Provisional 96.6
cd07414293 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzyme 96.58
PTZ00244294 serine/threonine-protein phosphatase PP1; Provisio 96.57
cd07416305 MPP_PP2B PP2B, metallophosphatase domain. PP2B (ca 96.53
cd07419311 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase a 96.52
KOG0377|consensus 631 94.81
KOG0376|consensus 476 94.47
PRK11439218 pphA serine/threonine protein phosphatase 1; Provi 93.01
PF0832195 PPP5: PPP5 TPR repeat region; InterPro: IPR013235 92.55
PRK13625245 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provision 90.8
cd07421 304 MPP_Rhilphs Rhilph phosphatases, metallophosphatas 90.22
PRK09968218 serine/threonine-specific protein phosphatase 2; P 89.03
PRK00166 275 apaH diadenosine tetraphosphatase; Reviewed 87.6
cd07422 257 MPP_ApaH Escherichia coli ApaH and related protein 86.51
cd00144225 MPP_PPP_family phosphoprotein phosphatases of the 86.51
TIGR00668 279 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetric 85.19
cd07423 234 MPP_PrpE Bacillus subtilis PrpE and related protei 84.31
cd07424207 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do 84.17
cd07424207 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do 80.24
>KOG0372|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.1e-59  Score=401.22  Aligned_cols=175  Identities=55%  Similarity=1.059  Sum_probs=167.3

Q ss_pred             ccHHHHHHHHHhCCCCCcccccccccccCCcchhhhhhhhhcCCCCCccccccchhHHHHHHHHHHHHHhcCCCccccCC
Q psy3331           3 HKLDEWVEIAQQCKYLPENELKSKKFVKGGTYYTALAKMKILNFPPHVKLDNIVHRSLETLCDFVCSILNEESNVQHVST   82 (214)
Q Consensus         3 ~~~~~~~~~~~~~~~~~e~~~~~~~~~rGnh~~~~~~~~~~~~~e~~~~~~~~~~~~l~~l~~~a~~il~~ep~ll~l~~   82 (214)
                      +++|+.|+++.++++++|.+|+                                     .||.++++||.+|||++.+++
T Consensus         1 ~dldr~ie~L~~~~li~E~eV~-------------------------------------~LC~~~~eiL~~E~NV~~i~t   43 (303)
T KOG0372|consen    1 SDLDRQIEQLRRCELIAESEVK-------------------------------------ALCAKVREILVEESNVQRIDT   43 (303)
T ss_pred             CcHHHHHHHHHhcCCCcHHHHH-------------------------------------HHHHHHHHHHhcCCCceecCC
Confidence            4799999999999999999999                                     999999999999999999999


Q ss_pred             CeeEeccccccc------------------cch-----------------------------------------------
Q psy3331          83 PVTVCGDIHGQY------------------IYM-----------------------------------------------   97 (214)
Q Consensus        83 pv~vvGDiHGq~------------------LFL-----------------------------------------------   97 (214)
                      ||+|||||||||                  |||                                               
T Consensus        44 PvtvcGDIHGQf~Dllelf~igG~~~~t~YLFLGDyVDRG~~SvEt~lLLl~lK~rYP~ritLiRGNHEsRqitqvYGFY  123 (303)
T KOG0372|consen   44 PVTVCGDIHGQFYDLLELFRIGGDVPETNYLFLGDYVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFY  123 (303)
T ss_pred             CcEEeecccchHHHHHHHHHhCCCCCCCceEeecchhccccchHHHHHHHHHHhhcCcceeEEeeccchhhhhhhhhhHH
Confidence            999999999999                  666                                               


Q ss_pred             --------------------------------------------------------------hhhhhhhcCCCCCCCCCc
Q psy3331          98 --------------------------------------------------------------GAFCDLVWSDPAEVETWT  115 (214)
Q Consensus        98 --------------------------------------------------------------gl~~DlLWSDP~~~~g~~  115 (214)
                                                                                    |.+||||||||.+..||+
T Consensus       124 ~EclrKYG~~~vWr~c~eiFdyL~l~aiid~kifCVHGGlSP~i~~lDqIr~lDR~~Eiph~g~m~DllWSDPee~~g~~  203 (303)
T KOG0372|consen  124 DECLRKYGSANVWRYCTEIFDYLSLAAIIDGKIFCVHGGLSPSIQTLDQIRVLDRKQEVPHDGAMCDLLWSDPEEGPGWG  203 (303)
T ss_pred             HHHHHHcCChHHHHHHHHHHHhhhHhheecCcEEEEcCCCCcchhhHHHHHHhhccccCCCCCcchheeccCcccCCCcc
Confidence                                                                          999999999999999999


Q ss_pred             cCCCCCceEeCHHHHHHHHhhcCcceEEeccccccccceEeeCCcEEEEecCCCCCcCCCCcEEEEEEcCCCceeeEEee
Q psy3331         116 VSPRGAGWLFGAKVTHEFIHINHLKLICRAHQLVHEGYKYMFDGNLVTIWSAPNYCYRCGNIASILKFNSVDNRTPALFQ  195 (214)
Q Consensus       116 ~s~RG~g~~FG~~~v~~Fl~~n~l~~IiRaHq~v~~Gy~~~~~~~~iTVfSA~nY~~~~~N~aAvl~i~~~~~~~f~~f~  195 (214)
                      .||||+||+||++++++||+.||+++|+||||++++||++.|+.+++|||||||||++|+|.||||++|++....|++|+
T Consensus       204 ~SPRGaGylFG~dvv~~F~~~N~~~~I~RaHQLv~eGyk~~F~~~v~TVWSAPNYCYrCGN~AsIl~lde~~~~~F~vFe  283 (303)
T KOG0372|consen  204 LSPRGAGYLFGEDVVESFLEANGLSLICRAHQLVMEGYKWHFDEKVVTVWSAPNYCYRCGNVAAILELDEDLDKDFRVFE  283 (303)
T ss_pred             cCCCCccccccHHHHHHHHHhCChHHHHHHHHHHHhhHHHhcCCceEEEecCCchhhhcCChHHheeeccccCcceEeee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCCCCCC-CCCCCCCC
Q psy3331         196 AVPNEERVIPD-RVITPYFL  214 (214)
Q Consensus       196 ~~~~~~~~~~~-~~~~~~~~  214 (214)
                      ++|.+.+..+. +.+.+||+
T Consensus       284 aa~~~~~~~~~kk~~~~yFl  303 (303)
T KOG0372|consen  284 AAPQESRGIPAKKPIADYFL  303 (303)
T ss_pred             cchhhhcCCcccCcchhhcC
Confidence            99988886664 45667886

>KOG0373|consensus Back     alignment and domain information
>PTZ00239 serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>KOG0371|consensus Back     alignment and domain information
>cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information
>PTZ00480 serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>PTZ00244 serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain Back     alignment and domain information
>cd07414 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07416 MPP_PP2B PP2B, metallophosphatase domain Back     alignment and domain information
>KOG0374|consensus Back     alignment and domain information
>smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>cd07418 MPP_PP7 PP7, metallophosphatase domain Back     alignment and domain information
>cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>KOG0375|consensus Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>KOG0376|consensus Back     alignment and domain information
>cd00144 MPP_PPP_family phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>KOG0373|consensus Back     alignment and domain information
>KOG0372|consensus Back     alignment and domain information
>COG0639 ApaH Diadenosine tetraphosphatase and related serine/threonine protein phosphatases [Signal transduction mechanisms] Back     alignment and domain information
>cd07425 MPP_Shelphs Shewanella-like phosphatases, metallophosphatase domain Back     alignment and domain information
>cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG0371|consensus Back     alignment and domain information
>KOG0375|consensus Back     alignment and domain information
>KOG0374|consensus Back     alignment and domain information
>cd07418 MPP_PP7 PP7, metallophosphatase domain Back     alignment and domain information
>cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information
>cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain Back     alignment and domain information
>PTZ00239 serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>PTZ00480 serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>cd07414 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information
>PTZ00244 serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>cd07416 MPP_PP2B PP2B, metallophosphatase domain Back     alignment and domain information
>cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>KOG0376|consensus Back     alignment and domain information
>PRK11439 pphA serine/threonine protein phosphatase 1; Provisional Back     alignment and domain information
>PF08321 PPP5: PPP5 TPR repeat region; InterPro: IPR013235 This domain is specific to the PPP5 subfamily of serine/threonine phosphatases Back     alignment and domain information
>PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional Back     alignment and domain information
>cd07421 MPP_Rhilphs Rhilph phosphatases, metallophosphatase domain Back     alignment and domain information
>PRK09968 serine/threonine-specific protein phosphatase 2; Provisional Back     alignment and domain information
>PRK00166 apaH diadenosine tetraphosphatase; Reviewed Back     alignment and domain information
>cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00144 MPP_PPP_family phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>TIGR00668 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) Back     alignment and domain information
>cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain Back     alignment and domain information
>cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
3p71_C304 Crystal Structure Of The Complex Of Lcmt-1 And Pp2a 5e-28
2ie4_C309 Structure Of The Protein Phosphatase 2a Core Enzyme 4e-27
3fga_C309 Structural Basis Of Pp2a And Sgo Interaction Length 4e-27
3c5w_C310 Complex Between Pp2a-Specific Methylesterase Pme-1 4e-27
2ie3_C309 Structure Of The Protein Phosphatase 2a Core Enzyme 4e-27
2iae_C309 Crystal Structure Of A Protein Phosphatase 2a (Pp2a 5e-27
2nyl_C293 Crystal Structure Of Protein Phosphatase 2a (Pp2a) 2e-26
2o8a_A329 Rat Pp1cgamma Complexed With Mouse Inhibitor-2 Leng 8e-20
1jk7_A323 Crystal Structure Of The Tumor-Promoter Okadaic Aci 8e-20
3n5u_B300 Crystal Structure Of An Rb C-Terminal Peptide Bound 6e-19
1fjm_A330 Protein SerineTHREONINE PHOSPHATASE-1 (Alpha Isofor 7e-19
4g9j_A331 Protein SerTHR PHOSPHATASE-1 In Complex With Cell-P 7e-19
3v4y_A306 Crystal Structure Of The First Nuclear Pp1 Holoenzy 8e-19
3e7a_A299 Crystal Structure Of Protein Phosphatase-1 Bound To 8e-19
3egg_A329 Crystal Structure Of A Complex Between Protein Phos 8e-19
1s70_A330 Complex Between Protein Ser/thr Phosphatase-1 (delt 2e-18
1wao_1477 Pp5 Structure Length = 477 4e-17
1s95_A333 Structure Of SerineTHREONINE PROTEIN PHOSPHATASE 5 6e-17
1u32_A293 Crystal Structure Of A Protein Phosphatase-1: Calci 6e-17
3h60_A315 Catalytic Domain Of Human SerineTHREONINE PHOSPHATA 7e-17
3icf_A335 Structure Of Protein SerineTHREONINE PHOSPHATASE FR 3e-15
1aui_A 521 Human Calcineurin Heterodimer Length = 521 1e-07
1m63_A372 Crystal Structure Of Calcineurin-Cyclophilin-Cyclos 1e-07
2p6b_A383 Crystal Structure Of Human Calcineurin In Complex W 1e-07
3ll8_A357 Crystal Structure Of Calcineurin In Complex With Ak 1e-07
2jog_A327 Structure Of The Calcineurin-Nfat Complex Length = 1e-07
1tco_A375 Ternary Complex Of A Calcineurin A Fragment, Calcin 2e-07
1mf8_A373 Crystal Structure Of Human Calcineurin Complexed Wi 2e-07
>pdb|3P71|C Chain C, Crystal Structure Of The Complex Of Lcmt-1 And Pp2a Length = 304 Back     alignment and structure 
Iteration: 1

 Score =  120 bits (301), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 73/117 (62%), Gaps = 5/117 (4%)
Query: 98  GAFCDLVWSDPAEVETWTVSPRGAGWLFGAKVTHEFIHINHLKLICRAHQLVHEGYKYMF 157
           G  CDL+WSDP +   W +SPRGAG+ FG  ++  F H N L L+ RAHQLV EGY +  
Sbjct: 193 GPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCH 252
Query: 158 DGNLVTIWSAPNYCYRCGNIASILKFNSVDNRTPALFQAVPNEERVIPDRVITPYFL 214
           D N+VTI+SAPNYCYRCGN A+I++ +     +   F   P+  R  PD     YFL
Sbjct: 253 DRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPHVTRRTPD-----YFL 304
>pdb|2IE4|C Chain C, Structure Of The Protein Phosphatase 2a Core Enzyme Bound To Okadaic Acid Length = 309 Back     alignment and structure
>pdb|3FGA|C Chain C, Structural Basis Of Pp2a And Sgo Interaction Length = 309 Back     alignment and structure
>pdb|3C5W|C Chain C, Complex Between Pp2a-Specific Methylesterase Pme-1 And Pp2a Core Enzyme Length = 310 Back     alignment and structure
>pdb|2IE3|C Chain C, Structure Of The Protein Phosphatase 2a Core Enzyme Bound To Tumor- Inducing Toxins Length = 309 Back     alignment and structure
>pdb|2IAE|C Chain C, Crystal Structure Of A Protein Phosphatase 2a (Pp2a) Holoenzyme. Length = 309 Back     alignment and structure
>pdb|2NYL|C Chain C, Crystal Structure Of Protein Phosphatase 2a (Pp2a) Holoenzyme With The Catalytic Subunit Carboxyl Terminus Truncated Length = 293 Back     alignment and structure
>pdb|2O8A|A Chain A, Rat Pp1cgamma Complexed With Mouse Inhibitor-2 Length = 329 Back     alignment and structure
>pdb|1JK7|A Chain A, Crystal Structure Of The Tumor-Promoter Okadaic Acid Bound To Protein Phosphatase-1 Length = 323 Back     alignment and structure
>pdb|1FJM|A Chain A, Protein SerineTHREONINE PHOSPHATASE-1 (Alpha Isoform, Type 1) Complexed With Microcystin-Lr Toxin Length = 330 Back     alignment and structure
>pdb|4G9J|A Chain A, Protein SerTHR PHOSPHATASE-1 In Complex With Cell-Permeable Peptide Length = 331 Back     alignment and structure
>pdb|3V4Y|A Chain A, Crystal Structure Of The First Nuclear Pp1 Holoenzyme Length = 306 Back     alignment and structure
>pdb|3E7A|A Chain A, Crystal Structure Of Protein Phosphatase-1 Bound To The Natural Toxin Nodularin-R Length = 299 Back     alignment and structure
>pdb|3EGG|A Chain A, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1) And The Pp1 Binding And Pdz Domains Of Spinophilin Length = 329 Back     alignment and structure
>pdb|1S70|A Chain A, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 330 Back     alignment and structure
>pdb|1WAO|1 Chain 1, Pp5 Structure Length = 477 Back     alignment and structure
>pdb|1S95|A Chain A, Structure Of SerineTHREONINE PROTEIN PHOSPHATASE 5 Length = 333 Back     alignment and structure
>pdb|1U32|A Chain A, Crystal Structure Of A Protein Phosphatase-1: Calcineurin Hybrid Bound To Okadaic Acid Length = 293 Back     alignment and structure
>pdb|3H60|A Chain A, Catalytic Domain Of Human SerineTHREONINE PHOSPHATASE 5 (Pp5c)with Two Mn2+ Atoms Length = 315 Back     alignment and structure
>pdb|3ICF|A Chain A, Structure Of Protein SerineTHREONINE PHOSPHATASE FROM SACCHAROMYCES Cerevisiae With Similarity To Human Phosphatase Pp5 Length = 335 Back     alignment and structure
>pdb|1AUI|A Chain A, Human Calcineurin Heterodimer Length = 521 Back     alignment and structure
>pdb|1M63|A Chain A, Crystal Structure Of Calcineurin-Cyclophilin-Cyclosporin Shows Common But Distinct Recognition Of Immunophilin-Drug Complexes Length = 372 Back     alignment and structure
>pdb|2P6B|A Chain A, Crystal Structure Of Human Calcineurin In Complex With Pvivit Peptide Length = 383 Back     alignment and structure
>pdb|3LL8|A Chain A, Crystal Structure Of Calcineurin In Complex With Akap79 Peptide Length = 357 Back     alignment and structure
>pdb|2JOG|A Chain A, Structure Of The Calcineurin-Nfat Complex Length = 327 Back     alignment and structure
>pdb|1TCO|A Chain A, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 375 Back     alignment and structure
>pdb|1MF8|A Chain A, Crystal Structure Of Human Calcineurin Complexed With Cyclosporin A And Human Cyclophilin Length = 373 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
2ie4_C309 PP2A-alpha;, serine/threonine-protein phosphatase 7e-63
2ie4_C 309 PP2A-alpha;, serine/threonine-protein phosphatase 2e-15
3h63_A315 Serine/threonine-protein phosphatase 5; metalloenz 1e-54
3h63_A 315 Serine/threonine-protein phosphatase 5; metalloenz 4e-11
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 3e-53
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 2e-10
1fjm_A330 Protein serine/threonine phosphatase-1 (alpha ISO 6e-53
1fjm_A 330 Protein serine/threonine phosphatase-1 (alpha ISO 9e-12
3icf_A335 PPT, serine/threonine-protein phosphatase T; IRO m 1e-52
3icf_A 335 PPT, serine/threonine-protein phosphatase T; IRO m 4e-09
3e7a_A299 PP-1A, serine/threonine-protein phosphatase PP1-al 2e-50
3e7a_A 299 PP-1A, serine/threonine-protein phosphatase PP1-al 8e-12
1aui_A 521 Calcineurin, serine/threonine phosphatase 2B; hydr 6e-47
1aui_A 521 Calcineurin, serine/threonine phosphatase 2B; hydr 3e-12
3ll8_A357 Serine/threonine-protein phosphatase 2B catalytic 7e-47
3ll8_A 357 Serine/threonine-protein phosphatase 2B catalytic 2e-13
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Length = 309 Back     alignment and structure
 Score =  196 bits (501), Expect = 7e-63
 Identities = 55/117 (47%), Positives = 70/117 (59%)

Query: 98  GAFCDLVWSDPAEVETWTVSPRGAGWLFGAKVTHEFIHINHLKLICRAHQLVHEGYKYMF 157
           G  CDL+WSDP +   W +SPRGAG+ FG  ++  F H N L L+ RAHQLV EGY +  
Sbjct: 193 GPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCH 252

Query: 158 DGNLVTIWSAPNYCYRCGNIASILKFNSVDNRTPALFQAVPNEERVIPDRVITPYFL 214
           D N+VTI+SAPNYCYRCGN A+I++ +     +   F   P        R    YFL
Sbjct: 253 DRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL 309
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Length = 309 Back     alignment and structure
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Length = 315 Back     alignment and structure
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Length = 315 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Length = 330 Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Length = 330 Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Length = 335 Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Length = 335 Back     alignment and structure
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Length = 299 Back     alignment and structure
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Length = 299 Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Length = 521 Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Length = 521 Back     alignment and structure
>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Length = 357 Back     alignment and structure
>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Length = 357 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query214
3e7a_A299 PP-1A, serine/threonine-protein phosphatase PP1-al 100.0
3icf_A335 PPT, serine/threonine-protein phosphatase T; IRO m 100.0
3h63_A315 Serine/threonine-protein phosphatase 5; metalloenz 100.0
2ie4_C309 PP2A-alpha;, serine/threonine-protein phosphatase 100.0
3ll8_A357 Serine/threonine-protein phosphatase 2B catalytic 100.0
1fjm_A330 Protein serine/threonine phosphatase-1 (alpha ISO 100.0
1aui_A 521 Calcineurin, serine/threonine phosphatase 2B; hydr 100.0
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 100.0
2z72_A342 Protein-tyrosine-phosphatase; cold-active enzyme, 99.62
2dfj_A280 Diadenosinetetraphosphatase; helices and strands m 99.08
3e7a_A299 PP-1A, serine/threonine-protein phosphatase PP1-al 97.1
3icf_A335 PPT, serine/threonine-protein phosphatase T; IRO m 96.98
3ll8_A357 Serine/threonine-protein phosphatase 2B catalytic 96.97
3h63_A315 Serine/threonine-protein phosphatase 5; metalloenz 96.78
2z72_A 342 Protein-tyrosine-phosphatase; cold-active enzyme, 96.45
1fjm_A330 Protein serine/threonine phosphatase-1 (alpha ISO 96.35
2ie4_C309 PP2A-alpha;, serine/threonine-protein phosphatase 96.29
1aui_A 521 Calcineurin, serine/threonine phosphatase 2B; hydr 96.09
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 95.86
2qjc_A262 Diadenosine tetraphosphatase, putative; putative d 95.64
1g5b_A221 Serine/threonine protein phosphatase; bacteriophag 92.19
2qjc_A 262 Diadenosine tetraphosphatase, putative; putative d 91.23
3rqz_A246 Metallophosphoesterase; PSI-biology, midwest cente 88.16
2dfj_A 280 Diadenosinetetraphosphatase; helices and strands m 82.7
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} SCOP: d.159.1.3 PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3v4y_A* 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Back     alignment and structure
Probab=100.00  E-value=2.6e-49  Score=351.48  Aligned_cols=142  Identities=36%  Similarity=0.788  Sum_probs=134.3

Q ss_pred             chhHHHHHHHHHHHHHhcCCCccccCCCeeEeccccccc------------------cch--------------------
Q psy3331          56 VHRSLETLCDFVCSILNEESNVQHVSTPVTVCGDIHGQY------------------IYM--------------------   97 (214)
Q Consensus        56 ~~~~l~~l~~~a~~il~~ep~ll~l~~pv~vvGDiHGq~------------------LFL--------------------   97 (214)
                      +++++..||.+|+++|.+||+++++++|++|||||||||                  +||                    
T Consensus        30 ~~~~~~~l~~~~~~il~~ep~ll~~~~~i~viGDIHG~~~~L~~ll~~~g~~~~~~~vfLGD~VDrG~~s~evl~lL~~l  109 (299)
T 3e7a_A           30 TENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAY  109 (299)
T ss_dssp             CHHHHHHHHHHHHHHHHHSCSEEEECSSEEEECBCTTCHHHHHHHHHHHCSTTSSCEEECSCCSSSSSCHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHhCCCeeecCCCEEEEecCCCCHHHHHHHHHHhCCCCCccEEeCCcccCCCCCcHHHHHHHHHH
Confidence            344444999999999999999999999999999999999                  333                    


Q ss_pred             --------------------------------------------------------------------------------
Q psy3331          98 --------------------------------------------------------------------------------   97 (214)
Q Consensus        98 --------------------------------------------------------------------------------   97 (214)
                                                                                                      
T Consensus       110 k~~~p~~v~~lrGNHE~~~i~~~ygF~~e~~~ky~~~l~~~~~~~f~~LPlaaii~~~il~vHGGlsp~~~~l~~i~~i~  189 (299)
T 3e7a_A          110 KIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIM  189 (299)
T ss_dssp             HHHSTTTEEECCCTTSSHHHHHHHSHHHHHHHHSCHHHHHHHHHHHTTCCCEEEETTTEEEESSCCCTTCCCTHHHHTCC
T ss_pred             HhhCCCcEEEEecCchhhhhcccccchHHHHHHhhHHHHHHHHHHHhhCCceEEECCeEEEEcCccCcccCCHHHHHhcc
Confidence                                                                                            


Q ss_pred             --------hhhhhhhcCCCCC-CCCCccCCCCCceEeCHHHHHHHHhhcCcceEEeccccccccceEeeCCcEEEEecCC
Q psy3331          98 --------GAFCDLVWSDPAE-VETWTVSPRGAGWLFGAKVTHEFIHINHLKLICRAHQLVHEGYKYMFDGNLVTIWSAP  168 (214)
Q Consensus        98 --------gl~~DlLWSDP~~-~~g~~~s~RG~g~~FG~~~v~~Fl~~n~l~~IiRaHq~v~~Gy~~~~~~~~iTVfSA~  168 (214)
                              |+++|||||||.+ ..+|.+|+||+|++||++++++||++|++++||||||++++||+++++++|+||||||
T Consensus       190 R~~~~p~~~~~~dllWsDP~~~~~~~~~~~RG~~~~fG~~~~~~fl~~n~l~~IiR~Hq~v~~Gy~~~~~~~~iTvfSap  269 (299)
T 3e7a_A          190 RPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAP  269 (299)
T ss_dssp             SSCCCCSSSHHHHHHHCEECTTCSSEEECTTSSSEEECHHHHHHHHHHHTCSEEEECCSCCTTSEEEETTTTEEEEBCCS
T ss_pred             CCCcCCcchhhhhhhcCCccccccCcccCCCCcceeeCHHHHHHHHHHCCCeEEEEcCeeeecceEEecCCeEEEEECCc
Confidence                    7899999999995 7899999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcCCCCcEEEEEEcCCCceeeEEeecC
Q psy3331         169 NYCYRCGNIASILKFNSVDNRTPALFQAV  197 (214)
Q Consensus       169 nY~~~~~N~aAvl~i~~~~~~~f~~f~~~  197 (214)
                      |||++++|+||+|.|++++.++|++|+|.
T Consensus       270 nY~~~~~N~~a~l~~~~~~~~~~~~~~~~  298 (299)
T 3e7a_A          270 NYCGEFDNAGAMMSVDETLMCSFQILKPA  298 (299)
T ss_dssp             SGGGTCCCCEEEEEECTTCCEEEEEECCC
T ss_pred             ccCCCCCccEEEEEECCCCcEEEEEecCC
Confidence            99999999999999999999999999985
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} SCOP: d.159.1.3 PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Back     alignment and structure
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Back     alignment and structure
>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Back     alignment and structure
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Back     alignment and structure
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} SCOP: d.159.1.3 PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3v4y_A* 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Back     alignment and structure
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} SCOP: d.159.1.3 PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Back     alignment and structure
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Back     alignment and structure
>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0 Back     alignment and structure
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 214
d3c5wc1288 d.159.1.3 (C:6-293) Protein phosphatase 2A catalyt 3e-40
d3c5wc1 288 d.159.1.3 (C:6-293) Protein phosphatase 2A catalyt 6e-12
d1s95a_324 d.159.1.3 (A:) Serine/threonine protein phosphatas 3e-39
d1s95a_ 324 d.159.1.3 (A:) Serine/threonine protein phosphatas 9e-07
d1jk7a_294 d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human 4e-38
d1jk7a_ 294 d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human 6e-09
d1auia_ 473 d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calc 2e-34
d1auia_ 473 d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calc 2e-09
>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: Protein serine/threonine phosphatase
domain: Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  137 bits (345), Expect = 3e-40
 Identities = 50/99 (50%), Positives = 65/99 (65%)

Query: 100 FCDLVWSDPAEVETWTVSPRGAGWLFGAKVTHEFIHINHLKLICRAHQLVHEGYKYMFDG 159
            CDL+WSDP +   W +SPRGAG+ FG  ++  F H N L L+ RAHQLV EGY +  D 
Sbjct: 190 MCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDR 249

Query: 160 NLVTIWSAPNYCYRCGNIASILKFNSVDNRTPALFQAVP 198
           N+VTI+SAPNYCYRCGN A+I++ +     +   F   P
Sbjct: 250 NVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAP 288
>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 473 Back     information, alignment and structure
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 473 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query214
d3c5wc1288 Protein phosphatase 2A catalytic subunit alpha iso 100.0
d1jk7a_294 Protein phosphatase-1 (PP-1) {Human (Homo sapiens) 100.0
d1s95a_324 Serine/threonine protein phosphatase 5, PP5 {Human 100.0
d1auia_ 473 Protein phosphatase-2B (PP-2B, calcineurin A subun 100.0
d1s95a_324 Serine/threonine protein phosphatase 5, PP5 {Human 97.7
d3c5wc1288 Protein phosphatase 2A catalytic subunit alpha iso 97.65
d1jk7a_294 Protein phosphatase-1 (PP-1) {Human (Homo sapiens) 97.6
d1auia_ 473 Protein phosphatase-2B (PP-2B, calcineurin A subun 97.42
d1g5ba_219 lambda ser/thr protein phosphatase {Bacteriophage 95.43
d1nnwa_ 251 Hypothetical protein PF1291 {Archaeon Pyrococcus f 87.96
>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: Protein serine/threonine phosphatase
domain: Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=3.9e-50  Score=353.04  Aligned_cols=160  Identities=51%  Similarity=1.010  Sum_probs=155.0

Q ss_pred             CccHHHHHHHHHhCCCCCcccccccccccCCcchhhhhhhhhcCCCCCccccccchhHHHHHHHHHHHHHhcCCCccccC
Q psy3331           2 SHKLDEWVEIAQQCKYLPENELKSKKFVKGGTYYTALAKMKILNFPPHVKLDNIVHRSLETLCDFVCSILNEESNVQHVS   81 (214)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~e~~~~~~~~~rGnh~~~~~~~~~~~~~e~~~~~~~~~~~~l~~l~~~a~~il~~ep~ll~l~   81 (214)
                      +.|||+||+++++++.|++++|.                                     +||++|+++|.+||++++|+
T Consensus         2 ~~~~d~~i~~~~~~~~l~~~~i~-------------------------------------~L~~~a~~il~~e~~l~~i~   44 (288)
T d3c5wc1           2 TKELDQWIEQLNECKQLSESQVK-------------------------------------SLCEKAKEILTKESNVQEVR   44 (288)
T ss_dssp             HHHHHHHHHHHTTTCCCCHHHHH-------------------------------------HHHHHHHHHHHTSCSEEEEC
T ss_pred             chHHHHHHHHHHcCCCCCHHHHH-------------------------------------HHHHHHHHHHHhCCCEEEeC
Confidence            46899999999999999999999                                     99999999999999999999


Q ss_pred             CCeeEeccccccc------------------cch----------------------------------------------
Q psy3331          82 TPVTVCGDIHGQY------------------IYM----------------------------------------------   97 (214)
Q Consensus        82 ~pv~vvGDiHGq~------------------LFL----------------------------------------------   97 (214)
                      +|++|||||||||                  |||                                              
T Consensus        45 ~pv~VvGDlHG~~~DL~~if~~~g~p~~~~ylFLGDYVDRG~~slEvl~lL~alKi~~P~~v~lLRGNHE~~~~~~~~gF  124 (288)
T d3c5wc1          45 CPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGF  124 (288)
T ss_dssp             SSEEEECBCTTCHHHHHHHHHHHCCTTTSCEEECSCCCCSSSSHHHHHHHHHHHHHHCTTTEEECCCTTSSHHHHHHHSH
T ss_pred             CCeEEEeeCCCCHHHHHHHHHhcCCCccceEEecCcccCCCCcceeHHHHHHHHHhhCCCeEEEeccCCcccccccccCc
Confidence            9999999999999                  555                                              


Q ss_pred             ---------------------------------------------------------------hhhhhhhcCCCCCCCCC
Q psy3331          98 ---------------------------------------------------------------GAFCDLVWSDPAEVETW  114 (214)
Q Consensus        98 ---------------------------------------------------------------gl~~DlLWSDP~~~~g~  114 (214)
                                                                                     ++++|+|||||.+..+|
T Consensus       125 ~~E~~~ky~~~~i~~~~~~~F~~LPlaaiI~~~i~cvHGGi~~~~~~~~~i~~i~r~~~~~~~~~~~dllWsDP~~~~~~  204 (288)
T d3c5wc1         125 YDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGW  204 (288)
T ss_dssp             HHHHHHHHSSSHHHHHHHHHHTTSCSEEEETTTEEEESSCCCTTCSSHHHHHHSCCSSSCCSSSHHHHHHHCEECSSSSE
T ss_pred             chhhhhhcCcHHHHHHHHHHHhhccceEEecCeEEEecccccCCccchhhHhhcccccCCCccccccccccCCcccCCCC
Confidence                                                                           78999999999999999


Q ss_pred             ccCCCCCceEeCHHHHHHHHhhcCcceEEeccccccccceEeeCCcEEEEecCCCCCcCCCCcEEEEEEcCCCceeeEEe
Q psy3331         115 TVSPRGAGWLFGAKVTHEFIHINHLKLICRAHQLVHEGYKYMFDGNLVTIWSAPNYCYRCGNIASILKFNSVDNRTPALF  194 (214)
Q Consensus       115 ~~s~RG~g~~FG~~~v~~Fl~~n~l~~IiRaHq~v~~Gy~~~~~~~~iTVfSA~nY~~~~~N~aAvl~i~~~~~~~f~~f  194 (214)
                      .+|+||.|+.||++++++||++||+++||||||++++||++.++++|+|||||||||+.++|.||+|.|+++++++|++|
T Consensus       205 ~~~~rg~g~~fg~~~~~~Fl~~n~l~~IIR~He~~~~G~~~~~~~kviTiFSa~~Y~~~~~N~~a~l~i~~~~~~~~~~~  284 (288)
T d3c5wc1         205 GISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQF  284 (288)
T ss_dssp             EECTTSSSEEECHHHHHHHHHHTTCSEEEECCSCCTTSEEEEGGGTEEEEBCCTTGGGTSCCCEEEEEECTTCCEEEEEE
T ss_pred             ccCCCCCeeecCHHHHHHHHHHCCCcEEEcCCCcCCCCCeecCCCcEEEEecCCCccCCCCcceEEEEECCCCcEEEEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecCC
Q psy3331         195 QAVP  198 (214)
Q Consensus       195 ~~~~  198 (214)
                      +|+|
T Consensus       285 ~p~p  288 (288)
T d3c5wc1         285 DPAP  288 (288)
T ss_dssp             CCCC
T ss_pred             eCCC
Confidence            9986
>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Back     information, alignment and structure
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Back     information, alignment and structure
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure