Psyllid ID: psy3338


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--
MRRSARFCWNDLPTCKPILPEHIPLTIILLTTGRYPPGHLPICSVDPNIPDNAGYTALHYAARSNNKPICLLLISRGANVNAVTRAGQATPLHRAASAANEEIVTLLLDNGADSTLKDSDGLTALDRSRKESHEKISQILLERFSDLQTNIA
ccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccc
ccccccccccccHHHHHHHcccHHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccc
mrrsarfcwndlptckpilpehiplTIILlttgryppghlpicsvdpnipdnagytALHYAARSNNKPICLLLISrganvnavtragqatplhraaSAANEEIVTLLLDngadstlkdsdgltaldRSRKESHEKISQILLERFSDLQTNIA
mrrsarfcwndlptckpilpeHIPLTIILLTTGRYPPGHLPICSVDPNIPDNAGYTALHYAARSNNKPICLLLISRGANVNAVTRAGQATPLHRAASAANEEIVTLLLdngadstlkdsdgltaldrsrkesheKISQIllerfsdlqtnia
MRRSARFCWNDLPTCKPILPEHIPLTIILLTTGRYPPGHLPICSVDPNIPDNAGYTALHYAARSNNKPICLLLISRGANVNAVTRAGQATPLHRAASAANEEIVTLLLDNGADSTLKDSDGLTALDRSRKESHEKISQILLERFSDLQTNIA
*****RFCWNDLPTCKPILPEHIPLTIILLTTGRYPPGHLPICSVDPNIPDNAGYTALHYAARSNNKPICLLLISRGANVNAVTRAGQATPLHRAASAANEEIVTLLLD*******************************************
*RRSARFCWNDLPTCKPILPEHIPLTIILLTTGRYPPGHLPICSVDPNIPDNAGYTALHYAARSNNKPICLLLISRGANVNAVTRAGQATPLHRAASAANEEIVTLLLDNGADSTLKDSDGLTALDRSRKESHEKISQILLERFSDLQT***
MRRSARFCWNDLPTCKPILPEHIPLTIILLTTGRYPPGHLPICSVDPNIPDNAGYTALHYAARSNNKPICLLLISRGANVNAVTRAGQATPLHRAASAANEEIVTLLLDNGADSTLKDSDGLTALDRSRKESHEKISQILLERFSDLQTNIA
****ARFCWNDLPTCKPILPEHIPLTIILLTTGRYPPGHLPICSVDPNIPDNAGYTALHYAARSNNKPICLLLISRGANVNAVTRAGQATPLHRAASAANEEIVTLLLDNGADSTLKDSDGLTALDRSRKESHEKISQILLERF********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRRSARFCWNDLPTCKPILPEHIPLTIILLTTGRYPPGHLPICSVDPNIPDNAGYTALHYAARSNNKPICLLLISRGANVNAVTRAGQATPLHRAASAANEEIVTLLLDNGADSTLKDSDGLTALDRSRKESHEKISQILLERFSDLQTNIA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query152 2.2.26 [Sep-21-2011]
Q9D2X0183 Ankyrin repeat domain-con yes N/A 0.651 0.540 0.44 2e-18
Q0P5B9183 Ankyrin repeat domain-con yes N/A 0.644 0.535 0.434 2e-17
Q53RE8183 Ankyrin repeat domain-con yes N/A 0.677 0.562 0.423 6e-17
Q09701 642 Palmitoyltransferase akr1 yes N/A 0.526 0.124 0.432 8e-12
Q6B858345 Fibronectin type 3 and an no N/A 0.631 0.278 0.402 1e-11
Q01484 3957 Ankyrin-2 OS=Homo sapiens no N/A 0.651 0.025 0.4 3e-11
G5E8K5 1961 Ankyrin-3 OS=Mus musculus no N/A 0.578 0.044 0.404 3e-11
Q8C8R3 3898 Ankyrin-2 OS=Mus musculus no N/A 0.651 0.025 0.4 4e-11
Q9Z2X2231 26S proteasome non-ATPase no N/A 0.664 0.437 0.413 6e-11
P16157 1881 Ankyrin-1 OS=Homo sapiens no N/A 0.671 0.054 0.398 7e-11
>sp|Q9D2X0|ANR39_MOUSE Ankyrin repeat domain-containing protein 39 OS=Mus musculus GN=Ankrd39 PE=2 SV=1 Back     alignment and function desciption
 Score = 91.7 bits (226), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 67/100 (67%), Gaps = 1/100 (1%)

Query: 44  SVDPNIPDNAGYTALHYAARSNNKPICLLLISRGANVNAVTRAGQATPLHRAASAANEEI 103
           + DP+ PD+AGYTALHYA+R+ +  +C  L+  GA  +A T  G AT LHRA+   + EI
Sbjct: 54  ATDPSQPDSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGG-ATALHRASYCGHTEI 112

Query: 104 VTLLLDNGADSTLKDSDGLTALDRSRKESHEKISQILLER 143
             LLL +G++  L D+DG+T+L ++ ++ HE I  +LL+ 
Sbjct: 113 ARLLLSHGSNPWLVDNDGMTSLHKAAEKGHEDICSLLLQH 152





Mus musculus (taxid: 10090)
>sp|Q0P5B9|ANR39_BOVIN Ankyrin repeat domain-containing protein 39 OS=Bos taurus GN=ANKRD39 PE=2 SV=1 Back     alignment and function description
>sp|Q53RE8|ANR39_HUMAN Ankyrin repeat domain-containing protein 39 OS=Homo sapiens GN=ANKRD39 PE=1 SV=1 Back     alignment and function description
>sp|Q09701|AKR1_SCHPO Palmitoyltransferase akr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=akr1 PE=3 SV=1 Back     alignment and function description
>sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 Back     alignment and function description
>sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 Back     alignment and function description
>sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 Back     alignment and function description
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query152
156543005 296 PREDICTED: ankyrin repeat domain-contain 0.625 0.320 0.526 8e-20
189236945 286 PREDICTED: similar to p19 protein [Tribo 0.605 0.321 0.554 5e-19
163915505196 LOC100135233 protein [Xenopus (Silurana) 0.677 0.525 0.471 2e-18
148231420182 ankyrin repeat domain 39 [Xenopus laevis 0.677 0.565 0.480 3e-18
383863410 303 PREDICTED: death-associated protein kina 0.532 0.267 0.592 8e-18
387914884184 ankyrin repeat domain-containing protein 0.677 0.559 0.451 8e-18
357606649173 hypothetical protein KGM_03028 [Danaus p 0.677 0.595 0.462 1e-17
348571939183 PREDICTED: ankyrin repeat domain-contain 0.684 0.568 0.447 4e-17
414145861169 Chain A, Crystal Structure Of Engineered 0.697 0.627 0.467 9e-17
203096562183 ankyrin repeat domain 39 [Rattus norvegi 0.690 0.573 0.433 9e-17
>gi|156543005|ref|XP_001603403.1| PREDICTED: ankyrin repeat domain-containing protein 50-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  101 bits (252), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 50/95 (52%), Positives = 69/95 (72%)

Query: 47  PNIPDNAGYTALHYAARSNNKPICLLLISRGANVNAVTRAGQATPLHRAASAANEEIVTL 106
           P++ D AGYTALHYAAR+ +  +C  L+ RGANVNAVTR+G+AT LHRAA+  +  IV L
Sbjct: 161 PDVEDAAGYTALHYAARNGHDKVCKELLYRGANVNAVTRSGKATALHRAATQKHVHIVEL 220

Query: 107 LLDNGADSTLKDSDGLTALDRSRKESHEKISQILL 141
           LL   AD+ ++D+DG TAL RS     + +S++L+
Sbjct: 221 LLKANADANIQDADGFTALHRSITSDCDPVSKLLI 255




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189236945|ref|XP_967456.2| PREDICTED: similar to p19 protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|163915505|gb|AAI57354.1| LOC100135233 protein [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|148231420|ref|NP_001090329.1| ankyrin repeat domain 39 [Xenopus laevis] gi|114108177|gb|AAI23180.1| MGC154403 protein [Xenopus laevis] Back     alignment and taxonomy information
>gi|383863410|ref|XP_003707174.1| PREDICTED: death-associated protein kinase 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|387914884|gb|AFK11051.1| ankyrin repeat domain-containing protein 39-like protein [Callorhinchus milii] Back     alignment and taxonomy information
>gi|357606649|gb|EHJ65147.1| hypothetical protein KGM_03028 [Danaus plexippus] Back     alignment and taxonomy information
>gi|348571939|ref|XP_003471752.1| PREDICTED: ankyrin repeat domain-containing protein 39-like [Cavia porcellus] Back     alignment and taxonomy information
>gi|414145861|pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. gi|414145862|pdb|4HQD|B Chain B, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265 Back     alignment and taxonomy information
>gi|203096562|ref|NP_001128486.1| ankyrin repeat domain 39 [Rattus norvegicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query152
MGI|MGI:1914816183 Ankrd39 "ankyrin repeat domain 0.644 0.535 0.444 8.3e-19
UNIPROTKB|Q53RE8183 ANKRD39 "Ankyrin repeat domain 0.677 0.562 0.423 9.5e-18
UNIPROTKB|F1P1R3189 PSMD10 "Uncharacterized protei 0.592 0.476 0.450 5.6e-13
MGI|MGI:1858898231 Psmd10 "proteasome (prosome, m 0.684 0.450 0.411 7.1e-13
UNIPROTKB|E2RA22226 PSMD10 "Uncharacterized protei 0.684 0.460 0.401 1.5e-12
UNIPROTKB|O75832226 PSMD10 "26S proteasome non-ATP 0.684 0.460 0.401 1.5e-12
ZFIN|ZDB-GENE-091113-6 1923 si:ch211-263m18.3 "si:ch211-26 0.664 0.052 0.424 1.9e-12
ZFIN|ZDB-GENE-050112-1226 psmd10 "proteasome (prosome, m 0.684 0.460 0.392 2.4e-12
TAIR|locus:2063804240 AT2G03430 "AT2G03430" [Arabido 0.664 0.420 0.372 2.4e-12
RGD|620156 843 Ank2 "ankyrin 2, neuronal" [Ra 0.651 0.117 0.4 3e-12
MGI|MGI:1914816 Ankrd39 "ankyrin repeat domain 39" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 226 (84.6 bits), Expect = 8.3e-19, P = 8.3e-19
 Identities = 44/99 (44%), Positives = 67/99 (67%)

Query:    44 SVDPNIPDNAGYTALHYAARSNNKPICLLLISRGANVNAVTRAGQATPLHRAASAANEEI 103
             + DP+ PD+AGYTALHYA+R+ +  +C  L+  GA  +A T  G AT LHRA+   + EI
Sbjct:    54 ATDPSQPDSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGG-ATALHRASYCGHTEI 112

Query:   104 VTLLLDNGADSTLKDSDGLTALDRSRKESHEKISQILLE 142
               LLL +G++  L D+DG+T+L ++ ++ HE I  +LL+
Sbjct:   113 ARLLLSHGSNPWLVDNDGMTSLHKAAEKGHEDICSLLLQ 151


GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
UNIPROTKB|Q53RE8 ANKRD39 "Ankyrin repeat domain-containing protein 39" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P1R3 PSMD10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1858898 Psmd10 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 10" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RA22 PSMD10 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O75832 PSMD10 "26S proteasome non-ATPase regulatory subunit 10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-091113-6 si:ch211-263m18.3 "si:ch211-263m18.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050112-1 psmd10 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 10" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2063804 AT2G03430 "AT2G03430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|620156 Ank2 "ankyrin 2, neuronal" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query152
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 8e-27
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-24
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-18
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-16
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-13
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 7e-13
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 3e-12
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 3e-11
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-11
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 2e-10
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-10
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 6e-10
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 7e-09
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-08
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-08
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-08
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 3e-08
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 8e-08
PHA02798 489 PHA02798, PHA02798, ankyrin-like protein; Provisio 8e-08
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-07
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-07
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-07
PHA02859209 PHA02859, PHA02859, ankyrin repeat protein; Provis 2e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 3e-07
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 5e-07
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 6e-07
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 6e-07
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 8e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-06
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 4e-06
PHA02791 284 PHA02791, PHA02791, ankyrin-like protein; Provisio 4e-06
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 9e-06
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 1e-05
PHA02884 300 PHA02884, PHA02884, ankyrin repeat protein; Provis 1e-05
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 1e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-05
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 4e-05
smart0024830 smart00248, ANK, ankyrin repeats 4e-05
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 9e-05
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-04
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 1e-04
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-04
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-04
PHA02795 437 PHA02795, PHA02795, ankyrin-like protein; Provisio 2e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-04
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 5e-04
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 6e-04
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 6e-04
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 7e-04
PHA02946 446 PHA02946, PHA02946, ankyin-like protein; Provision 7e-04
PHA02798 489 PHA02798, PHA02798, ankyrin-like protein; Provisio 0.001
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 0.002
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 0.004
PHA02989 494 PHA02989, PHA02989, ankyrin repeat protein; Provis 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 97.1 bits (242), Expect = 8e-27
 Identities = 42/97 (43%), Positives = 58/97 (59%), Gaps = 1/97 (1%)

Query: 45  VDPNIPDNAGYTALHYAARSNNKPICLLLISRGANVNAVTRAGQATPLHRAASAANEEIV 104
            D N  DN G T LH AA++ +  I  LL+ +GA+VNA  + G  TPLH AA   N ++V
Sbjct: 31  ADVNAKDNDGRTPLHLAAKNGHLEIVKLLLEKGADVNARDKDGN-TPLHLAARNGNLDVV 89

Query: 105 TLLLDNGADSTLKDSDGLTALDRSRKESHEKISQILL 141
            LLL +GAD   +D DG T L  + K  H ++ ++LL
Sbjct: 90  KLLLKHGADVNARDKDGRTPLHLAAKNGHLEVVKLLL 126


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165195 PHA02859, PHA02859, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|165154 PHA02791, PHA02791, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165212 PHA02884, PHA02884, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165157 PHA02795, PHA02795, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222954 PHA02989, PHA02989, ankyrin repeat protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 152
KOG4412|consensus226 99.96
KOG4412|consensus226 99.96
PHA02791284 ankyrin-like protein; Provisional 99.93
KOG0508|consensus 615 99.93
PHA02791 284 ankyrin-like protein; Provisional 99.93
PHA02875 413 ankyrin repeat protein; Provisional 99.93
PHA02875 413 ankyrin repeat protein; Provisional 99.92
PHA02743166 Viral ankyrin protein; Provisional 99.92
KOG0509|consensus 600 99.92
PHA02878 477 ankyrin repeat protein; Provisional 99.91
PHA02884 300 ankyrin repeat protein; Provisional 99.91
PHA02878 477 ankyrin repeat protein; Provisional 99.91
PHA02859209 ankyrin repeat protein; Provisional 99.91
PHA03100 480 ankyrin repeat protein; Provisional 99.91
PHA02741169 hypothetical protein; Provisional 99.91
PHA02874 434 ankyrin repeat protein; Provisional 99.91
PHA02874 434 ankyrin repeat protein; Provisional 99.91
PHA02859209 ankyrin repeat protein; Provisional 99.9
KOG0509|consensus 600 99.9
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.9
PHA03100 480 ankyrin repeat protein; Provisional 99.9
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.89
PHA03095 471 ankyrin-like protein; Provisional 99.89
PHA02946 446 ankyin-like protein; Provisional 99.89
PHA03095 471 ankyrin-like protein; Provisional 99.89
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.89
PHA02876 682 ankyrin repeat protein; Provisional 99.88
KOG0508|consensus 615 99.88
PHA02736154 Viral ankyrin protein; Provisional 99.88
PHA02798 489 ankyrin-like protein; Provisional 99.88
PHA02989 494 ankyrin repeat protein; Provisional 99.88
PHA02798 489 ankyrin-like protein; Provisional 99.88
PHA02795 437 ankyrin-like protein; Provisional 99.88
KOG0510|consensus 929 99.88
KOG0502|consensus296 99.87
PHA02989 494 ankyrin repeat protein; Provisional 99.87
PHA02946 446 ankyin-like protein; Provisional 99.87
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.86
PHA02917 661 ankyrin-like protein; Provisional 99.86
PHA02876 682 ankyrin repeat protein; Provisional 99.86
KOG0512|consensus228 99.85
PHA02795 437 ankyrin-like protein; Provisional 99.84
KOG4177|consensus 1143 99.84
PHA02917 661 ankyrin-like protein; Provisional 99.83
PHA02730 672 ankyrin-like protein; Provisional 99.83
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.83
KOG0195|consensus 448 99.82
KOG0502|consensus296 99.82
PHA02730 672 ankyrin-like protein; Provisional 99.81
KOG4177|consensus 1143 99.81
KOG0514|consensus452 99.81
KOG0195|consensus 448 99.8
KOG0510|consensus 929 99.8
PHA02741169 hypothetical protein; Provisional 99.8
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.8
PHA02743166 Viral ankyrin protein; Provisional 99.78
PHA02792 631 ankyrin-like protein; Provisional 99.78
KOG0512|consensus228 99.78
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.77
KOG4214|consensus117 99.77
PHA02792 631 ankyrin-like protein; Provisional 99.76
PHA02884 300 ankyrin repeat protein; Provisional 99.76
KOG0514|consensus452 99.75
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.74
KOG0505|consensus 527 99.73
KOG3676|consensus 782 99.7
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.7
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.69
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.69
PHA02736154 Viral ankyrin protein; Provisional 99.68
KOG4214|consensus117 99.68
KOG0507|consensus 854 99.67
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.66
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.63
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.63
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.61
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.6
KOG1710|consensus 396 99.59
KOG0505|consensus 527 99.58
KOG0515|consensus752 99.57
KOG0507|consensus 854 99.57
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.57
KOG0515|consensus 752 99.48
KOG4369|consensus 2131 99.46
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.46
KOG3676|consensus 782 99.36
KOG0818|consensus 669 99.32
KOG4369|consensus 2131 99.3
KOG0783|consensus 1267 99.2
KOG1710|consensus 396 99.18
KOG0506|consensus622 99.16
PF1360630 Ank_3: Ankyrin repeat 99.07
KOG0506|consensus622 99.05
PF1360630 Ank_3: Ankyrin repeat 99.02
KOG0782|consensus1004 99.02
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.99
KOG0818|consensus 669 98.94
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.83
KOG0705|consensus749 98.83
KOG0705|consensus749 98.82
KOG0522|consensus 560 98.77
KOG0522|consensus 560 98.72
KOG2384|consensus 223 98.7
KOG0511|consensus 516 98.7
KOG0782|consensus1004 98.67
KOG0511|consensus 516 98.64
KOG3609|consensus 822 98.58
KOG0521|consensus785 98.57
KOG0783|consensus 1267 98.54
KOG2384|consensus 223 98.32
KOG0520|consensus 975 98.16
KOG0521|consensus785 98.02
KOG0520|consensus 975 97.71
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.57
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.55
KOG2505|consensus591 97.54
KOG2505|consensus591 97.53
KOG3609|consensus 822 97.32
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.89
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 93.91
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 93.19
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 91.59
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 89.31
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 81.41
>KOG4412|consensus Back     alignment and domain information
Probab=99.96  E-value=1.2e-29  Score=154.25  Aligned_cols=126  Identities=36%  Similarity=0.447  Sum_probs=69.7

Q ss_pred             CChhHHHHHHHcCCCC-CCCcC-CCCCCCCCCCCCCccHHHHHHHcCCHHHHHHHHhc-CCCCCccccCCCcCHHHHHHH
Q psy3338          21 EHIPLTIILLTTGRYP-PGHLP-ICSVDPNIPDNAGYTALHYAARSNNKPICLLLISR-GANVNAVTRAGQATPLHRAAS   97 (152)
Q Consensus        21 ~~~~~~~~a~~~g~~~-v~~Ll-~~~~~~~~~~~~g~~~L~~a~~~g~~~~~~~L~~~-~~~~~~~~~~~~~~~l~~a~~   97 (152)
                      +.+|+ |+|+..|+.+ +++|+ +.+..+|.+|..|+||||+|+..|+.++++-|+.+ |++++...+.| .|+||+|+.
T Consensus        38 ~Rt~L-Hwa~S~g~~eiv~fLlsq~nv~~ddkDdaGWtPlhia~s~g~~evVk~Ll~r~~advna~tn~G-~T~LHyAag  115 (226)
T KOG4412|consen   38 GRTPL-HWACSFGHVEIVYFLLSQPNVKPDDKDDAGWTPLHIAASNGNDEVVKELLNRSGADVNATTNGG-QTCLHYAAG  115 (226)
T ss_pred             CCcee-eeeeecCchhHHHHHHhcCCCCCCCccccCCchhhhhhhcCcHHHHHHHhcCCCCCcceecCCC-cceehhhhc
Confidence            44444 3455555555 55555 34555555555555555555555555555555555 55555555444 555555555


Q ss_pred             cCCHHHHHHHHhcCCCCCccCCCCCcHHHHHHhcCcHHHHHHHHHhCCccc
Q psy3338          98 AANEEIVTLLLDNGADSTLKDSDGLTALDRSRKESHEKISQILLERFSDLQ  148 (152)
Q Consensus        98 ~~~~~~~~~Ll~~g~~~~~~~~~~~~~l~~a~~~~~~~i~~~L~~~~~~~~  148 (152)
                      .|+.++.++|++.|+.+..+|..|+||||.|+..|..+++++|+..|+.++
T Consensus       116 K~r~eIaqlLle~ga~i~~kD~~~qtplHRAAavGklkvie~Li~~~a~~n  166 (226)
T KOG4412|consen  116 KGRLEIAQLLLEKGALIRIKDKQGQTPLHRAAAVGKLKVIEYLISQGAPLN  166 (226)
T ss_pred             CChhhHHHHHHhcCCCCcccccccCchhHHHHhccchhhHHHHHhcCCCCC
Confidence            555555555555555555555555555555555555555555555555544



>KOG4412|consensus Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query152
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 1e-19
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 1e-17
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 3e-17
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 2e-15
2xeh_A157 Structural Determinants For Improved Thermal Stabil 5e-15
2xee_A157 Structural Determinants For Improved Thermal Stabil 9e-15
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 1e-14
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-14
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 1e-13
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 3e-13
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-13
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-13
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 5e-13
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 6e-13
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 1e-12
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 3e-12
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 5e-12
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 6e-12
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 6e-12
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 6e-12
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 6e-12
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 6e-12
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 7e-12
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 8e-12
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 8e-12
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 1e-11
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-11
1uoh_A226 Human Gankyrin Length = 226 2e-11
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 2e-11
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 2e-11
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 3e-11
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 4e-11
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 4e-11
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 7e-11
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 4e-10
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 4e-10
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 4e-10
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 5e-10
1ycs_B239 P53-53bp2 Complex Length = 239 3e-09
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 3e-09
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 3e-09
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 1e-08
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 4e-08
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 5e-08
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 6e-08
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 6e-08
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 7e-08
3utm_A 351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 1e-07
2xen_A91 Structural Determinants For Improved Thermal Stabil 2e-07
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 3e-07
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 4e-07
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 5e-07
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 5e-07
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 6e-07
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 6e-07
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 7e-07
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 8e-07
2vge_A229 Crystal Structure Of The C-Terminal Region Of Human 1e-06
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 2e-06
3deo_A183 Structural Basis For Specific Substrate Recognition 4e-06
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 4e-06
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 4e-06
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 4e-06
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 4e-06
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 4e-06
3ui2_A244 Crystal Structure Of The Cpsrp54 Tail Bound To Cpsr 5e-06
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 6e-06
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 8e-06
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 1e-05
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 1e-05
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 2e-05
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 3e-05
1s70_B 299 Complex Between Protein Ser/thr Phosphatase-1 (delt 4e-05
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 5e-05
3so8_A162 Crystal Structure Of Ankra Length = 162 5e-05
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 5e-05
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 6e-05
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 9e-05
2rfa_A232 Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat 9e-05
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 1e-04
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 1e-04
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 1e-04
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 1e-04
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 2e-04
4f1p_A368 Crystal Structure Of Mutant S554d For Arfgap And An 2e-04
3jue_A368 Crystal Structure Of Arfgap And Ank Repeat Domain O 2e-04
3t9k_A390 Crystal Structure Of Acap1 C-portion Mutant S554d F 2e-04
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 3e-04
3uxg_A172 Crystal Structure Of Rfxank Length = 172 3e-04
3kea_A 285 Structure Function Studies Of Vaccinia Virus Host-R 3e-04
1dcq_A278 Crystal Structure Of The Arf-Gap Domain And Ankyrin 5e-04
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure

Iteration: 1

Score = 91.7 bits (226), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 50/107 (46%), Positives = 69/107 (64%), Gaps = 1/107 (0%) Query: 44 SVDPNIPDNAGYTALHYAARSNNKPICLLLISRGANVNAVTRAGQATPLHRAASAANEEI 103 D N D+ G T LHYAA+ +K I LLIS+GA+VNA G+ TPLH AA ++EI Sbjct: 27 GADVNASDSDGRTPLHYAAKEGHKEIVKLLISKGADVNAKDSDGR-TPLHYAAKEGHKEI 85 Query: 104 VTLLLDNGADSTLKDSDGLTALDRSRKESHEKISQILLERFSDLQTN 150 V LL+ GAD KDSDG T L + KE H++I ++L+ + +D+ T+ Sbjct: 86 VKLLISKGADVNAKDSDGRTPLHYAAKEGHKEIVKLLISKGADVNTS 132
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|2VGE|A Chain A, Crystal Structure Of The C-Terminal Region Of Human Iaspp Length = 229 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|3DEO|A Chain A, Structural Basis For Specific Substrate Recognition By The Chloroplast Signal Recognition Particle Protein Cpsrp43 Length = 183 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|3UI2|A Chain A, Crystal Structure Of The Cpsrp54 Tail Bound To Cpsrp43 Length = 244 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|2RFA|A Chain A, Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat Domain Length = 232 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|4F1P|A Chain A, Crystal Structure Of Mutant S554d For Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|3JUE|A Chain A, Crystal Structure Of Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|3T9K|A Chain A, Crystal Structure Of Acap1 C-portion Mutant S554d Fused With Integrin Beta1 Peptide Length = 390 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|3KEA|A Chain A, Structure Function Studies Of Vaccinia Virus Host-Range Protein K1 Reveal A Novel Ankyrin Repeat Interaction Surface For K1s Function Length = 285 Back     alignment and structure
>pdb|1DCQ|A Chain A, Crystal Structure Of The Arf-Gap Domain And Ankyrin Repeats Of Papbeta Length = 278 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query152
3deo_A183 Signal recognition particle 43 kDa protein; chloro 8e-32
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-21
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-20
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-11
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-31
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-29
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-25
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-23
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-31
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 7e-28
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-22
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-08
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 6e-31
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 8e-19
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 6e-15
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-08
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-30
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 7e-28
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-26
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-24
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-21
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 2e-15
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-09
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-30
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-27
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-25
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-22
3v30_A 172 DNA-binding protein rfxank; structural genomics co 4e-09
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-30
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-27
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-23
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-23
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-11
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-29
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-26
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-23
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-29
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-27
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-26
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-19
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 9e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-29
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-28
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-28
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-28
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-27
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-27
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-26
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-23
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-15
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 5e-29
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-25
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 9e-17
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 6e-29
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-26
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-21
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-29
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-27
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-24
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-11
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-29
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-23
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-23
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 5e-14
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-29
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-27
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-26
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-24
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-22
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-20
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-09
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-28
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 5e-28
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-26
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-24
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-21
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-28
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 9e-28
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-21
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-28
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-24
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 1e-28
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-27
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 2e-21
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 2e-21
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-19
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-19
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 4e-19
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-28
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-26
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-22
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-20
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-28
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-28
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-25
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 9e-24
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-20
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-08
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-28
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-26
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-24
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-24
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-28
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-26
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-24
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-20
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-07
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-28
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-27
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-24
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-23
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-20
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-18
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-28
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-27
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-26
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-25
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-25
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-21
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-19
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-09
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-28
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-25
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-23
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-18
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-18
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-28
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-26
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-21
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-27
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-26
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-14
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-27
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-26
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-20
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-19
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-15
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-27
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 5e-25
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-23
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-14
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 5e-14
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 8e-10
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-27
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-24
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-24
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-15
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-27
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-26
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-26
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-25
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-21
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-09
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 8e-27
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-26
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-26
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 8e-25
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-23
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-19
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-26
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-25
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-24
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-22
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-17
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 7e-16
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-08
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-26
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-24
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-24
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 2e-21
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-16
2rfa_A232 Transient receptor potential cation channel subfa 2e-26
2rfa_A232 Transient receptor potential cation channel subfa 1e-22
2rfa_A 232 Transient receptor potential cation channel subfa 1e-21
2rfa_A232 Transient receptor potential cation channel subfa 2e-21
2rfa_A232 Transient receptor potential cation channel subfa 8e-20
2rfa_A232 Transient receptor potential cation channel subfa 2e-10
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-26
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-26
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-24
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 5e-26
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 8e-26
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-24
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-24
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-24
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-23
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 3e-16
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-12
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 7e-26
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-18
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-15
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 7e-26
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-21
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-25
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-22
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-21
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-21
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-20
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-19
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-17
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-07
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-25
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-24
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-24
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-23
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-23
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-22
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-21
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-10
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-25
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 2e-22
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-21
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 8e-18
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-15
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-12
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-04
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-24
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-20
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-19
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-15
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-22
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-17
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-11
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-11
3jxi_A 260 Vanilloid receptor-related osmotically activated p 2e-09
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-08
2pnn_A273 Transient receptor potential cation channel subfa 9e-22
2pnn_A273 Transient receptor potential cation channel subfa 4e-17
2pnn_A273 Transient receptor potential cation channel subfa 3e-12
2pnn_A 273 Transient receptor potential cation channel subfa 1e-11
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-20
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 4e-16
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-14
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-13
1sw6_A327 Regulatory protein SWI6; transcription regulation, 9e-12
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 4e-06
2etb_A256 Transient receptor potential cation channel subfam 4e-20
2etb_A256 Transient receptor potential cation channel subfam 2e-18
2etb_A256 Transient receptor potential cation channel subfam 5e-14
2etb_A256 Transient receptor potential cation channel subfam 1e-11
2etb_A256 Transient receptor potential cation channel subfam 2e-08
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-18
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-09
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 4e-18
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-06
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-17
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 5e-15
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 4e-09
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 6e-08
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-13
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-11
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-09
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-09
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-08
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-06
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
 Score =  111 bits (279), Expect = 8e-32
 Identities = 30/97 (30%), Positives = 46/97 (47%)

Query: 46  DPNIPDNAGYTALHYAARSNNKPICLLLISRGANVNAVTRAGQATPLHRAASAANEEIVT 105
           D +  D  G TAL + A   +     LL   GA+++     G  T LH AA     E+V 
Sbjct: 68  DVDAVDENGRTALLFVAGLGSDKCVRLLAEAGADLDHRDMRGGLTALHMAAGYVRPEVVE 127

Query: 106 LLLDNGADSTLKDSDGLTALDRSRKESHEKISQILLE 142
            L++ GAD  ++D  GLTAL+ +R+          ++
Sbjct: 128 ALVELGADIEVEDERGLTALELAREILKTTPKGNPMQ 164


>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query152
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.97
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.96
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.96
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.96
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.96
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.95
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.95
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.95
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.95
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.95
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.95
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.94
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.94
2rfa_A232 Transient receptor potential cation channel subfa 99.94
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.94
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.94
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.94
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.94
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.94
3hra_A201 Ankyrin repeat family protein; structural protein; 99.94
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.94
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.94
2etb_A256 Transient receptor potential cation channel subfam 99.94
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.94
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.94
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.94
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.94
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.94
2rfa_A232 Transient receptor potential cation channel subfa 99.94
2pnn_A273 Transient receptor potential cation channel subfa 99.94
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.94
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.94
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.94
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.94
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.94
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.94
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.94
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.94
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.94
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.93
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.93
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.93
2etb_A256 Transient receptor potential cation channel subfam 99.93
3hra_A201 Ankyrin repeat family protein; structural protein; 99.93
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.93
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.93
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.93
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.93
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.93
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.93
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.93
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.93
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.93
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.93
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.93
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.93
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.93
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.93
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.93
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.93
2pnn_A273 Transient receptor potential cation channel subfa 99.93
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.92
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.92
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.92
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.92
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.92
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.92
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.92
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.92
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.92
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.91
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.91
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.91
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.91
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.91
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.9
4g8k_A 337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.9
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.89
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.89
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.89
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.89
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.88
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.88
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.87
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.87
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.86
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.86
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.86
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.85
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.84
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 99.84
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.8
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.8
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.79
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.79
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.77
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=100.00  E-value=3.4e-33  Score=174.55  Aligned_cols=137  Identities=35%  Similarity=0.433  Sum_probs=121.1

Q ss_pred             CCCCccccCCCChhHHHHHHHcCCCC-CCCcCCCCCCCCCCCCCCccHHHHHHHcCCHHHHHHHHhcCCCCCccccCCCc
Q psy3338          11 DLPTCKPILPEHIPLTIILLTTGRYP-PGHLPICSVDPNIPDNAGYTALHYAARSNNKPICLLLISRGANVNAVTRAGQA   89 (152)
Q Consensus        11 ~~~~~~~~~~~~~~~~~~a~~~g~~~-v~~Ll~~~~~~~~~~~~g~~~L~~a~~~g~~~~~~~L~~~~~~~~~~~~~~~~   89 (152)
                      +.........|.||+ ++|+..++.+ +++|++.|++++.+|..|.||||+|+..|+.+++++|+++|++++.++..+ +
T Consensus        27 Gadvn~~d~~g~t~l-~~a~~~~~~~~~~~ll~~gad~~~~d~~g~TpLh~A~~~g~~~~v~~Ll~~gadvn~~d~~G-~  104 (169)
T 4gpm_A           27 GADVNASDSDGRTPL-HHAAENGHKEVVKLLISKGADVNAKDSDGRTPLHHAAENGHKEVVKLLISKGADVNAKDSDG-R  104 (169)
T ss_dssp             TCCTTCCCTTSCCHH-HHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTS-C
T ss_pred             CCCCCCcCCCCCCHH-HHHHHcCCHHHHHHHHhcccchhhhccCCCCHHHHHHHcCCHHHHHHHHHCcCCCCCCCCCC-C
Confidence            344445566788887 5688999999 999999999999999999999999999999999999999999999999888 8


Q ss_pred             CHHHHHHHcCCHHHHHHHHhcCCCCCccCCCCCcHHHHHHhcCcHHHHHHHHHhCCcccc
Q psy3338          90 TPLHRAASAANEEIVTLLLDNGADSTLKDSDGLTALDRSRKESHEKISQILLERFSDLQT  149 (152)
Q Consensus        90 ~~l~~a~~~~~~~~~~~Ll~~g~~~~~~~~~~~~~l~~a~~~~~~~i~~~L~~~~~~~~~  149 (152)
                      ||||+|+..|+.+++++|++.|++++.++..|.|||++|+..|+.+++++|+++|++++-
T Consensus       105 TpLh~A~~~g~~~~v~~Ll~~gad~~~~d~~G~TpL~~A~~~g~~~iv~~Ll~~GA~ie~  164 (169)
T 4gpm_A          105 TPLHHAAENGHKEVVKLLISKGADVNTSDSDGRTPLDLAREHGNEEVVKLLEKQGGWLEH  164 (169)
T ss_dssp             CHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHTC------
T ss_pred             CHHHHHHHcCCHHHHHHHHHcCCCccccCCCCCCHHHHHHHcCCHHHHHHHHHCCCCcCC
Confidence            999999999999999999999999999999999999999999999999999999999874



>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 152
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-22
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-17
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-17
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-16
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-15
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-13
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-12
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-11
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-18
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-07
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-05
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-17
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-15
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-14
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 8e-11
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-10
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-16
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 9e-13
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-06
d1uoha_ 223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.003
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 9e-15
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 8e-06
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.004
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-13
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 6e-12
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-07
d1sw6a_ 301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 7e-07
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 5e-13
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-12
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-08
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-07
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 0.002
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 6e-13
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-09
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-08
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-12
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-10
d1ot8a_ 209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-06
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.002
d1ot8a_ 209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.004
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-12
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-11
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-08
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.002
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 7e-11
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-10
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-08
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 7e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 9e-10
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-09
d1iknd_ 221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-08
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 8e-06
d1iknd_ 221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 4e-07
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-04
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 1e-06
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 0.002
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 4e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 6e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 5e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 4e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.001
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 88.9 bits (219), Expect = 3e-22
 Identities = 31/93 (33%), Positives = 45/93 (48%), Gaps = 1/93 (1%)

Query: 56  TALHYAARSNNKPICLLLISRGANVNAVTRAGQATPLHRAASAANEEIVTLLLDNGADST 115
           T LH A+   + PI   L+ RGA+ N      + TPLH AA A + E+   LL N A   
Sbjct: 2   TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVE-TPLHMAARAGHTEVAKYLLQNKAKVN 60

Query: 116 LKDSDGLTALDRSRKESHEKISQILLERFSDLQ 148
            K  D  T L  + +  H  + ++LLE  ++  
Sbjct: 61  AKAKDDQTPLHCAARIGHTNMVKLLLENNANPN 93


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query152
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.96
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.95
d2fo1e1 277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.94
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.94
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.94
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.93
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.93
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.93
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.92
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.92
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.92
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.91
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.91
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.9
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.9
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.9
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.89
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.89
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.89
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.88
d2fo1e1 277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.88
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.87
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.87
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.84
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.83
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.83
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.83
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.78
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.77
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.76
d1s70b_ 291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.73
d1wdya_ 285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.69
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.57
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Cell cycle inhibitor p16ink4A
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96  E-value=2.6e-30  Score=152.66  Aligned_cols=121  Identities=22%  Similarity=0.299  Sum_probs=111.1

Q ss_pred             CCChhHHHHHHHcCCCC-CCCcCCCCCCCCCCCCCCccHHHHHHHcCCHHHHHHHHhcCCCCCccccCCCcCHHHHHHHc
Q psy3338          20 PEHIPLTIILLTTGRYP-PGHLPICSVDPNIPDNAGYTALHYAARSNNKPICLLLISRGANVNAVTRAGQATPLHRAASA   98 (152)
Q Consensus        20 ~~~~~~~~~a~~~g~~~-v~~Ll~~~~~~~~~~~~g~~~L~~a~~~g~~~~~~~L~~~~~~~~~~~~~~~~~~l~~a~~~   98 (152)
                      |+.+++ +.|+..|+++ +++|+++|+|++.++..|.||+|+|+ .|+.+++++|+++|++++..+..++.+|+|+|++.
T Consensus         2 p~~~~L-~~Aa~~G~~~~v~~Ll~~gad~n~~~~~g~t~l~~a~-~g~~~~v~~Ll~~ga~~~~~~~~~~~~~L~~A~~~   79 (125)
T d1bi7b_           2 PSADWL-ATAAARGRVEEVRALLEAGANPNAPNSYGRRPIQVMM-MGSARVAELLLLHGAEPNCADPATLTRPVHDAARE   79 (125)
T ss_dssp             CSTTHH-HHHHHHTCHHHHHHHHTTTCCTTCCCSSSCCTTTSSC-TTCHHHHHHHHTTTCCCCCCCTTTCCCHHHHHHHH
T ss_pred             CChhHH-HHHHHCCCHHHHHHHHHcCCccccccccccccccccc-ccccccccccccccccccccccccccccccccccc
Confidence            344444 7799999999 99999999999999999999999775 79999999999999999988887745799999999


Q ss_pred             CCHHHHHHHHhcCCCCCccCCCCCcHHHHHHhcCcHHHHHHHHH
Q psy3338          99 ANEEIVTLLLDNGADSTLKDSDGLTALDRSRKESHEKISQILLE  142 (152)
Q Consensus        99 ~~~~~~~~Ll~~g~~~~~~~~~~~~~l~~a~~~~~~~i~~~L~~  142 (152)
                      |+.+++++|++.|++++.+|..|+||+++|++.|+.+++++|++
T Consensus        80 g~~~~v~~Ll~~ga~~~~~d~~G~T~l~~A~~~g~~~~v~~Lls  123 (125)
T d1bi7b_          80 GFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRA  123 (125)
T ss_dssp             TCHHHHHHHHHHTCCSSCCCTTCCCHHHHHHHHTCHHHHHHHSS
T ss_pred             ccccccccccccccccccccCCCCCHHHHHHHcCCHHHHHHHHh
Confidence            99999999999999999999999999999999999999999974



>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure