Psyllid ID: psy3351
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 276 | ||||||
| 206114237 | 823 | transferrin 2 [Aedes aegypti] | 0.710 | 0.238 | 0.466 | 2e-63 | |
| 170027798 | 820 | lactotransferrin [Culex quinquefasciatus | 0.710 | 0.239 | 0.470 | 2e-63 | |
| 157130994 | 806 | transferrin [Aedes aegypti] gi|108871702 | 0.710 | 0.243 | 0.463 | 1e-62 | |
| 157130996 | 784 | transferrin [Aedes aegypti] gi|108871703 | 0.710 | 0.25 | 0.463 | 1e-62 | |
| 332018468 | 876 | Melanotransferrin [Acromyrmex echinatior | 0.713 | 0.224 | 0.482 | 7e-58 | |
| 321464063 | 787 | hypothetical protein DAPPUDRAFT_306921 [ | 0.771 | 0.270 | 0.423 | 6e-57 | |
| 383856018 | 825 | PREDICTED: melanotransferrin-like [Megac | 0.717 | 0.24 | 0.461 | 7e-57 | |
| 345491749 | 832 | PREDICTED: melanotransferrin [Nasonia vi | 0.253 | 0.084 | 0.692 | 1e-55 | |
| 307203800 | 902 | Ovotransferrin [Harpegnathos saltator] | 0.467 | 0.143 | 0.703 | 6e-55 | |
| 350414165 | 823 | PREDICTED: melanotransferrin-like [Bombu | 0.467 | 0.156 | 0.688 | 4e-53 |
| >gi|206114237|gb|ACI05249.1| transferrin 2 [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Score = 248 bits (634), Expect = 2e-63, Method: Compositional matrix adjust.
Identities = 120/257 (46%), Positives = 159/257 (61%), Gaps = 61/257 (23%)
Query: 1 MKKNSLPDLTHISHLRGKKACFAGVGTQAGWVIPVDVLIRNGGMEVIDCNNHVKSVINYF 60
+KK+SL ++T + HL+GKKACF+ VG+ AGW++P+ L R GGME+ DCNNHVK+ +YF
Sbjct: 126 IKKDSLREVTSLRHLKGKKACFSWVGSYAGWIVPIYTLQREGGMEITDCNNHVKTATDYF 185
Query: 61 GPSCAVNALINKYNPIGDNSDRLCELCIGRVPGEKCTTADPYAGFEGAFRCLVDKGEVAF 120
GPSCAVNAL++KYNPIGDNSD+LC LC G+VPG KCT +DPYAGFEGAF+CL++ G+VAF
Sbjct: 186 GPSCAVNALVDKYNPIGDNSDKLCSLCTGKVPGGKCTPSDPYAGFEGAFQCLLEAGDVAF 245
Query: 121 LKHTTVQEMIEGRIDACKYSFLGKELKMSFFYFLLLQYSGGLIEGTGAFRCLVDKGEVAF 180
LKHTTV EM+E GL+ G
Sbjct: 246 LKHTTVNEMVE----------------------------SGLVHG--------------- 262
Query: 181 LKHTTVQEMIEGRIDAYGLTKENFELLCTDGTRQPVDNYQSCNWGQVPSNAVMTTSAKST 240
+T + FELLC DG+RQPV Y+ C+WG S+A++ +SA+ST
Sbjct: 263 ------------------VTADQFELLCKDGSRQPVSEYRQCHWGLAQSHAMVVSSARST 304
Query: 241 QIRRYYQQFLIKTVQLF 257
RR Y++F + V L+
Sbjct: 305 AERRRYKKFFTQVVNLY 321
|
Source: Aedes aegypti Species: Aedes aegypti Genus: Aedes Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|170027798|ref|XP_001841784.1| lactotransferrin [Culex quinquefasciatus] gi|167862354|gb|EDS25737.1| lactotransferrin [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|157130994|ref|XP_001662114.1| transferrin [Aedes aegypti] gi|108871702|gb|EAT35927.1| AAEL011949-PB [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|157130996|ref|XP_001662115.1| transferrin [Aedes aegypti] gi|108871703|gb|EAT35928.1| AAEL011949-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|332018468|gb|EGI59058.1| Melanotransferrin [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|321464063|gb|EFX75074.1| hypothetical protein DAPPUDRAFT_306921 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|383856018|ref|XP_003703507.1| PREDICTED: melanotransferrin-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|345491749|ref|XP_001601375.2| PREDICTED: melanotransferrin [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|307203800|gb|EFN82736.1| Ovotransferrin [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|350414165|ref|XP_003490226.1| PREDICTED: melanotransferrin-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 276 | ||||||
| FB|FBgn0036299 | 819 | Tsf2 "Transferrin 2" [Drosophi | 0.474 | 0.159 | 0.580 | 3.6e-61 | |
| MGI|MGI:98821 | 697 | Trf "transferrin" [Mus musculu | 0.326 | 0.129 | 0.453 | 5.8e-35 | |
| UNIPROTKB|J3KN47 | 571 | TF "Serotransferrin" [Homo sap | 0.413 | 0.199 | 0.377 | 9.1e-35 | |
| UNIPROTKB|P02789 | 705 | P02789 "Ovotransferrin" [Gallu | 0.387 | 0.151 | 0.4 | 1.2e-34 | |
| UNIPROTKB|P02787 | 698 | TF "Serotransferrin" [Homo sap | 0.413 | 0.163 | 0.377 | 1.9e-34 | |
| UNIPROTKB|G3X6N3 | 704 | TF "Serotransferrin" [Bos taur | 0.427 | 0.167 | 0.352 | 1.3e-32 | |
| UNIPROTKB|Q29443 | 704 | TF "Serotransferrin" [Bos taur | 0.427 | 0.167 | 0.352 | 1.6e-32 | |
| RGD|3845 | 698 | Tf "transferrin" [Rattus norve | 0.420 | 0.166 | 0.360 | 2.5e-32 | |
| UNIPROTKB|F1SQX4 | 736 | MFI2 "Uncharacterized protein" | 0.449 | 0.168 | 0.411 | 1.4e-17 | |
| MGI|MGI:1919025 | 700 | 1300017J02Rik "RIKEN cDNA 1300 | 0.322 | 0.127 | 0.468 | 5.2e-32 |
| FB|FBgn0036299 Tsf2 "Transferrin 2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 462 (167.7 bits), Expect = 3.6e-61, Sum P(2) = 3.6e-61
Identities = 76/131 (58%), Positives = 106/131 (80%)
Query: 1 MKKNSLPDLTHISHLRGKKACFAGVGTQAGWVIPVDVLIRNGGMEVIDCNNHVKSVINYF 60
+KK SLPDL ++ +R K+ CF VG+ AGW++P+ L R GGMEV+DCNN VK+ +YF
Sbjct: 127 IKKGSLPDLNNLRDMRNKRVCFPWVGSLAGWIVPIHTLQREGGMEVVDCNNQVKTAASYF 186
Query: 61 GPSCAVNALINKYNPIGDNSDRLCELCIGRVPGEKCTTADPYAGFEGAFRCLVDKGEVAF 120
SCAV +L +K+NPIGDNSD+LC LC G++PG +C++ADPY G+EGAF+CL++KG+VAF
Sbjct: 187 NNSCAVYSLSDKHNPIGDNSDKLCTLCTGKIPGGRCSSADPYFGYEGAFKCLLEKGDVAF 246
Query: 121 LKHTTVQEMIE 131
L+H+TV EM++
Sbjct: 247 LRHSTVNEMLQ 257
|
|
| MGI|MGI:98821 Trf "transferrin" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3KN47 TF "Serotransferrin" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P02789 P02789 "Ovotransferrin" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P02787 TF "Serotransferrin" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3X6N3 TF "Serotransferrin" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q29443 TF "Serotransferrin" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|3845 Tf "transferrin" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SQX4 MFI2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919025 1300017J02Rik "RIKEN cDNA 1300017J02 gene" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 276 | |||
| smart00094 | 332 | smart00094, TR_FER, Transferrin | 3e-40 | |
| pfam00405 | 328 | pfam00405, Transferrin, Transferrin | 1e-21 | |
| pfam00405 | 328 | pfam00405, Transferrin, Transferrin | 3e-21 |
| >gnl|CDD|214514 smart00094, TR_FER, Transferrin | Back alignment and domain information |
|---|
Score = 141 bits (358), Expect = 3e-40
Identities = 78/280 (27%), Positives = 110/280 (39%), Gaps = 81/280 (28%)
Query: 3 KNSLPDLTHISHLRGKKACFAGVGTQAGWVIPVDVLIRNGGMEVIDCNNHVKSVINYFGP 62
K T + LRGKK+C GVG AGW IP+ +L + +C K+V +F
Sbjct: 93 KKGSAIFT-WNQLRGKKSCHTGVGRTAGWNIPMGLLYNKLVIRPPNCPFE-KAVSKFFSA 150
Query: 63 SCAVNALINKYNPIGDNSDRLCELCIGRVPGEKCTTADPYAGFEGAFRCLVDKGEVAFLK 122
SCA A D + LC LC G +C E
Sbjct: 151 SCAPGA------DKPDPNSNLCALCA------------------GDNKCACSSHE----- 181
Query: 123 HTTVQEMIEGRIDACKYSFLGKELKMSFFYFLLLQYSGGLIEGTGAFRCLVD-KGEVAFL 181
Y G +GAFRCL + G+VAF+
Sbjct: 182 ----------------------------------PYYGY----SGAFRCLAEGAGDVAFV 203
Query: 182 KHTTVQEMIEGRID---AYGLTKENFELLCTDGTRQPVDNYQSCNWGQVPSNAVMTTSAK 238
KH+TV E +G+ A L ++++ELLC DGTR+PV Y++C+ +VPS+AV+ K
Sbjct: 204 KHSTVFENTDGKNGADWAKNLKRDDYELLCLDGTRKPVTEYKNCHLARVPSHAVVARKDK 263
Query: 239 STQIRRYYQQFLIKTVQLFGGPVPPQ----RTQGKNVILF 274
+ L+ Q FG P + +LF
Sbjct: 264 KEDVI----WELLNQQQKFGKDKPSLFQLFGSPTGKDLLF 299
|
Length = 332 |
| >gnl|CDD|215903 pfam00405, Transferrin, Transferrin | Back alignment and domain information |
|---|
| >gnl|CDD|215903 pfam00405, Transferrin, Transferrin | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 276 | |||
| smart00094 | 332 | TR_FER Transferrin. | 100.0 | |
| PF00405 | 330 | Transferrin: Transferrin; InterPro: IPR001156 Tran | 100.0 | |
| smart00094 | 332 | TR_FER Transferrin. | 97.89 | |
| PF00405 | 330 | Transferrin: Transferrin; InterPro: IPR001156 Tran | 97.26 | |
| COG3221 | 299 | PhnD ABC-type phosphate/phosphonate transport syst | 96.61 | |
| PF12974 | 243 | Phosphonate-bd: ABC transporter, phosphonate, peri | 87.09 |
| >smart00094 TR_FER Transferrin | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.6e-59 Score=440.46 Aligned_cols=200 Identities=41% Similarity=0.751 Sum_probs=171.3
Q ss_pred CccCCcCCCCccCcCCCCCCCCCCCCCCCcchHhHHHHHhcCCccccCCCchhhhhhhhccCCccCCcccccCCCCCCCc
Q psy3351 1 MKKNSLPDLTHISHLRGKKACFAGVGTQAGWVIPVDVLIRNGGMEVIDCNNHVKSVINYFGPSCAVNALINKYNPIGDNS 80 (276)
Q Consensus 1 vkk~s~~~i~~~~dLkGkksCHtG~g~taGW~~Pv~~L~~~~~i~~~~c~~~~kavs~FFs~SC~PGa~~~~y~~~~~~~ 80 (276)
|||+| .|.+|+||||||+||||+++++||++|++.|+++|+|++.+|+ ..++|++||++||+||++.+.| +
T Consensus 92 Vkk~S--~i~sl~dLkGKksChtg~~stsGw~iP~~~L~~~g~i~~~~~~-~~~avs~fFs~sC~PG~~~~~~------~ 162 (332)
T smart00094 92 VKKGS--AIFTWNQLRGKKSCHTGVGRTAGWNIPMGLLYNKLVIRPPNCP-FEKAVSKFFSASCAPGADKPDP------N 162 (332)
T ss_pred EECCC--CCCCHHHhCCCceecCCCCCcchhHHHHHHHHHcCCCCCCCCc-HHHHHHHHhhccccCCCCCCCC------c
Confidence 57777 6789999999999999999999999999999999999998886 5789999999999999976544 4
Q ss_pred hhhchhccCCCCCCCC--CCCCCCCCccccccceec-CCcEEEEechhhHhhhhcccccccccccchhhhhhHHHHHhhh
Q psy3351 81 DRLCELCIGRVPGEKC--TTADPYAGFEGAFRCLVD-KGEVAFLKHTTVQEMIEGRIDACKYSFLGKELKMSFFYFLLLQ 157 (276)
Q Consensus 81 ~nLC~lC~g~~~~~~C--~~~e~Y~G~~GAfRCL~e-~GDVAFvkh~tV~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~ 157 (276)
+|||+||.|+ .+| +++|+||||+||||||+| +||||||||+||.+++++++
T Consensus 163 ~~LC~lC~g~---~~C~~~~~e~Y~Gy~GA~rCL~eg~GdVAFvk~~tv~~~~~~~~----------------------- 216 (332)
T smart00094 163 SNLCALCAGD---NKCACSSHEPYYGYSGAFRCLAEGAGDVAFVKHSTVFENTDGKN----------------------- 216 (332)
T ss_pred hhhHhhcCCC---CccCCCCCCcccCcchhheeeccCCccEEEEecccHHhhcCCCC-----------------------
Confidence 7999999997 688 788999999999999999 69999999999999987653
Q ss_pred ccCCcccCCccceeccccccchhhcchhhhhhhcccccccCCCccCeEEecCCCCCccCCCCccceeeeeCCceEEEcCC
Q psy3351 158 YSGGLIEGTGAFRCLVDKGEVAFLKHTTVQEMIEGRIDAYGLTKENFELLCTDGTRQPVDNYQSCNWGQVPSNAVMTTSA 237 (276)
Q Consensus 158 ~s~g~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~dfeLLCpdGtr~pv~~~~~Cnl~~vP~~aVvt~~~ 237 (276)
++.|+.+++++||+||||||+|+||++|++||||++|||+||+|++
T Consensus 217 ----------------------------------~~~wa~~~~~~dy~lLC~dg~r~pi~~~~~C~la~~P~~~vv~~~~ 262 (332)
T smart00094 217 ----------------------------------GADWAKNLKRDDYELLCLDGTRKPVTEYKNCHLARVPSHAVVARKD 262 (332)
T ss_pred ----------------------------------ccccccccCccceEEECCCCCcCCCccCCcceeeeccCCeEEeccc
Confidence 2458999999999999999999999999999999999999999986
Q ss_pred cchhHHHHHHHHHHHHHHHhCCCCC--CC---CCCCcceEE
Q psy3351 238 KSTQIRRYYQQFLIKTVQLFGGPVP--PQ---RTQGKNVIL 273 (276)
Q Consensus 238 ~~~~~r~~~~~~L~~~~~lfg~~~~--~~---~~~~~~~~~ 273 (276)
. ....++ .|+.++++||++.+ ++ .+.|||||.
T Consensus 263 ~---~~~~~~-~ll~~~~~~g~~~~~~f~lf~s~~~kdLlF 299 (332)
T smart00094 263 K---KEDVIW-ELLNQQQKFGKDKPSLFQLFGSPTGKDLLF 299 (332)
T ss_pred c---hHHHHH-HHHHHHHHhccCCCCccccccCCCCCccee
Confidence 4 223454 45555558887633 22 345788753
|
|
| >PF00405 Transferrin: Transferrin; InterPro: IPR001156 Transferrins are eukaryotic iron-binding glycoproteins that control the level of free iron in biological fluids [] | Back alignment and domain information |
|---|
| >smart00094 TR_FER Transferrin | Back alignment and domain information |
|---|
| >PF00405 Transferrin: Transferrin; InterPro: IPR001156 Transferrins are eukaryotic iron-binding glycoproteins that control the level of free iron in biological fluids [] | Back alignment and domain information |
|---|
| >COG3221 PhnD ABC-type phosphate/phosphonate transport system, periplasmic component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF12974 Phosphonate-bd: ABC transporter, phosphonate, periplasmic substrate-binding protein ; PDB: 3N5L_B 3QUJ_C 3P7I_A 3QK6_A 3S4U_A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 276 | ||||
| 3mc2_A | 687 | Crystal Structure Of The Murine Inhibitor Of Carbon | 3e-20 | ||
| 3mc2_A | 687 | Crystal Structure Of The Murine Inhibitor Of Carbon | 5e-10 | ||
| 2d3i_A | 686 | Crystal Structure Of Aluminum-Bound Ovotransferrin | 6e-20 | ||
| 2d3i_A | 686 | Crystal Structure Of Aluminum-Bound Ovotransferrin | 6e-13 | ||
| 1n04_A | 686 | Diferric Chicken Serum Transferrin At 2.8 A Resolut | 7e-20 | ||
| 1n04_A | 686 | Diferric Chicken Serum Transferrin At 2.8 A Resolut | 6e-13 | ||
| 1iq7_A | 345 | Ovotransferrin, C-Terminal Lobe, Apo Form Length = | 8e-20 | ||
| 1h76_A | 696 | The Crystal Structure Of Diferric Porcine Serum Tra | 3e-18 | ||
| 1nft_A | 329 | Ovotransferrin, N-Terminal Lobe, Iron Loaded Open F | 5e-18 | ||
| 1nft_A | 329 | Ovotransferrin, N-Terminal Lobe, Iron Loaded Open F | 5e-13 | ||
| 1iej_A | 332 | Ovotransferrin, N-Terminal Lobe, Holo Form, At 1.65 | 9e-18 | ||
| 1iej_A | 332 | Ovotransferrin, N-Terminal Lobe, Holo Form, At 1.65 | 5e-13 | ||
| 1nnt_A | 328 | Structural Evidence For A Ph-Sensitive Di-Lysine Tr | 1e-17 | ||
| 1nnt_A | 328 | Structural Evidence For A Ph-Sensitive Di-Lysine Tr | 5e-13 | ||
| 1gv8_A | 159 | 18 Kda Fragment Of N-Ii Domain Of Duck Ovotransferr | 2e-17 | ||
| 1gv8_A | 159 | 18 Kda Fragment Of N-Ii Domain Of Duck Ovotransferr | 7e-14 | ||
| 1gvc_A | 157 | 18kda N-Ii Domain Fragment Of Duck Ovotransferrin + | 2e-17 | ||
| 1gvc_A | 157 | 18kda N-Ii Domain Fragment Of Duck Ovotransferrin + | 1e-13 | ||
| 1aov_A | 686 | Apo Duck Ovotransferrin Length = 686 | 4e-17 | ||
| 1aov_A | 686 | Apo Duck Ovotransferrin Length = 686 | 4e-16 | ||
| 1ovb_A | 159 | The Mechanism Of Iron Uptake By Transferrins: The S | 5e-17 | ||
| 1ovb_A | 159 | The Mechanism Of Iron Uptake By Transferrins: The S | 2e-13 | ||
| 1oqh_A | 337 | Crystal Structure Of The R124a Mutant Of The N-lobe | 2e-16 | ||
| 1oqh_A | 337 | Crystal Structure Of The R124a Mutant Of The N-lobe | 3e-13 | ||
| 1suv_C | 329 | Structure Of Human Transferrin Receptor-transferrin | 2e-16 | ||
| 1suv_C | 329 | Structure Of Human Transferrin Receptor-transferrin | 2e-13 | ||
| 1jqf_A | 334 | Human Transferrin N-Lobe Mutant H249q Length = 334 | 2e-16 | ||
| 1jqf_A | 334 | Human Transferrin N-Lobe Mutant H249q Length = 334 | 3e-13 | ||
| 1ryo_A | 327 | Human Serum Transferrin, N-Lobe Bound With Oxalate | 2e-16 | ||
| 1ryo_A | 327 | Human Serum Transferrin, N-Lobe Bound With Oxalate | 3e-13 | ||
| 1n7x_A | 331 | Human Serum Transferrin, N-Lobe Y45e Mutant Length | 2e-16 | ||
| 1n7x_A | 331 | Human Serum Transferrin, N-Lobe Y45e Mutant Length | 2e-13 | ||
| 1fqf_A | 331 | Crystal Structures Of Mutant (K296a) That Abolish T | 2e-16 | ||
| 1fqf_A | 331 | Crystal Structures Of Mutant (K296a) That Abolish T | 3e-13 | ||
| 1n84_A | 331 | Human Serum Transferrin, N-Lobe Length = 331 | 2e-16 | ||
| 1n84_A | 331 | Human Serum Transferrin, N-Lobe Length = 331 | 3e-13 | ||
| 1n7w_A | 331 | Crystal Structure Of Human Serum Transferrin, N-Lob | 2e-16 | ||
| 1n7w_A | 331 | Crystal Structure Of Human Serum Transferrin, N-Lob | 3e-13 | ||
| 1oqg_A | 337 | Crystal Structure Of The D63e Mutant Of The N-Lobe | 2e-16 | ||
| 1oqg_A | 337 | Crystal Structure Of The D63e Mutant Of The N-Lobe | 3e-13 | ||
| 1bp5_A | 337 | Human Serum Transferrin, Recombinant N-Terminal Lob | 2e-16 | ||
| 1bp5_A | 337 | Human Serum Transferrin, Recombinant N-Terminal Lob | 3e-13 | ||
| 2hav_A | 676 | Apo-Human Serum Transferrin (Glycosylated) Length = | 2e-16 | ||
| 2hav_A | 676 | Apo-Human Serum Transferrin (Glycosylated) Length = | 1e-15 | ||
| 3qyt_A | 679 | Diferric Bound Human Serum Transferrin Length = 679 | 2e-16 | ||
| 3qyt_A | 679 | Diferric Bound Human Serum Transferrin Length = 679 | 1e-15 | ||
| 4h0w_A | 679 | Bismuth Bound Human Serum Transferrin Length = 679 | 2e-16 | ||
| 4h0w_A | 679 | Bismuth Bound Human Serum Transferrin Length = 679 | 1e-15 | ||
| 3ve1_B | 679 | The 2.9 Angstrom Crystal Structure Of Transferrin B | 2e-16 | ||
| 3ve1_B | 679 | The 2.9 Angstrom Crystal Structure Of Transferrin B | 1e-15 | ||
| 3v83_A | 698 | The 2.1 Angstrom Crystal Structure Of Diferric Huma | 3e-16 | ||
| 3v83_A | 698 | The 2.1 Angstrom Crystal Structure Of Diferric Huma | 1e-15 | ||
| 1dtg_A | 334 | Human Transferrin N-Lobe Mutant H249e Length = 334 | 3e-16 | ||
| 1dtg_A | 334 | Human Transferrin N-Lobe Mutant H249e Length = 334 | 6e-14 | ||
| 1b3e_A | 330 | Human Serum Transferrin, N-Terminal Lobe, Expressed | 3e-16 | ||
| 1b3e_A | 330 | Human Serum Transferrin, N-Terminal Lobe, Expressed | 5e-14 | ||
| 3s9l_C | 693 | Complex Between Transferrin Receptor 1 And Transfer | 3e-16 | ||
| 3s9l_C | 693 | Complex Between Transferrin Receptor 1 And Transfer | 1e-15 | ||
| 1d3k_A | 329 | Human Serum Transferrin Length = 329 | 4e-16 | ||
| 1d3k_A | 329 | Human Serum Transferrin Length = 329 | 6e-13 | ||
| 2hau_A | 676 | Apo-Human Serum Transferrin (Non-Glycosylated) Leng | 5e-16 | ||
| 2hau_A | 676 | Apo-Human Serum Transferrin (Non-Glycosylated) Leng | 1e-15 | ||
| 3fgs_A | 337 | Crystal Structure Of G65rK206E DOUBLE MUTANT OF THE | 6e-16 | ||
| 3fgs_A | 337 | Crystal Structure Of G65rK206E DOUBLE MUTANT OF THE | 7e-13 | ||
| 2o7u_B | 337 | Crystal Structure Of K206eK296E MUTANT OF THE N-Ter | 6e-16 | ||
| 2o7u_B | 337 | Crystal Structure Of K206eK296E MUTANT OF THE N-Ter | 7e-13 | ||
| 2o84_X | 337 | Crystal Structure Of K206e Mutant Of N-Lobe Human T | 6e-16 | ||
| 2o84_X | 337 | Crystal Structure Of K206e Mutant Of N-Lobe Human T | 7e-13 | ||
| 1fqe_A | 331 | Crystal Structures Of Mutant (K206a) That Abolish T | 8e-16 | ||
| 1fqe_A | 331 | Crystal Structures Of Mutant (K206a) That Abolish T | 1e-12 | ||
| 3v89_B | 343 | The Crystal Structure Of Transferrin Binding Protei | 1e-15 | ||
| 3skp_A | 342 | The Structure Of Apo-Human Transferrin C-Lobe With | 1e-15 | ||
| 1d4n_A | 329 | Human Serum Transferrin Length = 329 | 1e-15 | ||
| 1d4n_A | 329 | Human Serum Transferrin Length = 329 | 2e-12 | ||
| 1sdx_A | 335 | Crystal Structure Of The Zinc Saturated C-Terminal | 3e-15 | ||
| 1nkx_A | 348 | Crystal Structure Of A Proteolytically Generated Fu | 3e-15 | ||
| 2p1s_A | 344 | Crystal Structure Of The C-Terminal Lobe Of Bovine | 3e-15 | ||
| 2b65_A | 345 | Crystal Structure Of The Complex Of C-Lobe Of Bovin | 4e-15 | ||
| 1b1x_A | 689 | Structure Of Diferric Mare Lactoferrin At 2.62a Res | 4e-15 | ||
| 1b1x_A | 689 | Structure Of Diferric Mare Lactoferrin At 2.62a Res | 5e-10 | ||
| 1f9b_A | 695 | Melanin Protein Interaction: X-Ray Structure Of The | 4e-15 | ||
| 1f9b_A | 695 | Melanin Protein Interaction: X-Ray Structure Of The | 1e-09 | ||
| 1ce2_A | 689 | Structure Of Diferric Buffalo Lactoferrin At 2.5a R | 8e-15 | ||
| 1ce2_A | 689 | Structure Of Diferric Buffalo Lactoferrin At 2.5a R | 1e-11 | ||
| 1biy_A | 689 | Structure Of Diferric Buffalo Lactoferrin Length = | 9e-15 | ||
| 1biy_A | 689 | Structure Of Diferric Buffalo Lactoferrin Length = | 1e-11 | ||
| 1blf_A | 689 | Structure Of Diferric Bovine Lactoferrin At 2.8 Ang | 2e-14 | ||
| 1blf_A | 689 | Structure Of Diferric Bovine Lactoferrin At 2.8 Ang | 9e-12 | ||
| 1jnf_A | 676 | Rabbit Serum Transferrin At 2.6 A Resolution Length | 5e-14 | ||
| 1suv_E | 345 | Structure Of Human Transferrin Receptor-transferrin | 5e-14 | ||
| 1tfd_A | 304 | High-Resolution X-Ray Studies On Rabbit Serum Trans | 1e-13 | ||
| 1tfd_A | 304 | High-Resolution X-Ray Studies On Rabbit Serum Trans | 3e-11 | ||
| 1lfg_A | 691 | Structure Of Diferric Human Lactoferrin Length = 69 | 4e-13 | ||
| 1lfg_A | 691 | Structure Of Diferric Human Lactoferrin Length = 69 | 1e-11 | ||
| 1lfh_A | 691 | Molecular Replacement Solution Of The Structure Of | 6e-13 | ||
| 1lfh_A | 691 | Molecular Replacement Solution Of The Structure Of | 1e-11 | ||
| 1lfi_A | 691 | Metal Substitution In Transferrins: The Crystal Str | 6e-13 | ||
| 1lfi_A | 691 | Metal Substitution In Transferrins: The Crystal Str | 1e-11 | ||
| 1jw1_A | 689 | Crystallization And Structure Determination Of Goat | 6e-13 | ||
| 1jw1_A | 689 | Crystallization And Structure Determination Of Goat | 2e-12 | ||
| 1b0l_A | 691 | Recombinant Human Diferric Lactoferrin Length = 691 | 6e-13 | ||
| 1b0l_A | 691 | Recombinant Human Diferric Lactoferrin Length = 691 | 1e-11 | ||
| 1b0l_A | 691 | Recombinant Human Diferric Lactoferrin Length = 691 | 5e-09 | ||
| 1n76_A | 690 | Crystal Structure Of Human Seminal Lactoferrin At 3 | 6e-13 | ||
| 1n76_A | 690 | Crystal Structure Of Human Seminal Lactoferrin At 3 | 1e-11 | ||
| 1n76_A | 690 | Crystal Structure Of Human Seminal Lactoferrin At 3 | 4e-09 | ||
| 2bjj_X | 692 | Structure Of Recombinant Human Lactoferrin Produced | 7e-13 | ||
| 2bjj_X | 692 | Structure Of Recombinant Human Lactoferrin Produced | 1e-11 | ||
| 2bjj_X | 692 | Structure Of Recombinant Human Lactoferrin Produced | 4e-09 | ||
| 1dtz_A | 689 | Structure Of Camel Apo-Lactoferrin Demonstrates Its | 7e-13 | ||
| 1dtz_A | 689 | Structure Of Camel Apo-Lactoferrin Demonstrates Its | 8e-12 | ||
| 1cb6_A | 691 | Structure Of Human Apolactoferrin At 2.0 A Resoluti | 7e-13 | ||
| 1cb6_A | 691 | Structure Of Human Apolactoferrin At 2.0 A Resoluti | 1e-11 | ||
| 1cb6_A | 691 | Structure Of Human Apolactoferrin At 2.0 A Resoluti | 5e-09 | ||
| 1fck_A | 692 | Structure Of Diceric Human Lactoferrin Length = 692 | 7e-13 | ||
| 1fck_A | 692 | Structure Of Diceric Human Lactoferrin Length = 692 | 1e-11 | ||
| 1fck_A | 692 | Structure Of Diceric Human Lactoferrin Length = 692 | 5e-09 | ||
| 1lcf_A | 691 | Crystal Structure Of Copper-And Oxalate-Substituted | 7e-13 | ||
| 1lcf_A | 691 | Crystal Structure Of Copper-And Oxalate-Substituted | 1e-11 | ||
| 1lcf_A | 691 | Crystal Structure Of Copper-And Oxalate-Substituted | 5e-09 | ||
| 1sqy_A | 691 | Structure Of Human Diferric Lactoferrin At 2.5a Res | 1e-12 | ||
| 1sqy_A | 691 | Structure Of Human Diferric Lactoferrin At 2.5a Res | 1e-11 | ||
| 1sqy_A | 691 | Structure Of Human Diferric Lactoferrin At 2.5a Res | 5e-09 | ||
| 1vfe_A | 333 | Human Lactoferrin, N-terminal Lobe Mutant With Arg | 8e-12 | ||
| 2pms_A | 344 | Crystal Structure Of The Complex Of Human Lactoferr | 1e-11 | ||
| 1vfd_A | 330 | Human Lactoferrin, N-Terminal Lobe Mutant With Arg | 1e-11 | ||
| 1lct_A | 333 | Structure Of The Recombinant N-Terminal Lobe Of Hum | 2e-11 | ||
| 1dsn_A | 333 | D60s N-Terminal Lobe Human Lactoferrin Length = 333 | 2e-11 | ||
| 1l5t_A | 332 | Crystal Structure Of A Domain-Opened Mutant (R121d) | 2e-11 | ||
| 1h43_A | 334 | R210e N-Terminal Lobe Human Lactoferrin Length = 33 | 2e-11 | ||
| 1eh3_A | 334 | R210k N-Terminal Lobe Human Lactoferrin Length = 33 | 3e-11 | ||
| 1hse_A | 334 | H253m N Terminal Lobe Of Human Lactoferrin Length = | 4e-11 | ||
| 1h44_A | 334 | R210l N-Terminal Lobe Human Lactoferrin Length = 33 | 6e-11 | ||
| 1h45_A | 334 | R210g N-Terminal Lobe Human Lactoferrin Length = 33 | 1e-10 | ||
| 1lgb_C | 159 | Interaction Of A Legume Lectin With The N2 Fragment | 5e-09 |
| >pdb|3MC2|A Chain A, Crystal Structure Of The Murine Inhibitor Of Carbonic Anhydrase Length = 687 | Back alignment and structure |
|
| >pdb|3MC2|A Chain A, Crystal Structure Of The Murine Inhibitor Of Carbonic Anhydrase Length = 687 | Back alignment and structure |
| >pdb|2D3I|A Chain A, Crystal Structure Of Aluminum-Bound Ovotransferrin At 2.15 Angstrom Resolution Length = 686 | Back alignment and structure |
| >pdb|2D3I|A Chain A, Crystal Structure Of Aluminum-Bound Ovotransferrin At 2.15 Angstrom Resolution Length = 686 | Back alignment and structure |
| >pdb|1N04|A Chain A, Diferric Chicken Serum Transferrin At 2.8 A Resolution. Length = 686 | Back alignment and structure |
| >pdb|1N04|A Chain A, Diferric Chicken Serum Transferrin At 2.8 A Resolution. Length = 686 | Back alignment and structure |
| >pdb|1IQ7|A Chain A, Ovotransferrin, C-Terminal Lobe, Apo Form Length = 345 | Back alignment and structure |
| >pdb|1H76|A Chain A, The Crystal Structure Of Diferric Porcine Serum Transferrin Length = 696 | Back alignment and structure |
| >pdb|1NFT|A Chain A, Ovotransferrin, N-Terminal Lobe, Iron Loaded Open Form Length = 329 | Back alignment and structure |
| >pdb|1NFT|A Chain A, Ovotransferrin, N-Terminal Lobe, Iron Loaded Open Form Length = 329 | Back alignment and structure |
| >pdb|1IEJ|A Chain A, Ovotransferrin, N-Terminal Lobe, Holo Form, At 1.65 A Resolution Length = 332 | Back alignment and structure |
| >pdb|1IEJ|A Chain A, Ovotransferrin, N-Terminal Lobe, Holo Form, At 1.65 A Resolution Length = 332 | Back alignment and structure |
| >pdb|1NNT|A Chain A, Structural Evidence For A Ph-Sensitive Di-Lysine Trigger In The Hen Ovotransferrin N-Lobe: Implications For Transferrin Iron Release Length = 328 | Back alignment and structure |
| >pdb|1NNT|A Chain A, Structural Evidence For A Ph-Sensitive Di-Lysine Trigger In The Hen Ovotransferrin N-Lobe: Implications For Transferrin Iron Release Length = 328 | Back alignment and structure |
| >pdb|1GV8|A Chain A, 18 Kda Fragment Of N-Ii Domain Of Duck Ovotransferrin Length = 159 | Back alignment and structure |
| >pdb|1GV8|A Chain A, 18 Kda Fragment Of N-Ii Domain Of Duck Ovotransferrin Length = 159 | Back alignment and structure |
| >pdb|1GVC|A Chain A, 18kda N-Ii Domain Fragment Of Duck Ovotransferrin + Nta Length = 157 | Back alignment and structure |
| >pdb|1GVC|A Chain A, 18kda N-Ii Domain Fragment Of Duck Ovotransferrin + Nta Length = 157 | Back alignment and structure |
| >pdb|1AOV|A Chain A, Apo Duck Ovotransferrin Length = 686 | Back alignment and structure |
| >pdb|1AOV|A Chain A, Apo Duck Ovotransferrin Length = 686 | Back alignment and structure |
| >pdb|1OVB|A Chain A, The Mechanism Of Iron Uptake By Transferrins: The Structure Of An 18kd Nii-Domain Fragment At 2.3 Angstroms Resolution Length = 159 | Back alignment and structure |
| >pdb|1OVB|A Chain A, The Mechanism Of Iron Uptake By Transferrins: The Structure Of An 18kd Nii-Domain Fragment At 2.3 Angstroms Resolution Length = 159 | Back alignment and structure |
| >pdb|1OQH|A Chain A, Crystal Structure Of The R124a Mutant Of The N-lobe Human Transferrin Length = 337 | Back alignment and structure |
| >pdb|1OQH|A Chain A, Crystal Structure Of The R124a Mutant Of The N-lobe Human Transferrin Length = 337 | Back alignment and structure |
| >pdb|1SUV|C Chain C, Structure Of Human Transferrin Receptor-transferrin Complex Length = 329 | Back alignment and structure |
| >pdb|1SUV|C Chain C, Structure Of Human Transferrin Receptor-transferrin Complex Length = 329 | Back alignment and structure |
| >pdb|1JQF|A Chain A, Human Transferrin N-Lobe Mutant H249q Length = 334 | Back alignment and structure |
| >pdb|1JQF|A Chain A, Human Transferrin N-Lobe Mutant H249q Length = 334 | Back alignment and structure |
| >pdb|1RYO|A Chain A, Human Serum Transferrin, N-Lobe Bound With Oxalate Length = 327 | Back alignment and structure |
| >pdb|1RYO|A Chain A, Human Serum Transferrin, N-Lobe Bound With Oxalate Length = 327 | Back alignment and structure |
| >pdb|1N7X|A Chain A, Human Serum Transferrin, N-Lobe Y45e Mutant Length = 331 | Back alignment and structure |
| >pdb|1N7X|A Chain A, Human Serum Transferrin, N-Lobe Y45e Mutant Length = 331 | Back alignment and structure |
| >pdb|1FQF|A Chain A, Crystal Structures Of Mutant (K296a) That Abolish The Dilysine Interaction In The N-Lobe Of Human Transferrin Length = 331 | Back alignment and structure |
| >pdb|1FQF|A Chain A, Crystal Structures Of Mutant (K296a) That Abolish The Dilysine Interaction In The N-Lobe Of Human Transferrin Length = 331 | Back alignment and structure |
| >pdb|1N84|A Chain A, Human Serum Transferrin, N-Lobe Length = 331 | Back alignment and structure |
| >pdb|1N84|A Chain A, Human Serum Transferrin, N-Lobe Length = 331 | Back alignment and structure |
| >pdb|1N7W|A Chain A, Crystal Structure Of Human Serum Transferrin, N-Lobe L66w Mutant Length = 331 | Back alignment and structure |
| >pdb|1N7W|A Chain A, Crystal Structure Of Human Serum Transferrin, N-Lobe L66w Mutant Length = 331 | Back alignment and structure |
| >pdb|1OQG|A Chain A, Crystal Structure Of The D63e Mutant Of The N-Lobe Human Transferrin Length = 337 | Back alignment and structure |
| >pdb|1OQG|A Chain A, Crystal Structure Of The D63e Mutant Of The N-Lobe Human Transferrin Length = 337 | Back alignment and structure |
| >pdb|1BP5|A Chain A, Human Serum Transferrin, Recombinant N-Terminal Lobe, Apo Form Length = 337 | Back alignment and structure |
| >pdb|1BP5|A Chain A, Human Serum Transferrin, Recombinant N-Terminal Lobe, Apo Form Length = 337 | Back alignment and structure |
| >pdb|2HAV|A Chain A, Apo-Human Serum Transferrin (Glycosylated) Length = 676 | Back alignment and structure |
| >pdb|2HAV|A Chain A, Apo-Human Serum Transferrin (Glycosylated) Length = 676 | Back alignment and structure |
| >pdb|3QYT|A Chain A, Diferric Bound Human Serum Transferrin Length = 679 | Back alignment and structure |
| >pdb|3QYT|A Chain A, Diferric Bound Human Serum Transferrin Length = 679 | Back alignment and structure |
| >pdb|4H0W|A Chain A, Bismuth Bound Human Serum Transferrin Length = 679 | Back alignment and structure |
| >pdb|4H0W|A Chain A, Bismuth Bound Human Serum Transferrin Length = 679 | Back alignment and structure |
| >pdb|3VE1|B Chain B, The 2.9 Angstrom Crystal Structure Of Transferrin Binding Protein B (Tbpb) From Serogroup B M982 Neisseria Meningitidis In Complex With Human Transferrin Length = 679 | Back alignment and structure |
| >pdb|3VE1|B Chain B, The 2.9 Angstrom Crystal Structure Of Transferrin Binding Protein B (Tbpb) From Serogroup B M982 Neisseria Meningitidis In Complex With Human Transferrin Length = 679 | Back alignment and structure |
| >pdb|3V83|A Chain A, The 2.1 Angstrom Crystal Structure Of Diferric Human Transferrin Length = 698 | Back alignment and structure |
| >pdb|3V83|A Chain A, The 2.1 Angstrom Crystal Structure Of Diferric Human Transferrin Length = 698 | Back alignment and structure |
| >pdb|1DTG|A Chain A, Human Transferrin N-Lobe Mutant H249e Length = 334 | Back alignment and structure |
| >pdb|1DTG|A Chain A, Human Transferrin N-Lobe Mutant H249e Length = 334 | Back alignment and structure |
| >pdb|1B3E|A Chain A, Human Serum Transferrin, N-Terminal Lobe, Expressed In Pichia Pastoris Length = 330 | Back alignment and structure |
| >pdb|1B3E|A Chain A, Human Serum Transferrin, N-Terminal Lobe, Expressed In Pichia Pastoris Length = 330 | Back alignment and structure |
| >pdb|3S9L|C Chain C, Complex Between Transferrin Receptor 1 And Transferrin With Iron In The N-Lobe, Cryocooled 2 Length = 693 | Back alignment and structure |
| >pdb|3S9L|C Chain C, Complex Between Transferrin Receptor 1 And Transferrin With Iron In The N-Lobe, Cryocooled 2 Length = 693 | Back alignment and structure |
| >pdb|1D3K|A Chain A, Human Serum Transferrin Length = 329 | Back alignment and structure |
| >pdb|1D3K|A Chain A, Human Serum Transferrin Length = 329 | Back alignment and structure |
| >pdb|2HAU|A Chain A, Apo-Human Serum Transferrin (Non-Glycosylated) Length = 676 | Back alignment and structure |
| >pdb|2HAU|A Chain A, Apo-Human Serum Transferrin (Non-Glycosylated) Length = 676 | Back alignment and structure |
| >pdb|3FGS|A Chain A, Crystal Structure Of G65rK206E DOUBLE MUTANT OF THE N-Lobe Human Transferrin Length = 337 | Back alignment and structure |
| >pdb|3FGS|A Chain A, Crystal Structure Of G65rK206E DOUBLE MUTANT OF THE N-Lobe Human Transferrin Length = 337 | Back alignment and structure |
| >pdb|2O7U|B Chain B, Crystal Structure Of K206eK296E MUTANT OF THE N-Terminal Half Molecule Of Human Transferrin Length = 337 | Back alignment and structure |
| >pdb|2O7U|B Chain B, Crystal Structure Of K206eK296E MUTANT OF THE N-Terminal Half Molecule Of Human Transferrin Length = 337 | Back alignment and structure |
| >pdb|2O84|X Chain X, Crystal Structure Of K206e Mutant Of N-Lobe Human Transferrin Length = 337 | Back alignment and structure |
| >pdb|2O84|X Chain X, Crystal Structure Of K206e Mutant Of N-Lobe Human Transferrin Length = 337 | Back alignment and structure |
| >pdb|1FQE|A Chain A, Crystal Structures Of Mutant (K206a) That Abolish The Dilysine Interaction In The N-Lobe Of Human Transferrin Length = 331 | Back alignment and structure |
| >pdb|1FQE|A Chain A, Crystal Structures Of Mutant (K206a) That Abolish The Dilysine Interaction In The N-Lobe Of Human Transferrin Length = 331 | Back alignment and structure |
| >pdb|3V89|B Chain B, The Crystal Structure Of Transferrin Binding Protein A (Tbpa) From Neisseria Meningitidis Serogroup B In Complex With The C-Lobe Of Human Transferrin Length = 343 | Back alignment and structure |
| >pdb|3SKP|A Chain A, The Structure Of Apo-Human Transferrin C-Lobe With Bound Sulfate Ions Length = 342 | Back alignment and structure |
| >pdb|1D4N|A Chain A, Human Serum Transferrin Length = 329 | Back alignment and structure |
| >pdb|1D4N|A Chain A, Human Serum Transferrin Length = 329 | Back alignment and structure |
| >pdb|1SDX|A Chain A, Crystal Structure Of The Zinc Saturated C-Terminal Half Of Bovine Lactoferrin At 2.0 A Resolution Reveals Two Additional Zinc Binding Sites Length = 335 | Back alignment and structure |
| >pdb|1NKX|A Chain A, Crystal Structure Of A Proteolytically Generated Functional Monoferric C-Lobe Of Bovine Lactoferrin At 1.9a Resolution Length = 348 | Back alignment and structure |
| >pdb|2P1S|A Chain A, Crystal Structure Of The C-Terminal Lobe Of Bovine Lactoferrin Complexed With O-Alpha-D-Glucopyranosyl-(1 3)-Alpha-D- Fructofuranosyl- (2 1)- Alpha-D-Glucopyranoside At 1.93 A Resolution Length = 344 | Back alignment and structure |
| >pdb|2B65|A Chain A, Crystal Structure Of The Complex Of C-Lobe Of Bovine Lactoferrin With Maltose At 1.5a Resolution Length = 345 | Back alignment and structure |
| >pdb|1B1X|A Chain A, Structure Of Diferric Mare Lactoferrin At 2.62a Resolution Length = 689 | Back alignment and structure |
| >pdb|1B1X|A Chain A, Structure Of Diferric Mare Lactoferrin At 2.62a Resolution Length = 689 | Back alignment and structure |
| >pdb|1F9B|A Chain A, Melanin Protein Interaction: X-Ray Structure Of The Complex Of Mare Lactoferrin With Melanin Monomers Length = 695 | Back alignment and structure |
| >pdb|1F9B|A Chain A, Melanin Protein Interaction: X-Ray Structure Of The Complex Of Mare Lactoferrin With Melanin Monomers Length = 695 | Back alignment and structure |
| >pdb|1CE2|A Chain A, Structure Of Diferric Buffalo Lactoferrin At 2.5a Resolution Length = 689 | Back alignment and structure |
| >pdb|1CE2|A Chain A, Structure Of Diferric Buffalo Lactoferrin At 2.5a Resolution Length = 689 | Back alignment and structure |
| >pdb|1BIY|A Chain A, Structure Of Diferric Buffalo Lactoferrin Length = 689 | Back alignment and structure |
| >pdb|1BIY|A Chain A, Structure Of Diferric Buffalo Lactoferrin Length = 689 | Back alignment and structure |
| >pdb|1BLF|A Chain A, Structure Of Diferric Bovine Lactoferrin At 2.8 Angstroms Resolution Length = 689 | Back alignment and structure |
| >pdb|1BLF|A Chain A, Structure Of Diferric Bovine Lactoferrin At 2.8 Angstroms Resolution Length = 689 | Back alignment and structure |
| >pdb|1JNF|A Chain A, Rabbit Serum Transferrin At 2.6 A Resolution Length = 676 | Back alignment and structure |
| >pdb|1SUV|E Chain E, Structure Of Human Transferrin Receptor-transferrin Complex Length = 345 | Back alignment and structure |
| >pdb|1TFD|A Chain A, High-Resolution X-Ray Studies On Rabbit Serum Transferrin: Preliminary Structure Analysis Of The N-Terminal Half- Molecule At 2.3 Angstroms Resolution Length = 304 | Back alignment and structure |
| >pdb|1TFD|A Chain A, High-Resolution X-Ray Studies On Rabbit Serum Transferrin: Preliminary Structure Analysis Of The N-Terminal Half- Molecule At 2.3 Angstroms Resolution Length = 304 | Back alignment and structure |
| >pdb|1LFG|A Chain A, Structure Of Diferric Human Lactoferrin Length = 691 | Back alignment and structure |
| >pdb|1LFG|A Chain A, Structure Of Diferric Human Lactoferrin Length = 691 | Back alignment and structure |
| >pdb|1LFH|A Chain A, Molecular Replacement Solution Of The Structure Of Apolactoferrin, A Protein Displaying Large-Scale Conformational Change Length = 691 | Back alignment and structure |
| >pdb|1LFH|A Chain A, Molecular Replacement Solution Of The Structure Of Apolactoferrin, A Protein Displaying Large-Scale Conformational Change Length = 691 | Back alignment and structure |
| >pdb|1LFI|A Chain A, Metal Substitution In Transferrins: The Crystal Structure Of Human Copper-lactoferrin At 2.1 Angstroms Resolution Length = 691 | Back alignment and structure |
| >pdb|1LFI|A Chain A, Metal Substitution In Transferrins: The Crystal Structure Of Human Copper-lactoferrin At 2.1 Angstroms Resolution Length = 691 | Back alignment and structure |
| >pdb|1JW1|A Chain A, Crystallization And Structure Determination Of Goat Lactoferrin At 4.0 Resolution: A New Form Of Packing In Lactoferrins With A High Solvent Content In Crystals Length = 689 | Back alignment and structure |
| >pdb|1JW1|A Chain A, Crystallization And Structure Determination Of Goat Lactoferrin At 4.0 Resolution: A New Form Of Packing In Lactoferrins With A High Solvent Content In Crystals Length = 689 | Back alignment and structure |
| >pdb|1B0L|A Chain A, Recombinant Human Diferric Lactoferrin Length = 691 | Back alignment and structure |
| >pdb|1B0L|A Chain A, Recombinant Human Diferric Lactoferrin Length = 691 | Back alignment and structure |
| >pdb|1B0L|A Chain A, Recombinant Human Diferric Lactoferrin Length = 691 | Back alignment and structure |
| >pdb|1N76|A Chain A, Crystal Structure Of Human Seminal Lactoferrin At 3.4 A Resolution Length = 690 | Back alignment and structure |
| >pdb|1N76|A Chain A, Crystal Structure Of Human Seminal Lactoferrin At 3.4 A Resolution Length = 690 | Back alignment and structure |
| >pdb|1N76|A Chain A, Crystal Structure Of Human Seminal Lactoferrin At 3.4 A Resolution Length = 690 | Back alignment and structure |
| >pdb|2BJJ|X Chain X, Structure Of Recombinant Human Lactoferrin Produced In The Milk Of Transgenic Cows Length = 692 | Back alignment and structure |
| >pdb|2BJJ|X Chain X, Structure Of Recombinant Human Lactoferrin Produced In The Milk Of Transgenic Cows Length = 692 | Back alignment and structure |
| >pdb|2BJJ|X Chain X, Structure Of Recombinant Human Lactoferrin Produced In The Milk Of Transgenic Cows Length = 692 | Back alignment and structure |
| >pdb|1DTZ|A Chain A, Structure Of Camel Apo-Lactoferrin Demonstrates Its Dual Role In Sequestering And Transporting Ferric Ions Simultaneously:crystal Structure Of Camel Apo-Lactoferrin At 2.6a Resolution. Length = 689 | Back alignment and structure |
| >pdb|1DTZ|A Chain A, Structure Of Camel Apo-Lactoferrin Demonstrates Its Dual Role In Sequestering And Transporting Ferric Ions Simultaneously:crystal Structure Of Camel Apo-Lactoferrin At 2.6a Resolution. Length = 689 | Back alignment and structure |
| >pdb|1CB6|A Chain A, Structure Of Human Apolactoferrin At 2.0 A Resolution. Length = 691 | Back alignment and structure |
| >pdb|1CB6|A Chain A, Structure Of Human Apolactoferrin At 2.0 A Resolution. Length = 691 | Back alignment and structure |
| >pdb|1CB6|A Chain A, Structure Of Human Apolactoferrin At 2.0 A Resolution. Length = 691 | Back alignment and structure |
| >pdb|1FCK|A Chain A, Structure Of Diceric Human Lactoferrin Length = 692 | Back alignment and structure |
| >pdb|1FCK|A Chain A, Structure Of Diceric Human Lactoferrin Length = 692 | Back alignment and structure |
| >pdb|1FCK|A Chain A, Structure Of Diceric Human Lactoferrin Length = 692 | Back alignment and structure |
| >pdb|1LCF|A Chain A, Crystal Structure Of Copper-And Oxalate-Substituted Human Lactoferrin At 2.0 Angstroms Resolution Length = 691 | Back alignment and structure |
| >pdb|1LCF|A Chain A, Crystal Structure Of Copper-And Oxalate-Substituted Human Lactoferrin At 2.0 Angstroms Resolution Length = 691 | Back alignment and structure |
| >pdb|1LCF|A Chain A, Crystal Structure Of Copper-And Oxalate-Substituted Human Lactoferrin At 2.0 Angstroms Resolution Length = 691 | Back alignment and structure |
| >pdb|1SQY|A Chain A, Structure Of Human Diferric Lactoferrin At 2.5a Resolution Using Crystals Grown At Ph 6.5 Length = 691 | Back alignment and structure |
| >pdb|1SQY|A Chain A, Structure Of Human Diferric Lactoferrin At 2.5a Resolution Using Crystals Grown At Ph 6.5 Length = 691 | Back alignment and structure |
| >pdb|1SQY|A Chain A, Structure Of Human Diferric Lactoferrin At 2.5a Resolution Using Crystals Grown At Ph 6.5 Length = 691 | Back alignment and structure |
| >pdb|1VFE|A Chain A, Human Lactoferrin, N-terminal Lobe Mutant With Arg 121 Replaced By Ser (r121s) Length = 333 | Back alignment and structure |
| >pdb|2PMS|A Chain A, Crystal Structure Of The Complex Of Human Lactoferrin N-Lobe And Lactoferrin-Binding Domain Of Pneumococcal Surface Protein A Length = 344 | Back alignment and structure |
| >pdb|1VFD|A Chain A, Human Lactoferrin, N-Terminal Lobe Mutant With Arg 121 Replaced By Glu (R121e) Length = 330 | Back alignment and structure |
| >pdb|1LCT|A Chain A, Structure Of The Recombinant N-Terminal Lobe Of Human Lactoferrin At 2.0 Angstroms Resolution Length = 333 | Back alignment and structure |
| >pdb|1DSN|A Chain A, D60s N-Terminal Lobe Human Lactoferrin Length = 333 | Back alignment and structure |
| >pdb|1L5T|A Chain A, Crystal Structure Of A Domain-Opened Mutant (R121d) Of The Human Lactoferrin N-Lobe Refined From A Merohedrally- Twinned Crystal Form. Length = 332 | Back alignment and structure |
| >pdb|1H43|A Chain A, R210e N-Terminal Lobe Human Lactoferrin Length = 334 | Back alignment and structure |
| >pdb|1EH3|A Chain A, R210k N-Terminal Lobe Human Lactoferrin Length = 334 | Back alignment and structure |
| >pdb|1HSE|A Chain A, H253m N Terminal Lobe Of Human Lactoferrin Length = 334 | Back alignment and structure |
| >pdb|1H44|A Chain A, R210l N-Terminal Lobe Human Lactoferrin Length = 334 | Back alignment and structure |
| >pdb|1H45|A Chain A, R210g N-Terminal Lobe Human Lactoferrin Length = 334 | Back alignment and structure |
| >pdb|1LGB|C Chain C, Interaction Of A Legume Lectin With The N2 Fragment Of Human Lactotransferrin Or With The Isolated Biantennary Glycopeptide: Role Of The Fucose Moiety Length = 159 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 276 | |||
| 1cb6_A | 691 | Protein (lactoferrin); iron transport, apolactofer | 4e-30 | |
| 1cb6_A | 691 | Protein (lactoferrin); iron transport, apolactofer | 5e-24 | |
| 2d3i_A | 686 | Ovotransferrin; aluminum, metal-binding, transport | 3e-27 | |
| 2d3i_A | 686 | Ovotransferrin; aluminum, metal-binding, transport | 2e-25 | |
| 2d3i_A | 686 | Ovotransferrin; aluminum, metal-binding, transport | 2e-15 | |
| 3v83_A | 698 | Serotransferrin; iron binding domain, iron carrier | 8e-27 | |
| 3v83_A | 698 | Serotransferrin; iron binding domain, iron carrier | 1e-24 | |
| 3v83_A | 698 | Serotransferrin; iron binding domain, iron carrier | 2e-16 | |
| 3mc2_A | 687 | Inhibitor of carbonic anhydrase; MICA, transferrin | 1e-26 | |
| 3mc2_A | 687 | Inhibitor of carbonic anhydrase; MICA, transferrin | 5e-26 | |
| 1blf_A | 689 | Lactoferrin; transferrin, iron-binding protein, ca | 1e-26 | |
| 1blf_A | 689 | Lactoferrin; transferrin, iron-binding protein, ca | 2e-23 | |
| 3tod_A | 335 | Lactotransferrin; C-LOBE, metal binding protein, 1 | 3e-26 | |
| 1h45_A | 334 | Lactoferrin; metal transport, iron transport, meta | 5e-26 | |
| 3skp_A | 342 | Serotransferrin; iron binding protein, transferrin | 7e-26 | |
| 1iej_A | 332 | Ovotransferrin; iron, metal binding protein; 1.65A | 1e-23 | |
| 1iej_A | 332 | Ovotransferrin; iron, metal binding protein; 1.65A | 4e-16 | |
| 1ryo_A | 327 | Serotransferrin; iron transport, metal transport; | 4e-23 | |
| 1ryo_A | 327 | Serotransferrin; iron transport, metal transport; | 2e-16 |
| >1cb6_A Protein (lactoferrin); iron transport, apolactoferrin, conformational change; 2.00A {Homo sapiens} SCOP: c.94.1.2 c.94.1.2 PDB: 1bka_A 1b0l_A 1lfi_A* 1fck_A 1lcf_A* 2bjj_X* 1lfh_A 1n76_A 1lfg_A* 1sqy_A* 1b1x_A 1b7u_A 1b7z_A 1i6b_A 1qjm_A 3cr9_A* 1f9b_A* 1dtz_A 1i6q_A 1jw1_A ... Length = 691 | Back alignment and structure |
|---|
Score = 118 bits (295), Expect = 4e-30
Identities = 58/259 (22%), Positives = 93/259 (35%), Gaps = 78/259 (30%)
Query: 1 MKKNSLPDLTHISHLRGKKACFAGVGTQAGWVIPVDVLIRNGGMEVIDCNNHVKSVINYF 60
+KK ++ L+G K+C G+ AGW +P+ L +V +F
Sbjct: 98 VKKGGS---FQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFL-NWTGPPEPIEAAVARFF 153
Query: 61 GPSCAVNALINKYNPIGDNSDRLCELCIGRVPGEKCTTADPYAGFEGAFRCLVDKGEVAF 120
SC A ++ LC LC G
Sbjct: 154 SASCVPGADKGQF-------PNLCRLCAGTGE---------------------------- 178
Query: 121 LKHTTVQEMIEGRIDACKYSFLGKELKMSFFYFLLLQYSGGLIEGTGAFRCLVD-KGEVA 179
+ C +S Y +GAF+CL D G+VA
Sbjct: 179 --------------NKCAFSSQEP-------------YFSY----SGAFKCLRDGAGDVA 207
Query: 180 FLKHTTVQEMIEGRIDAYGLTKENFELLCTDGTRQPVDNYQSCNWGQVPSNAVMTTSAKS 239
F++ +TV E + + ++ +ELLC D TR+PVD ++ C+ +VPS+AV+ S
Sbjct: 208 FIRESTVFEDLSDEAE-----RDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNG 262
Query: 240 TQIRRYYQQFLIKTVQLFG 258
+ L + + FG
Sbjct: 263 KEDA--IWNLLRQAQEKFG 279
|
| >1cb6_A Protein (lactoferrin); iron transport, apolactoferrin, conformational change; 2.00A {Homo sapiens} SCOP: c.94.1.2 c.94.1.2 PDB: 1bka_A 1b0l_A 1lfi_A* 1fck_A 1lcf_A* 2bjj_X* 1lfh_A 1n76_A 1lfg_A* 1sqy_A* 1b1x_A 1b7u_A 1b7z_A 1i6b_A 1qjm_A 3cr9_A* 1f9b_A* 1dtz_A 1i6q_A 1jw1_A ... Length = 691 | Back alignment and structure |
|---|
| >2d3i_A Ovotransferrin; aluminum, metal-binding, transport, metal transport; 2.15A {Gallus gallus} SCOP: c.94.1.2 c.94.1.2 PDB: 1ovt_A 1aiv_A* 1n04_A 1ryx_A 1dot_A* 1aov_A* 1iq7_A* Length = 686 | Back alignment and structure |
|---|
| >2d3i_A Ovotransferrin; aluminum, metal-binding, transport, metal transport; 2.15A {Gallus gallus} SCOP: c.94.1.2 c.94.1.2 PDB: 1ovt_A 1aiv_A* 1n04_A 1ryx_A 1dot_A* 1aov_A* 1iq7_A* Length = 686 | Back alignment and structure |
|---|
| >2d3i_A Ovotransferrin; aluminum, metal-binding, transport, metal transport; 2.15A {Gallus gallus} SCOP: c.94.1.2 c.94.1.2 PDB: 1ovt_A 1aiv_A* 1n04_A 1ryx_A 1dot_A* 1aov_A* 1iq7_A* Length = 686 | Back alignment and structure |
|---|
| >3v83_A Serotransferrin; iron binding domain, iron carrier/transporter, transferrin R serum, metal transport; HET: P6G; 2.10A {Homo sapiens} PDB: 3v8x_B* 3qyt_A* 3ve1_B 2hav_A* 3s9l_C* 3s9m_C* 3s9n_C* 2hau_A* 1jnf_A 1h76_A* Length = 698 | Back alignment and structure |
|---|
| >3v83_A Serotransferrin; iron binding domain, iron carrier/transporter, transferrin R serum, metal transport; HET: P6G; 2.10A {Homo sapiens} PDB: 3v8x_B* 3qyt_A* 3ve1_B 2hav_A* 3s9l_C* 3s9m_C* 3s9n_C* 2hau_A* 1jnf_A 1h76_A* Length = 698 | Back alignment and structure |
|---|
| >3v83_A Serotransferrin; iron binding domain, iron carrier/transporter, transferrin R serum, metal transport; HET: P6G; 2.10A {Homo sapiens} PDB: 3v8x_B* 3qyt_A* 3ve1_B 2hav_A* 3s9l_C* 3s9m_C* 3s9n_C* 2hau_A* 1jnf_A 1h76_A* Length = 698 | Back alignment and structure |
|---|
| >3mc2_A Inhibitor of carbonic anhydrase; MICA, transferrin superfamily, lyase inhibitor; 2.40A {Mus musculus} Length = 687 | Back alignment and structure |
|---|
| >3mc2_A Inhibitor of carbonic anhydrase; MICA, transferrin superfamily, lyase inhibitor; 2.40A {Mus musculus} Length = 687 | Back alignment and structure |
|---|
| >1blf_A Lactoferrin; transferrin, iron-binding protein, carbohydrate structure; HET: NAG BMA MAN; 2.80A {Bos taurus} SCOP: c.94.1.2 c.94.1.2 PDB: 1lfc_A Length = 689 | Back alignment and structure |
|---|
| >1blf_A Lactoferrin; transferrin, iron-binding protein, carbohydrate structure; HET: NAG BMA MAN; 2.80A {Bos taurus} SCOP: c.94.1.2 c.94.1.2 PDB: 1lfc_A Length = 689 | Back alignment and structure |
|---|
| >3tod_A Lactotransferrin; C-LOBE, metal binding protein, 1- butyl1-H-pyrazol-5-carboxy hydrolase; HET: NAG XXB; 1.38A {Bos taurus} PDB: 1sdx_A* 3u72_A* 3u8q_A* 3ugw_A* 3uk4_A* 3usd_A* 3v5a_A* 3vdf_A* 4dig_A* 4dxu_A* 2b6d_A* 2b65_A* 2doj_A* 2dp8_A* 2dqv_A* 2ds9_A* 2dsf_A* 2dvc_A* 2dwa_A* 2dwh_A* ... Length = 335 | Back alignment and structure |
|---|
| >1h45_A Lactoferrin; metal transport, iron transport, metal binding; 1.95A {Homo sapiens} SCOP: c.94.1.2 PDB: 1eh3_A 2pms_A* 1h43_A 1h44_A 1dsn_A 1lct_A 1hse_A 1vfe_A 1l5t_A 1vfd_A 1lgb_C* 1z6v_A 1z6w_A Length = 334 | Back alignment and structure |
|---|
| >3skp_A Serotransferrin; iron binding protein, transferrin receptor, TBP metal binding protein; 1.70A {Homo sapiens} PDB: 3v89_B 1suv_E Length = 342 | Back alignment and structure |
|---|
| >1iej_A Ovotransferrin; iron, metal binding protein; 1.65A {Gallus gallus} SCOP: c.94.1.2 PDB: 1tfa_A 1nft_A 1nnt_A 1ovb_A 1gv8_A 1gvc_A* Length = 332 | Back alignment and structure |
|---|
| >1iej_A Ovotransferrin; iron, metal binding protein; 1.65A {Gallus gallus} SCOP: c.94.1.2 PDB: 1tfa_A 1nft_A 1nnt_A 1ovb_A 1gv8_A 1gvc_A* Length = 332 | Back alignment and structure |
|---|
| >1ryo_A Serotransferrin; iron transport, metal transport; 1.20A {Homo sapiens} SCOP: c.94.1.2 PDB: 1bp5_A 1btj_A 1n84_A 1oqg_A 2o84_X 1fqf_A 1fqe_A 1oqh_A 2o7u_B 1jqf_A 1n7x_A 3fgs_A 1a8e_A 1a8f_A 1suv_C 1dtg_A 1d3k_A 1d4n_A 1n7w_A 1b3e_A ... Length = 327 | Back alignment and structure |
|---|
| >1ryo_A Serotransferrin; iron transport, metal transport; 1.20A {Homo sapiens} SCOP: c.94.1.2 PDB: 1bp5_A 1btj_A 1n84_A 1oqg_A 2o84_X 1fqf_A 1fqe_A 1oqh_A 2o7u_B 1jqf_A 1n7x_A 3fgs_A 1a8e_A 1a8f_A 1suv_C 1dtg_A 1d3k_A 1d4n_A 1n7w_A 1b3e_A ... Length = 327 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 276 | |||
| 3skp_A | 342 | Serotransferrin; iron binding protein, transferrin | 100.0 | |
| 3tod_A | 335 | Lactotransferrin; C-LOBE, metal binding protein, 1 | 100.0 | |
| 3mc2_A | 687 | Inhibitor of carbonic anhydrase; MICA, transferrin | 100.0 | |
| 3v83_A | 698 | Serotransferrin; iron binding domain, iron carrier | 100.0 | |
| 1iej_A | 332 | Ovotransferrin; iron, metal binding protein; 1.65A | 100.0 | |
| 1h45_A | 334 | Lactoferrin; metal transport, iron transport, meta | 100.0 | |
| 1cb6_A | 691 | Protein (lactoferrin); iron transport, apolactofer | 100.0 | |
| 2d3i_A | 686 | Ovotransferrin; aluminum, metal-binding, transport | 100.0 | |
| 3v83_A | 698 | Serotransferrin; iron binding domain, iron carrier | 100.0 | |
| 3mc2_A | 687 | Inhibitor of carbonic anhydrase; MICA, transferrin | 100.0 | |
| 2d3i_A | 686 | Ovotransferrin; aluminum, metal-binding, transport | 100.0 | |
| 1blf_A | 689 | Lactoferrin; transferrin, iron-binding protein, ca | 100.0 | |
| 1ryo_A | 327 | Serotransferrin; iron transport, metal transport; | 100.0 | |
| 1blf_A | 689 | Lactoferrin; transferrin, iron-binding protein, ca | 100.0 | |
| 1cb6_A | 691 | Protein (lactoferrin); iron transport, apolactofer | 100.0 | |
| 3skp_A | 342 | Serotransferrin; iron binding protein, transferrin | 98.02 | |
| 3tod_A | 335 | Lactotransferrin; C-LOBE, metal binding protein, 1 | 97.97 | |
| 1iej_A | 332 | Ovotransferrin; iron, metal binding protein; 1.65A | 96.57 | |
| 1h45_A | 334 | Lactoferrin; metal transport, iron transport, meta | 96.5 | |
| 1ryo_A | 327 | Serotransferrin; iron transport, metal transport; | 93.34 |
| >3skp_A Serotransferrin; iron binding protein, transferrin receptor, TBP metal binding protein; 1.70A {Homo sapiens} PDB: 3v89_B 1suv_E | Back alignment and structure |
|---|
Probab=100.00 E-value=1e-59 Score=442.52 Aligned_cols=190 Identities=37% Similarity=0.727 Sum_probs=163.2
Q ss_pred CccCCcCCCCccCcCCCCCCCCCCCCCCCcchHhHHHHHhcCCccccCCCchhhhhhhhccCCccCCcccccCCCCCCCc
Q psy3351 1 MKKNSLPDLTHISHLRGKKACFAGVGTQAGWVIPVDVLIRNGGMEVIDCNNHVKSVINYFGPSCAVNALINKYNPIGDNS 80 (276)
Q Consensus 1 vkk~s~~~i~~~~dLkGkksCHtG~g~taGW~~Pv~~L~~~~~i~~~~c~~~~kavs~FFs~SC~PGa~~~~y~~~~~~~ 80 (276)
|||++ .+.+|+||||||+||||++++|||+||++.|+++.. .| ++++||++||+||+. .+
T Consensus 95 VkK~s--~~~tl~dLrGKksCHtg~g~tAGW~iP~g~L~~~~~----~c-----~~s~FFs~sC~PG~~---------~~ 154 (342)
T 3skp_A 95 VKKSA--SDLTWDNLKGKKSCHTAVGRTAGWNIPMGLLYNKIN----HC-----RFDEFFSEGCAPGSK---------KD 154 (342)
T ss_dssp EETTC--SSCCGGGCTTSEEEESCTTCTTTTHHHHHHSGGGCS----TT-----CGGGSSSEEECTTSC---------TT
T ss_pred EEcCC--CCCCHHHcCCCCccCCCCCCccchhhHHHHHhhccC----CC-----CHHHhhhhcccCCCC---------Cc
Confidence 57754 235799999999999999999999999999988632 24 379999999999983 35
Q ss_pred hhhchhccCCCCCCCC--CCCCCCCCccccccceecCCcEEEEechhhHhhhhcccccccccccchhhhhhHHHHHhhhc
Q psy3351 81 DRLCELCIGRVPGEKC--TTADPYAGFEGAFRCLVDKGEVAFLKHTTVQEMIEGRIDACKYSFLGKELKMSFFYFLLLQY 158 (276)
Q Consensus 81 ~nLC~lC~g~~~~~~C--~~~e~Y~G~~GAfRCL~e~GDVAFvkh~tV~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~ 158 (276)
++||+||.|+ +.++| ++.|+||||+||||||+|+||||||||+||.++++|++
T Consensus 155 ~~LC~lC~g~-~~~~C~~~~~e~Y~Gy~GAfrCL~egGDVAFvkh~tV~~~~~g~~------------------------ 209 (342)
T 3skp_A 155 SSLCKLCMGS-GLNLCEPNNKEGYYGYTGAFRCLVEKGDVAFVKHQTVPQNTGGKN------------------------ 209 (342)
T ss_dssp SGGGTTCCCC-GGGTTCSSTTSTTCHHHHHHHHHHHTCSEEEEETTHHHHTSTTSS------------------------
T ss_pred cchhhhcCCC-CCCCCCCCCCCcCcCCcchheeeccCCcEEEEechhHHhhcCCCC------------------------
Confidence 7999999997 35689 47899999999999999999999999999999987654
Q ss_pred cCCcccCCccceeccccccchhhcchhhhhhhcccccccCCCccCeEEecCCCCCccCCCCccceeeeeCCceEEEcCCc
Q psy3351 159 SGGLIEGTGAFRCLVDKGEVAFLKHTTVQEMIEGRIDAYGLTKENFELLCTDGTRQPVDNYQSCNWGQVPSNAVMTTSAK 238 (276)
Q Consensus 159 s~g~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~dfeLLCpdGtr~pv~~~~~Cnl~~vP~~aVvt~~~~ 238 (276)
++.|+.+++++|||||||||+|+||++|++|||+++|||+||+|+++
T Consensus 210 ---------------------------------~~~wa~~~~~~dyeLLC~dGtr~pv~~~~~C~la~vP~~aVv~r~~~ 256 (342)
T 3skp_A 210 ---------------------------------PDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLARAPNHAVVTRKDK 256 (342)
T ss_dssp ---------------------------------CSTTTTTCCGGGEEEECTTSCEEEGGGGGGSCSEEECCCEEEECGGG
T ss_pred ---------------------------------chhhhccCChhhEEEECCCCCcCCCCCCccceEEEccCCeEEecCch
Confidence 23599999999999999999999999999999999999999999854
Q ss_pred chhHHHHHHHHHHHHHHHhCCCCC-----CC--CCCCcceE
Q psy3351 239 STQIRRYYQQFLIKTVQLFGGPVP-----PQ--RTQGKNVI 272 (276)
Q Consensus 239 ~~~~r~~~~~~L~~~~~lfg~~~~-----~~--~~~~~~~~ 272 (276)
...|+++|.++|++||++.. |+ .+.+||||
T Consensus 257 ----~~~i~~~L~~~q~~fg~~~~~~~~~F~lF~s~~kdLL 293 (342)
T 3skp_A 257 ----EACVHKILRQQQHLFGSNVTDCSGNFCLFRSETKDLL 293 (342)
T ss_dssp ----HHHHHHHHHHHHHHHSTTCSCCSSSCCTTCCSSSCSS
T ss_pred ----HHHHHHHHHHHHHHhCcCCCCCCCCccccCCCCCCcc
Confidence 35789999999999999643 44 33468876
|
| >3tod_A Lactotransferrin; C-LOBE, metal binding protein, 1- butyl1-H-pyrazol-5-carboxy hydrolase; HET: NAG XXB; 1.38A {Bos taurus} PDB: 1sdx_A* 3u72_A* 3u8q_A* 3ugw_A* 3uk4_A* 3usd_A* 3v5a_A* 3vdf_A* 4dig_A* 4dxu_A* 4fim_A* 4fjp_A* 4for_A* 4g2z_A* 4grk_A* 2b6d_A* 2b65_A* 2doj_A* 2dp8_A* 2dqv_A* ... | Back alignment and structure |
|---|
| >3mc2_A Inhibitor of carbonic anhydrase; MICA, transferrin superfamily, lyase inhibitor; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >3v83_A Serotransferrin; iron binding domain, iron carrier/transporter, transferrin R serum, metal transport; HET: P6G; 2.10A {Homo sapiens} PDB: 3v8x_B* 3qyt_A* 4h0w_A* 3ve1_B 2hav_A* 3s9l_C* 3s9m_C* 3s9n_C* 2hau_A* 1jnf_A 1h76_A* | Back alignment and structure |
|---|
| >1iej_A Ovotransferrin; iron, metal binding protein; 1.65A {Gallus gallus} SCOP: c.94.1.2 PDB: 1tfa_A 1nft_A 1nnt_A 1ovb_A 1gv8_A 1gvc_A* | Back alignment and structure |
|---|
| >1h45_A Lactoferrin; metal transport, iron transport, metal binding; 1.95A {Homo sapiens} SCOP: c.94.1.2 PDB: 1eh3_A 2pms_A* 1h43_A 1h44_A 1dsn_A 1lct_A 1hse_A 1vfe_A 1l5t_A 1vfd_A 1lgb_C* 1z6v_A 1z6w_A | Back alignment and structure |
|---|
| >1cb6_A Protein (lactoferrin); iron transport, apolactoferrin, conformational change; 2.00A {Homo sapiens} SCOP: c.94.1.2 c.94.1.2 PDB: 1bka_A 1b0l_A 1lfi_A* 1fck_A 1lcf_A* 2bjj_X* 1lfh_A 1n76_A 1lfg_A* 1sqy_A* 1b1x_A 1b7u_A 1b7z_A 1i6b_A 1qjm_A 3cr9_A* 1f9b_A* 1dtz_A 1i6q_A 1jw1_A ... | Back alignment and structure |
|---|
| >2d3i_A Ovotransferrin; aluminum, metal-binding, transport, metal transport; 2.15A {Gallus gallus} SCOP: c.94.1.2 c.94.1.2 PDB: 1ovt_A 1aiv_A* 1n04_A 1ryx_A 1dot_A* 1aov_A* 1iq7_A* | Back alignment and structure |
|---|
| >3v83_A Serotransferrin; iron binding domain, iron carrier/transporter, transferrin R serum, metal transport; HET: P6G; 2.10A {Homo sapiens} PDB: 3v8x_B* 3qyt_A* 4h0w_A* 3ve1_B 2hav_A* 3s9l_C* 3s9m_C* 3s9n_C* 2hau_A* 1jnf_A 1h76_A* | Back alignment and structure |
|---|
| >3mc2_A Inhibitor of carbonic anhydrase; MICA, transferrin superfamily, lyase inhibitor; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2d3i_A Ovotransferrin; aluminum, metal-binding, transport, metal transport; 2.15A {Gallus gallus} SCOP: c.94.1.2 c.94.1.2 PDB: 1ovt_A 1aiv_A* 1n04_A 1ryx_A 1dot_A* 1aov_A* 1iq7_A* | Back alignment and structure |
|---|
| >1blf_A Lactoferrin; transferrin, iron-binding protein, carbohydrate structure; HET: NAG BMA MAN; 2.80A {Bos taurus} SCOP: c.94.1.2 c.94.1.2 PDB: 1lfc_A | Back alignment and structure |
|---|
| >1ryo_A Serotransferrin; iron transport, metal transport; 1.20A {Homo sapiens} SCOP: c.94.1.2 PDB: 1bp5_A 1btj_A 1n84_A 1oqg_A 2o84_X 1fqf_A 1fqe_A 1oqh_A 2o7u_B 1jqf_A 1n7x_A 3fgs_A 1a8e_A 1a8f_A 1suv_C 1dtg_A 1d3k_A 1d4n_A 1n7w_A 1b3e_A ... | Back alignment and structure |
|---|
| >1blf_A Lactoferrin; transferrin, iron-binding protein, carbohydrate structure; HET: NAG BMA MAN; 2.80A {Bos taurus} SCOP: c.94.1.2 c.94.1.2 PDB: 1lfc_A | Back alignment and structure |
|---|
| >1cb6_A Protein (lactoferrin); iron transport, apolactoferrin, conformational change; 2.00A {Homo sapiens} SCOP: c.94.1.2 c.94.1.2 PDB: 1bka_A 1b0l_A 1lfi_A* 1fck_A 1lcf_A* 2bjj_X* 1lfh_A 1n76_A 1lfg_A* 1sqy_A* 1b1x_A 1b7u_A 1b7z_A 1i6b_A 1qjm_A 3cr9_A* 1f9b_A* 1dtz_A 1i6q_A 1jw1_A ... | Back alignment and structure |
|---|
| >3skp_A Serotransferrin; iron binding protein, transferrin receptor, TBP metal binding protein; 1.70A {Homo sapiens} PDB: 3v89_B 1suv_E | Back alignment and structure |
|---|
| >3tod_A Lactotransferrin; C-LOBE, metal binding protein, 1- butyl1-H-pyrazol-5-carboxy hydrolase; HET: NAG XXB; 1.38A {Bos taurus} PDB: 1sdx_A* 3u72_A* 3u8q_A* 3ugw_A* 3uk4_A* 3usd_A* 3v5a_A* 3vdf_A* 4dig_A* 4dxu_A* 4fim_A* 4fjp_A* 4for_A* 4g2z_A* 4grk_A* 2b6d_A* 2b65_A* 2doj_A* 2dp8_A* 2dqv_A* ... | Back alignment and structure |
|---|
| >1iej_A Ovotransferrin; iron, metal binding protein; 1.65A {Gallus gallus} SCOP: c.94.1.2 PDB: 1tfa_A 1nft_A 1nnt_A 1ovb_A 1gv8_A 1gvc_A* | Back alignment and structure |
|---|
| >1h45_A Lactoferrin; metal transport, iron transport, metal binding; 1.95A {Homo sapiens} SCOP: c.94.1.2 PDB: 1eh3_A 2pms_A* 1h43_A 1h44_A 1dsn_A 1lct_A 1hse_A 1vfe_A 1l5t_A 1vfd_A 1lgb_C* 1z6v_A 1z6w_A | Back alignment and structure |
|---|
| >1ryo_A Serotransferrin; iron transport, metal transport; 1.20A {Homo sapiens} SCOP: c.94.1.2 PDB: 1bp5_A 1btj_A 1n84_A 1oqg_A 2o84_X 1fqf_A 1fqe_A 1oqh_A 2o7u_B 1jqf_A 1n7x_A 3fgs_A 1a8e_A 1a8f_A 1suv_C 1dtg_A 1d3k_A 1d4n_A 1n7w_A 1b3e_A ... | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 276 | ||||
| d2d3ia2 | 352 | c.94.1.2 (A:335-686) Ovotransferrin {Chicken (Gall | 1e-32 | |
| d1gv8a_ | 159 | c.94.1.2 (A:) Ovotransferrin {Duck (Anas platyrhyn | 2e-32 | |
| d1gv8a_ | 159 | c.94.1.2 (A:) Ovotransferrin {Duck (Anas platyrhyn | 2e-20 | |
| d1ce2a1 | 333 | c.94.1.2 (A:1-333) Lactoferrin {Domestic water buf | 8e-32 | |
| d1lgbc_ | 159 | c.94.1.2 (C:) Lactoferrin {Human (Homo sapiens) [T | 1e-31 | |
| d1h76a2 | 346 | c.94.1.2 (A:342-687) Transferrin {Pig (Sus scrofa) | 4e-31 | |
| d2b6da1 | 344 | c.94.1.2 (A:342-685) Lactoferrin {Cow (Bos taurus) | 9e-30 | |
| d1eh3a_ | 324 | c.94.1.2 (A:) Lactoferrin {Human (Homo sapiens) [T | 3e-29 | |
| d2hava1 | 325 | c.94.1.2 (A:340-664) Transferrin {Rabbit (Oryctola | 5e-29 | |
| d1ieja_ | 329 | c.94.1.2 (A:) Ovotransferrin {Chicken (Gallus gall | 2e-26 | |
| d1ieja_ | 329 | c.94.1.2 (A:) Ovotransferrin {Chicken (Gallus gall | 2e-18 | |
| d1ryoa_ | 324 | c.94.1.2 (A:) Transferrin {Human (Homo sapiens) [T | 7e-24 | |
| d1ryoa_ | 324 | c.94.1.2 (A:) Transferrin {Human (Homo sapiens) [T | 2e-19 |
| >d2d3ia2 c.94.1.2 (A:335-686) Ovotransferrin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 352 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Periplasmic binding protein-like II superfamily: Periplasmic binding protein-like II family: Transferrin domain: Ovotransferrin species: Chicken (Gallus gallus) [TaxId: 9031]
Score = 120 bits (302), Expect = 1e-32
Identities = 71/250 (28%), Positives = 104/250 (41%), Gaps = 81/250 (32%)
Query: 12 ISHLRGKKACFAGVGTQAGWVIPVDVLIRNGGMEVIDCNNHVKSVINYFGPSCAVNALIN 71
++L+GKK+C VG AGWVIP+ ++ G + YF CA
Sbjct: 111 WNNLKGKKSCHTAVGRTAGWVIPMGLIHNRTG---------TCNFDEYFSEGCA------ 155
Query: 72 KYNPIGDNSDRLCELCIGRVPGEKCTTADPYAGFEGAFRCLVDKGEVAFLKHTTVQEMIE 131
P + RLC+LC G G +C+ E
Sbjct: 156 ---PGSPPNSRLCQLCQGS-------------GGIPPEKCVASSHE-------------- 185
Query: 132 GRIDACKYSFLGKELKMSFFYFLLLQYSGGLIEGTGAFRCLVDKGEVAFLKHTTVQEMIE 191
+Y G TGA RCLV+KG+VAF++H+TV+E
Sbjct: 186 -------------------------KYFGY----TGALRCLVEKGDVAFIQHSTVEENTG 216
Query: 192 GRID---AYGLTKENFELLCTDGTRQPVDNYQSCNWGQVPSNAVMTTSAKSTQIRRYYQQ 248
G+ A L ++FELLCTDG R V +Y+ CN +VP++AV+ K+ +IR ++
Sbjct: 217 GKNKADWAKNLQMDDFELLCTDGRRANVMDYRECNLAEVPTHAVVVRPEKANKIRDLLER 276
Query: 249 FLIKTVQLFG 258
+ FG
Sbjct: 277 QE----KRFG 282
|
| >d1gv8a_ c.94.1.2 (A:) Ovotransferrin {Duck (Anas platyrhynchos) [TaxId: 8839]} Length = 159 | Back information, alignment and structure |
|---|
| >d1gv8a_ c.94.1.2 (A:) Ovotransferrin {Duck (Anas platyrhynchos) [TaxId: 8839]} Length = 159 | Back information, alignment and structure |
|---|
| >d1ce2a1 c.94.1.2 (A:1-333) Lactoferrin {Domestic water buffalo (Bubalus arnee bubalis) [TaxId: 89462]} Length = 333 | Back information, alignment and structure |
|---|
| >d1lgbc_ c.94.1.2 (C:) Lactoferrin {Human (Homo sapiens) [TaxId: 9606]} Length = 159 | Back information, alignment and structure |
|---|
| >d1h76a2 c.94.1.2 (A:342-687) Transferrin {Pig (Sus scrofa) [TaxId: 9823]} Length = 346 | Back information, alignment and structure |
|---|
| >d2b6da1 c.94.1.2 (A:342-685) Lactoferrin {Cow (Bos taurus) [TaxId: 9913]} Length = 344 | Back information, alignment and structure |
|---|
| >d1eh3a_ c.94.1.2 (A:) Lactoferrin {Human (Homo sapiens) [TaxId: 9606]} Length = 324 | Back information, alignment and structure |
|---|
| >d2hava1 c.94.1.2 (A:340-664) Transferrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 325 | Back information, alignment and structure |
|---|
| >d1ieja_ c.94.1.2 (A:) Ovotransferrin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 329 | Back information, alignment and structure |
|---|
| >d1ieja_ c.94.1.2 (A:) Ovotransferrin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 329 | Back information, alignment and structure |
|---|
| >d1ryoa_ c.94.1.2 (A:) Transferrin {Human (Homo sapiens) [TaxId: 9606]} Length = 324 | Back information, alignment and structure |
|---|
| >d1ryoa_ c.94.1.2 (A:) Transferrin {Human (Homo sapiens) [TaxId: 9606]} Length = 324 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 276 | |||
| d1ieja_ | 329 | Ovotransferrin {Chicken (Gallus gallus) [TaxId: 90 | 100.0 | |
| d1ce2a1 | 333 | Lactoferrin {Domestic water buffalo (Bubalus arnee | 100.0 | |
| d1eh3a_ | 324 | Lactoferrin {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d2hava1 | 325 | Transferrin {Rabbit (Oryctolagus cuniculus) [TaxId | 100.0 | |
| d1ryoa_ | 324 | Transferrin {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1gv8a_ | 159 | Ovotransferrin {Duck (Anas platyrhynchos) [TaxId: | 100.0 | |
| d2d3ia2 | 352 | Ovotransferrin {Chicken (Gallus gallus) [TaxId: 90 | 100.0 | |
| d2b6da1 | 344 | Lactoferrin {Cow (Bos taurus) [TaxId: 9913]} | 100.0 | |
| d1lgbc_ | 159 | Lactoferrin {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1h76a2 | 346 | Transferrin {Pig (Sus scrofa) [TaxId: 9823]} | 100.0 | |
| d2hava1 | 325 | Transferrin {Rabbit (Oryctolagus cuniculus) [TaxId | 97.71 | |
| d2d3ia2 | 352 | Ovotransferrin {Chicken (Gallus gallus) [TaxId: 90 | 97.65 | |
| d1gv8a_ | 159 | Ovotransferrin {Duck (Anas platyrhynchos) [TaxId: | 97.59 | |
| d1lgbc_ | 159 | Lactoferrin {Human (Homo sapiens) [TaxId: 9606]} | 97.59 | |
| d2b6da1 | 344 | Lactoferrin {Cow (Bos taurus) [TaxId: 9913]} | 97.47 | |
| d1h76a2 | 346 | Transferrin {Pig (Sus scrofa) [TaxId: 9823]} | 97.45 | |
| d1ieja_ | 329 | Ovotransferrin {Chicken (Gallus gallus) [TaxId: 90 | 97.17 | |
| d1ce2a1 | 333 | Lactoferrin {Domestic water buffalo (Bubalus arnee | 97.11 | |
| d1eh3a_ | 324 | Lactoferrin {Human (Homo sapiens) [TaxId: 9606]} | 97.09 | |
| d1ryoa_ | 324 | Transferrin {Human (Homo sapiens) [TaxId: 9606]} | 96.93 |
| >d1ieja_ c.94.1.2 (A:) Ovotransferrin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Periplasmic binding protein-like II superfamily: Periplasmic binding protein-like II family: Transferrin domain: Ovotransferrin species: Chicken (Gallus gallus) [TaxId: 9031]
Probab=100.00 E-value=1.6e-56 Score=415.76 Aligned_cols=179 Identities=41% Similarity=0.822 Sum_probs=158.5
Q ss_pred CccCCcCCCCccCcCCCCCCCCCCCCCCCcchHhHHHHHhcCCccccCCC--chhhhhhhhccCCccCCcccccCCCCCC
Q psy3351 1 MKKNSLPDLTHISHLRGKKACFAGVGTQAGWVIPVDVLIRNGGMEVIDCN--NHVKSVINYFGPSCAVNALINKYNPIGD 78 (276)
Q Consensus 1 vkk~s~~~i~~~~dLkGkksCHtG~g~taGW~~Pv~~L~~~~~i~~~~c~--~~~kavs~FFs~SC~PGa~~~~y~~~~~ 78 (276)
|||++ .+ +|++||||||||||++++|||++||++|+++++|++..|+ +..+++++||++||+||++
T Consensus 95 vkk~s--~~-~~~~LkGkksCHtG~~~~aGw~~P~~~L~~~~~i~~~~~~~~~~~~~v~~FF~~sC~PG~~--------- 162 (329)
T d1ieja_ 95 VKKGT--EF-TVNDLQGKTSCHTGLGRSAGWNIPIGTLLHRGAIEWEGIESGSVEQAVAKFFSASCVPGAT--------- 162 (329)
T ss_dssp EETTC--CC-CGGGCTTCEEEESCTTCTTTTHHHHHHHHHTTSSCCCCGGGCCHHHHHHHHSSEEECTTCC---------
T ss_pred EecCC--cc-chhhccCCcccccCCCCcchhhHHHHHHHhcCCCCccCCCCccHHHHHHHHhhhhhhcCCC---------
Confidence 46665 44 7999999999999999999999999999999999987443 5678999999999999964
Q ss_pred CchhhchhccCCCCCCCCCCCCCCCCccccccceec-CCcEEEEechhhHhhhhcccccccccccchhhhhhHHHHHhhh
Q psy3351 79 NSDRLCELCIGRVPGEKCTTADPYAGFEGAFRCLVD-KGEVAFLKHTTVQEMIEGRIDACKYSFLGKELKMSFFYFLLLQ 157 (276)
Q Consensus 79 ~~~nLC~lC~g~~~~~~C~~~e~Y~G~~GAfRCL~e-~GDVAFvkh~tV~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~ 157 (276)
.++|||+||.|. +..+|+.+|+||||+||||||+| +||||||+|+||.+++++
T Consensus 163 ~~~~LC~lC~g~-~~~~c~~~~~Y~Gy~GA~rCL~eg~GDVAFvk~~tv~~~~~~------------------------- 216 (329)
T d1ieja_ 163 IEQKLCRQCKGD-PKTKCARNAPYSGYSGAFHCLKDGKGDVAFVKHTTVNENAPD------------------------- 216 (329)
T ss_dssp SCGGGGTTCCSC-TTTTTSTTSTTCHHHHHHHHHHTTSCSEEEEETTHHHHHCTT-------------------------
T ss_pred CCcchhhhcCCC-CcccCCCCCccccccCHHHHHHcCCCcEEEEechhHhhhccc-------------------------
Confidence 358999999987 45789999999999999999999 699999999999988642
Q ss_pred ccCCcccCCccceeccccccchhhcchhhhhhhcccccccCCCccCeEEecCCCCCccCCCCccceeeeeCCceEEEcCC
Q psy3351 158 YSGGLIEGTGAFRCLVDKGEVAFLKHTTVQEMIEGRIDAYGLTKENFELLCTDGTRQPVDNYQSCNWGQVPSNAVMTTSA 237 (276)
Q Consensus 158 ~s~g~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~dfeLLCpdGtr~pv~~~~~Cnl~~vP~~aVvt~~~ 237 (276)
+++||+||||||+|+|+++|++|||+++|+|+||+|++
T Consensus 217 ------------------------------------------~~~dy~lLC~dg~~~~v~~~~~C~l~~~P~~~vv~r~d 254 (329)
T d1ieja_ 217 ------------------------------------------QKDEYELLCLDGSRQPVDNYKTCNWARVAAHAVVARDD 254 (329)
T ss_dssp ------------------------------------------SGGGEEEECTTSCEEEGGGTTTSCSEEEECCEEEECSS
T ss_pred ------------------------------------------cccchhhcCCCCCccCcccCcCCcceeccCceEEECCc
Confidence 25689999999999999999999999999999999976
Q ss_pred cchhHHHHHHHHHHHHHHHhCCCCC
Q psy3351 238 KSTQIRRYYQQFLIKTVQLFGGPVP 262 (276)
Q Consensus 238 ~~~~~r~~~~~~L~~~~~lfg~~~~ 262 (276)
. ..++|+++|..+|++||++.+
T Consensus 255 ~---~~~~i~~~L~~~~~~fg~~~~ 276 (329)
T d1ieja_ 255 N---KVEDIWSFLSKAQSDFGVDTK 276 (329)
T ss_dssp T---THHHHHHHHHHHHHHHSTTCS
T ss_pred h---hHHHHHHHHHHHHHHhcCCCC
Confidence 4 235789999999999998765
|
| >d1ce2a1 c.94.1.2 (A:1-333) Lactoferrin {Domestic water buffalo (Bubalus arnee bubalis) [TaxId: 89462]} | Back information, alignment and structure |
|---|
| >d1eh3a_ c.94.1.2 (A:) Lactoferrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hava1 c.94.1.2 (A:340-664) Transferrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1ryoa_ c.94.1.2 (A:) Transferrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gv8a_ c.94.1.2 (A:) Ovotransferrin {Duck (Anas platyrhynchos) [TaxId: 8839]} | Back information, alignment and structure |
|---|
| >d2d3ia2 c.94.1.2 (A:335-686) Ovotransferrin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2b6da1 c.94.1.2 (A:342-685) Lactoferrin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1lgbc_ c.94.1.2 (C:) Lactoferrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h76a2 c.94.1.2 (A:342-687) Transferrin {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2hava1 c.94.1.2 (A:340-664) Transferrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2d3ia2 c.94.1.2 (A:335-686) Ovotransferrin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1gv8a_ c.94.1.2 (A:) Ovotransferrin {Duck (Anas platyrhynchos) [TaxId: 8839]} | Back information, alignment and structure |
|---|
| >d1lgbc_ c.94.1.2 (C:) Lactoferrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b6da1 c.94.1.2 (A:342-685) Lactoferrin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1h76a2 c.94.1.2 (A:342-687) Transferrin {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ieja_ c.94.1.2 (A:) Ovotransferrin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ce2a1 c.94.1.2 (A:1-333) Lactoferrin {Domestic water buffalo (Bubalus arnee bubalis) [TaxId: 89462]} | Back information, alignment and structure |
|---|
| >d1eh3a_ c.94.1.2 (A:) Lactoferrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ryoa_ c.94.1.2 (A:) Transferrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|