Psyllid ID: psy3351


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270------
MKKNSLPDLTHISHLRGKKACFAGVGTQAGWVIPVDVLIRNGGMEVIDCNNHVKSVINYFGPSCAVNALINKYNPIGDNSDRLCELCIGRVPGEKCTTADPYAGFEGAFRCLVDKGEVAFLKHTTVQEMIEGRIDACKYSFLGKELKMSFFYFLLLQYSGGLIEGTGAFRCLVDKGEVAFLKHTTVQEMIEGRIDAYGLTKENFELLCTDGTRQPVDNYQSCNWGQVPSNAVMTTSAKSTQIRRYYQQFLIKTVQLFGGPVPPQRTQGKNVILFIF
cccccccccccccccccccccccccccccccHHHHHHHHHccccccccccHHHHHHHHHccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccEEEEEEcEEEHHHcccccccccccccccccccccccccccccccccccccccEEccccccEEEEEEEEEEEHHccccccccccccccEEEcccccccccccccccccccccccEEEEccccHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEc
cccccccccccHHHccccccccccccccccccccHHHHHHcccccccccccHHHHHHHHHcccccccccccccccccccccHHHHHHcccccccccccccccccccHHHHHHHccccEEEEEccHHHHcccccccccccHHHHHHccccccEEEcccccccccccHHHHHHHHHcccEEEEEccHHHHHcHHHHHHEEEHHccEEEEEcccEEEEHHHHHHcccEEEEccEEEEEccccHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEc
mkknslpdlthishlrgkkacfagvgtqagwvipvdvlirnggmevidcnNHVKSVINYFGPSCAVNALINkynpigdnsdrLCELcigrvpgekcttadpyagfegAFRCLVDKGEVAFLKHTTVQEMIEGRIDACKYSFLGKELKMSFFYFLLLQYsggliegtgaFRCLVDKGEVAFLKHTTVQEMIEGRIDAYGLTKENFELLctdgtrqpvdnyqscnwgqvpsnavmttsakSTQIRRYYQQFLIKTVqlfggpvppqrtqgknvilfif
mkknslpdltHISHLRGKKACFAGVGTQAGWVIPVDVLIRNGGMEVIDCNNHVKSVINYFGPSCAVNALINKYNPIGDNSDRLCELCIGRVPGEKCTTADPYAGFEGAFRCLVDKGEVAFLKHTTVQEMIEGRIDACKYSFLGKELKMSFFYFLLLQYSGGLIEGTGAFRCLVDKGEVAFLKHTTVQEMIEGRIDAYGLTKENFELLCTDGTRQPVDNYQSCNWGQVPSNAVMTTSAKSTQIRRYYQQFLIKTVQlfggpvppqrtqgknvilfif
MKKNSLPDLTHISHLRGKKACFAGVGTQAGWVIPVDVLIRNGGMEVIDCNNHVKSVINYFGPSCAVNALINKYNPIGDNSDRLCELCIGRVPGEKCTTADPYAGFEGAFRCLVDKGEVAFLKHTTVQEMIEGRIDACKYSFLGKELKMSFFYFLLLQYSGGLIEGTGAFRCLVDKGEVAFLKHTTVQEMIEGRIDAYGLTKENFELLCTDGTRQPVDNYQSCNWGQVPSNAVMTTSAKSTQIRRYYQQFLIKTVQLFGGPVPPQRTQGKNVILFIF
**********HISHLRGKKACFAGVGTQAGWVIPVDVLIRNGGMEVIDCNNHVKSVINYFGPSCAVNALINKYNPIGDNSDRLCELCIGRVPGEKCTTADPYAGFEGAFRCLVDKGEVAFLKHTTVQEMIEGRIDACKYSFLGKELKMSFFYFLLLQYSGGLIEGTGAFRCLVDKGEVAFLKHTTVQEMIEGRIDAYGLTKENFELLCTDGTRQPVDNYQSCNWGQVPSNAVMTTSAKSTQIRRYYQQFLIKTVQLFGGPVPP**TQGKNVILFI*
*******DLTHISHLRGKKACFAGVGTQAGWVIPVDVLIRNGGMEVIDCNNHVKSVINYFGPSCAVNALINKYNPIGDNSDRLCELCIGRVP*EKCTTADPYAGFEGAFRCLVDKGEVAFLKHTTVQEMIEGRIDACKYSFLGKELKMSFFYFLLLQYSGGLIEGTGAFRCLVDKGEVAFLKHTTVQEMIEGRID*YGLTKENFELLCTDGTRQPVDNYQSCNWGQVPSNAVMTTSAKSTQIRRYYQQFLIKT****************NVILFIF
MKKNSLPDLTHISHLRGKKACFAGVGTQAGWVIPVDVLIRNGGMEVIDCNNHVKSVINYFGPSCAVNALINKYNPIGDNSDRLCELCIGRVPGEKCTTADPYAGFEGAFRCLVDKGEVAFLKHTTVQEMIEGRIDACKYSFLGKELKMSFFYFLLLQYSGGLIEGTGAFRCLVDKGEVAFLKHTTVQEMIEGRIDAYGLTKENFELLCTDGTRQPVDNYQSCNWGQVPSNAVMTTSAKSTQIRRYYQQFLIKTVQLFGGPVPPQRTQGKNVILFIF
*****LPDLTHISHLRGKKACFAGVGTQAGWVIPVDVLIRNGGMEVIDCNNHVKSVINYFGPSCAVNALINKYNPIGDNSDRLCELCIGRVPGEKCTTADPYAGFEGAFRCLVDKGEVAFLKHTTVQEMIEGRIDACKYSFLGKELKMSFFYFLLLQYSGGLIEGTGAFRCLVDKGEVAFLKHTTVQEMIEGRIDAYGLTKENFELLCTDGTRQPVDNYQSCNWGQVPSNAVMTTSAKSTQIRRYYQQFLIKTVQLFGGPVPPQRTQGKNVILFIF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKNSLPDLTHISHLRGKKACFAGVGTQAGWVIPVDVLIRNGGMEVIDCNNHVKSVINYFGPSCAVNALINKYNPIGDNSDRLCELCIGRVPGEKCTTADPYAGFEGAFRCLVDKGEVAFLKHTTVQEMIEGRIDACKYSFLGKELKMSFFYFLLLQYSGGLIEGTGAFRCLVDKGEVAFLKHTTVQEMIEGRIDAYGLTKENFELLCTDGTRQPVDNYQSCNWGQVPSNAVMTTSAKSTQIRRYYQQFLIKTVQLFGGPVPPQRTQGKNVILFIF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query276 2.2.26 [Sep-21-2011]
Q29545704 Inhibitor of carbonic anh yes N/A 0.637 0.25 0.321 1e-22
P20233702 Serotransferrin-A OS=Xeno N/A N/A 0.637 0.250 0.316 1e-21
Q02942726 Transferrin OS=Blaberus d N/A N/A 0.626 0.238 0.314 2e-20
Q6PGT3701 Serotransferrin-B OS=Xeno N/A N/A 0.605 0.238 0.316 9e-20
Q9DBD0700 Inhibitor of carbonic anh yes N/A 0.597 0.235 0.299 3e-19
P31226844 Saxiphilin OS=Lithobates N/A N/A 0.568 0.186 0.302 4e-19
P02789705 Ovotransferrin OS=Gallus yes N/A 0.583 0.228 0.295 8e-19
Q921I1697 Serotransferrin OS=Mus mu no N/A 0.594 0.235 0.296 2e-18
Q501K5703 Serotransferrin OS=Xenopu no N/A 0.601 0.236 0.293 2e-17
P08582738 Melanotransferrin OS=Homo yes N/A 0.652 0.243 0.306 4e-17
>sp|Q29545|ICA_PIG Inhibitor of carbonic anhydrase OS=Sus scrofa GN=ICA PE=1 SV=1 Back     alignment and function desciption
 Score =  106 bits (265), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 84/261 (32%), Positives = 106/261 (40%), Gaps = 85/261 (32%)

Query: 3   KNSLPDLTHISHLRGKKACFAGVGTQAGWVIPVDVLIRNGGMEVIDCNNHVKSVINYFGP 62
           K S  DLT  S LRGKK+C   VGT AGW+IP+  +    G   +D          +F  
Sbjct: 455 KKSDADLTWNS-LRGKKSCHIAVGTSAGWIIPMGFIYNQTGSCKLD---------EFFSQ 504

Query: 63  SCAVNALINKYNPIGDNSDRLCELCIGRVPGEKCTTADP-----YAGFEGAFRCLVDKGE 117
           SCA         P  D   RLC LC G + G+   T  P     Y GF GA RCLV+KG+
Sbjct: 505 SCA---------PGSDPESRLCALCSGSISGQPAHTCAPNSHEGYHGFSGALRCLVEKGD 555

Query: 118 VAFLKHTTVQEMIEGRIDACKYSFLGKELKMSFFYFLLLQYSGGLIEGTGAFRCLVDKGE 177
           VAF+KH TV +  +GR          K+LK   F  L                       
Sbjct: 556 VAFVKHPTVLQNTDGR----NPEAWAKDLKQEDFQLL----------------------- 588

Query: 178 VAFLKHTTVQEMIEGRIDAYGLTKENFELLCTDGTRQPVDNYQSCNWGQVPSNAVMTTSA 237
                                         C DGTR+PV   QSC+   VPS+AV++   
Sbjct: 589 ------------------------------CPDGTRKPVTEAQSCHLAAVPSHAVVSRKD 618

Query: 238 KSTQIRRYYQQFLIKTVQLFG 258
           K+  +RR     L    +LFG
Sbjct: 619 KADFVRR----MLFNQQELFG 635




Inhibitor for carbonic anhydrase 2 (CA2). Does not bind iron ions.
Sus scrofa (taxid: 9823)
>sp|P20233|TRFEA_XENLA Serotransferrin-A OS=Xenopus laevis GN=tf-a PE=2 SV=3 Back     alignment and function description
>sp|Q02942|TRF_BLADI Transferrin OS=Blaberus discoidalis PE=1 SV=1 Back     alignment and function description
>sp|Q6PGT3|TRFEB_XENLA Serotransferrin-B OS=Xenopus laevis GN=tf-b PE=2 SV=1 Back     alignment and function description
>sp|Q9DBD0|ICA_MOUSE Inhibitor of carbonic anhydrase OS=Mus musculus GN=Ica PE=1 SV=1 Back     alignment and function description
>sp|P31226|SAX_LITCT Saxiphilin OS=Lithobates catesbeiana PE=1 SV=3 Back     alignment and function description
>sp|P02789|TRFE_CHICK Ovotransferrin OS=Gallus gallus PE=1 SV=2 Back     alignment and function description
>sp|Q921I1|TRFE_MOUSE Serotransferrin OS=Mus musculus GN=Tf PE=1 SV=1 Back     alignment and function description
>sp|Q501K5|TRFE_XENTR Serotransferrin OS=Xenopus tropicalis GN=tf PE=2 SV=1 Back     alignment and function description
>sp|P08582|TRFM_HUMAN Melanotransferrin OS=Homo sapiens GN=MFI2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query276
206114237 823 transferrin 2 [Aedes aegypti] 0.710 0.238 0.466 2e-63
170027798 820 lactotransferrin [Culex quinquefasciatus 0.710 0.239 0.470 2e-63
157130994 806 transferrin [Aedes aegypti] gi|108871702 0.710 0.243 0.463 1e-62
157130996 784 transferrin [Aedes aegypti] gi|108871703 0.710 0.25 0.463 1e-62
332018468 876 Melanotransferrin [Acromyrmex echinatior 0.713 0.224 0.482 7e-58
321464063 787 hypothetical protein DAPPUDRAFT_306921 [ 0.771 0.270 0.423 6e-57
383856018 825 PREDICTED: melanotransferrin-like [Megac 0.717 0.24 0.461 7e-57
345491749 832 PREDICTED: melanotransferrin [Nasonia vi 0.253 0.084 0.692 1e-55
307203800 902 Ovotransferrin [Harpegnathos saltator] 0.467 0.143 0.703 6e-55
350414165 823 PREDICTED: melanotransferrin-like [Bombu 0.467 0.156 0.688 4e-53
>gi|206114237|gb|ACI05249.1| transferrin 2 [Aedes aegypti] Back     alignment and taxonomy information
 Score =  248 bits (634), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 120/257 (46%), Positives = 159/257 (61%), Gaps = 61/257 (23%)

Query: 1   MKKNSLPDLTHISHLRGKKACFAGVGTQAGWVIPVDVLIRNGGMEVIDCNNHVKSVINYF 60
           +KK+SL ++T + HL+GKKACF+ VG+ AGW++P+  L R GGME+ DCNNHVK+  +YF
Sbjct: 126 IKKDSLREVTSLRHLKGKKACFSWVGSYAGWIVPIYTLQREGGMEITDCNNHVKTATDYF 185

Query: 61  GPSCAVNALINKYNPIGDNSDRLCELCIGRVPGEKCTTADPYAGFEGAFRCLVDKGEVAF 120
           GPSCAVNAL++KYNPIGDNSD+LC LC G+VPG KCT +DPYAGFEGAF+CL++ G+VAF
Sbjct: 186 GPSCAVNALVDKYNPIGDNSDKLCSLCTGKVPGGKCTPSDPYAGFEGAFQCLLEAGDVAF 245

Query: 121 LKHTTVQEMIEGRIDACKYSFLGKELKMSFFYFLLLQYSGGLIEGTGAFRCLVDKGEVAF 180
           LKHTTV EM+E                             GL+ G               
Sbjct: 246 LKHTTVNEMVE----------------------------SGLVHG--------------- 262

Query: 181 LKHTTVQEMIEGRIDAYGLTKENFELLCTDGTRQPVDNYQSCNWGQVPSNAVMTTSAKST 240
                             +T + FELLC DG+RQPV  Y+ C+WG   S+A++ +SA+ST
Sbjct: 263 ------------------VTADQFELLCKDGSRQPVSEYRQCHWGLAQSHAMVVSSARST 304

Query: 241 QIRRYYQQFLIKTVQLF 257
             RR Y++F  + V L+
Sbjct: 305 AERRRYKKFFTQVVNLY 321




Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|170027798|ref|XP_001841784.1| lactotransferrin [Culex quinquefasciatus] gi|167862354|gb|EDS25737.1| lactotransferrin [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157130994|ref|XP_001662114.1| transferrin [Aedes aegypti] gi|108871702|gb|EAT35927.1| AAEL011949-PB [Aedes aegypti] Back     alignment and taxonomy information
>gi|157130996|ref|XP_001662115.1| transferrin [Aedes aegypti] gi|108871703|gb|EAT35928.1| AAEL011949-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|332018468|gb|EGI59058.1| Melanotransferrin [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|321464063|gb|EFX75074.1| hypothetical protein DAPPUDRAFT_306921 [Daphnia pulex] Back     alignment and taxonomy information
>gi|383856018|ref|XP_003703507.1| PREDICTED: melanotransferrin-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|345491749|ref|XP_001601375.2| PREDICTED: melanotransferrin [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307203800|gb|EFN82736.1| Ovotransferrin [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|350414165|ref|XP_003490226.1| PREDICTED: melanotransferrin-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query276
FB|FBgn0036299 819 Tsf2 "Transferrin 2" [Drosophi 0.474 0.159 0.580 3.6e-61
MGI|MGI:98821697 Trf "transferrin" [Mus musculu 0.326 0.129 0.453 5.8e-35
UNIPROTKB|J3KN47 571 TF "Serotransferrin" [Homo sap 0.413 0.199 0.377 9.1e-35
UNIPROTKB|P02789 705 P02789 "Ovotransferrin" [Gallu 0.387 0.151 0.4 1.2e-34
UNIPROTKB|P02787 698 TF "Serotransferrin" [Homo sap 0.413 0.163 0.377 1.9e-34
UNIPROTKB|G3X6N3 704 TF "Serotransferrin" [Bos taur 0.427 0.167 0.352 1.3e-32
UNIPROTKB|Q29443 704 TF "Serotransferrin" [Bos taur 0.427 0.167 0.352 1.6e-32
RGD|3845 698 Tf "transferrin" [Rattus norve 0.420 0.166 0.360 2.5e-32
UNIPROTKB|F1SQX4736 MFI2 "Uncharacterized protein" 0.449 0.168 0.411 1.4e-17
MGI|MGI:1919025700 1300017J02Rik "RIKEN cDNA 1300 0.322 0.127 0.468 5.2e-32
FB|FBgn0036299 Tsf2 "Transferrin 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 462 (167.7 bits), Expect = 3.6e-61, Sum P(2) = 3.6e-61
 Identities = 76/131 (58%), Positives = 106/131 (80%)

Query:     1 MKKNSLPDLTHISHLRGKKACFAGVGTQAGWVIPVDVLIRNGGMEVIDCNNHVKSVINYF 60
             +KK SLPDL ++  +R K+ CF  VG+ AGW++P+  L R GGMEV+DCNN VK+  +YF
Sbjct:   127 IKKGSLPDLNNLRDMRNKRVCFPWVGSLAGWIVPIHTLQREGGMEVVDCNNQVKTAASYF 186

Query:    61 GPSCAVNALINKYNPIGDNSDRLCELCIGRVPGEKCTTADPYAGFEGAFRCLVDKGEVAF 120
               SCAV +L +K+NPIGDNSD+LC LC G++PG +C++ADPY G+EGAF+CL++KG+VAF
Sbjct:   187 NNSCAVYSLSDKHNPIGDNSDKLCTLCTGKIPGGRCSSADPYFGYEGAFKCLLEKGDVAF 246

Query:   121 LKHTTVQEMIE 131
             L+H+TV EM++
Sbjct:   247 LRHSTVNEMLQ 257


GO:0005381 "iron ion transmembrane transporter activity" evidence=ISS
GO:0005576 "extracellular region" evidence=ISS
GO:0008199 "ferric iron binding" evidence=IEA
GO:0006879 "cellular iron ion homeostasis" evidence=IEA
GO:0006826 "iron ion transport" evidence=IEA
GO:0019991 "septate junction assembly" evidence=IMP
GO:0005506 "iron ion binding" evidence=IDA
GO:0046658 "anchored to plasma membrane" evidence=IDA
GO:0055037 "recycling endosome" evidence=IPI
GO:0005918 "septate junction" evidence=IPI
GO:0005769 "early endosome" evidence=IPI
MGI|MGI:98821 Trf "transferrin" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|J3KN47 TF "Serotransferrin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P02789 P02789 "Ovotransferrin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P02787 TF "Serotransferrin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3X6N3 TF "Serotransferrin" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q29443 TF "Serotransferrin" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|3845 Tf "transferrin" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SQX4 MFI2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1919025 1300017J02Rik "RIKEN cDNA 1300017J02 gene" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query276
smart00094332 smart00094, TR_FER, Transferrin 3e-40
pfam00405328 pfam00405, Transferrin, Transferrin 1e-21
pfam00405328 pfam00405, Transferrin, Transferrin 3e-21
>gnl|CDD|214514 smart00094, TR_FER, Transferrin Back     alignment and domain information
 Score =  141 bits (358), Expect = 3e-40
 Identities = 78/280 (27%), Positives = 110/280 (39%), Gaps = 81/280 (28%)

Query: 3   KNSLPDLTHISHLRGKKACFAGVGTQAGWVIPVDVLIRNGGMEVIDCNNHVKSVINYFGP 62
           K      T  + LRGKK+C  GVG  AGW IP+ +L     +   +C    K+V  +F  
Sbjct: 93  KKGSAIFT-WNQLRGKKSCHTGVGRTAGWNIPMGLLYNKLVIRPPNCPFE-KAVSKFFSA 150

Query: 63  SCAVNALINKYNPIGDNSDRLCELCIGRVPGEKCTTADPYAGFEGAFRCLVDKGEVAFLK 122
           SCA  A         D +  LC LC                   G  +C     E     
Sbjct: 151 SCAPGA------DKPDPNSNLCALCA------------------GDNKCACSSHE----- 181

Query: 123 HTTVQEMIEGRIDACKYSFLGKELKMSFFYFLLLQYSGGLIEGTGAFRCLVD-KGEVAFL 181
                                              Y G     +GAFRCL +  G+VAF+
Sbjct: 182 ----------------------------------PYYGY----SGAFRCLAEGAGDVAFV 203

Query: 182 KHTTVQEMIEGRID---AYGLTKENFELLCTDGTRQPVDNYQSCNWGQVPSNAVMTTSAK 238
           KH+TV E  +G+     A  L ++++ELLC DGTR+PV  Y++C+  +VPS+AV+    K
Sbjct: 204 KHSTVFENTDGKNGADWAKNLKRDDYELLCLDGTRKPVTEYKNCHLARVPSHAVVARKDK 263

Query: 239 STQIRRYYQQFLIKTVQLFGGPVPPQ----RTQGKNVILF 274
              +       L+   Q FG   P       +     +LF
Sbjct: 264 KEDVI----WELLNQQQKFGKDKPSLFQLFGSPTGKDLLF 299


Length = 332

>gnl|CDD|215903 pfam00405, Transferrin, Transferrin Back     alignment and domain information
>gnl|CDD|215903 pfam00405, Transferrin, Transferrin Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 276
smart00094332 TR_FER Transferrin. 100.0
PF00405330 Transferrin: Transferrin; InterPro: IPR001156 Tran 100.0
smart00094332 TR_FER Transferrin. 97.89
PF00405330 Transferrin: Transferrin; InterPro: IPR001156 Tran 97.26
COG3221299 PhnD ABC-type phosphate/phosphonate transport syst 96.61
PF12974243 Phosphonate-bd: ABC transporter, phosphonate, peri 87.09
>smart00094 TR_FER Transferrin Back     alignment and domain information
Probab=100.00  E-value=1.6e-59  Score=440.46  Aligned_cols=200  Identities=41%  Similarity=0.751  Sum_probs=171.3

Q ss_pred             CccCCcCCCCccCcCCCCCCCCCCCCCCCcchHhHHHHHhcCCccccCCCchhhhhhhhccCCccCCcccccCCCCCCCc
Q psy3351           1 MKKNSLPDLTHISHLRGKKACFAGVGTQAGWVIPVDVLIRNGGMEVIDCNNHVKSVINYFGPSCAVNALINKYNPIGDNS   80 (276)
Q Consensus         1 vkk~s~~~i~~~~dLkGkksCHtG~g~taGW~~Pv~~L~~~~~i~~~~c~~~~kavs~FFs~SC~PGa~~~~y~~~~~~~   80 (276)
                      |||+|  .|.+|+||||||+||||+++++||++|++.|+++|+|++.+|+ ..++|++||++||+||++.+.|      +
T Consensus        92 Vkk~S--~i~sl~dLkGKksChtg~~stsGw~iP~~~L~~~g~i~~~~~~-~~~avs~fFs~sC~PG~~~~~~------~  162 (332)
T smart00094       92 VKKGS--AIFTWNQLRGKKSCHTGVGRTAGWNIPMGLLYNKLVIRPPNCP-FEKAVSKFFSASCAPGADKPDP------N  162 (332)
T ss_pred             EECCC--CCCCHHHhCCCceecCCCCCcchhHHHHHHHHHcCCCCCCCCc-HHHHHHHHhhccccCCCCCCCC------c
Confidence            57777  6789999999999999999999999999999999999998886 5789999999999999976544      4


Q ss_pred             hhhchhccCCCCCCCC--CCCCCCCCccccccceec-CCcEEEEechhhHhhhhcccccccccccchhhhhhHHHHHhhh
Q psy3351          81 DRLCELCIGRVPGEKC--TTADPYAGFEGAFRCLVD-KGEVAFLKHTTVQEMIEGRIDACKYSFLGKELKMSFFYFLLLQ  157 (276)
Q Consensus        81 ~nLC~lC~g~~~~~~C--~~~e~Y~G~~GAfRCL~e-~GDVAFvkh~tV~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~  157 (276)
                      +|||+||.|+   .+|  +++|+||||+||||||+| +||||||||+||.+++++++                       
T Consensus       163 ~~LC~lC~g~---~~C~~~~~e~Y~Gy~GA~rCL~eg~GdVAFvk~~tv~~~~~~~~-----------------------  216 (332)
T smart00094      163 SNLCALCAGD---NKCACSSHEPYYGYSGAFRCLAEGAGDVAFVKHSTVFENTDGKN-----------------------  216 (332)
T ss_pred             hhhHhhcCCC---CccCCCCCCcccCcchhheeeccCCccEEEEecccHHhhcCCCC-----------------------
Confidence            7999999997   688  788999999999999999 69999999999999987653                       


Q ss_pred             ccCCcccCCccceeccccccchhhcchhhhhhhcccccccCCCccCeEEecCCCCCccCCCCccceeeeeCCceEEEcCC
Q psy3351         158 YSGGLIEGTGAFRCLVDKGEVAFLKHTTVQEMIEGRIDAYGLTKENFELLCTDGTRQPVDNYQSCNWGQVPSNAVMTTSA  237 (276)
Q Consensus       158 ~s~g~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~dfeLLCpdGtr~pv~~~~~Cnl~~vP~~aVvt~~~  237 (276)
                                                        ++.|+.+++++||+||||||+|+||++|++||||++|||+||+|++
T Consensus       217 ----------------------------------~~~wa~~~~~~dy~lLC~dg~r~pi~~~~~C~la~~P~~~vv~~~~  262 (332)
T smart00094      217 ----------------------------------GADWAKNLKRDDYELLCLDGTRKPVTEYKNCHLARVPSHAVVARKD  262 (332)
T ss_pred             ----------------------------------ccccccccCccceEEECCCCCcCCCccCCcceeeeccCCeEEeccc
Confidence                                              2458999999999999999999999999999999999999999986


Q ss_pred             cchhHHHHHHHHHHHHHHHhCCCCC--CC---CCCCcceEE
Q psy3351         238 KSTQIRRYYQQFLIKTVQLFGGPVP--PQ---RTQGKNVIL  273 (276)
Q Consensus       238 ~~~~~r~~~~~~L~~~~~lfg~~~~--~~---~~~~~~~~~  273 (276)
                      .   ....++ .|+.++++||++.+  ++   .+.|||||.
T Consensus       263 ~---~~~~~~-~ll~~~~~~g~~~~~~f~lf~s~~~kdLlF  299 (332)
T smart00094      263 K---KEDVIW-ELLNQQQKFGKDKPSLFQLFGSPTGKDLLF  299 (332)
T ss_pred             c---hHHHHH-HHHHHHHHhccCCCCccccccCCCCCccee
Confidence            4   223454 45555558887633  22   345788753



>PF00405 Transferrin: Transferrin; InterPro: IPR001156 Transferrins are eukaryotic iron-binding glycoproteins that control the level of free iron in biological fluids [] Back     alignment and domain information
>smart00094 TR_FER Transferrin Back     alignment and domain information
>PF00405 Transferrin: Transferrin; InterPro: IPR001156 Transferrins are eukaryotic iron-binding glycoproteins that control the level of free iron in biological fluids [] Back     alignment and domain information
>COG3221 PhnD ABC-type phosphate/phosphonate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF12974 Phosphonate-bd: ABC transporter, phosphonate, periplasmic substrate-binding protein ; PDB: 3N5L_B 3QUJ_C 3P7I_A 3QK6_A 3S4U_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query276
3mc2_A687 Crystal Structure Of The Murine Inhibitor Of Carbon 3e-20
3mc2_A 687 Crystal Structure Of The Murine Inhibitor Of Carbon 5e-10
2d3i_A686 Crystal Structure Of Aluminum-Bound Ovotransferrin 6e-20
2d3i_A 686 Crystal Structure Of Aluminum-Bound Ovotransferrin 6e-13
1n04_A686 Diferric Chicken Serum Transferrin At 2.8 A Resolut 7e-20
1n04_A 686 Diferric Chicken Serum Transferrin At 2.8 A Resolut 6e-13
1iq7_A345 Ovotransferrin, C-Terminal Lobe, Apo Form Length = 8e-20
1h76_A696 The Crystal Structure Of Diferric Porcine Serum Tra 3e-18
1nft_A329 Ovotransferrin, N-Terminal Lobe, Iron Loaded Open F 5e-18
1nft_A329 Ovotransferrin, N-Terminal Lobe, Iron Loaded Open F 5e-13
1iej_A332 Ovotransferrin, N-Terminal Lobe, Holo Form, At 1.65 9e-18
1iej_A332 Ovotransferrin, N-Terminal Lobe, Holo Form, At 1.65 5e-13
1nnt_A328 Structural Evidence For A Ph-Sensitive Di-Lysine Tr 1e-17
1nnt_A328 Structural Evidence For A Ph-Sensitive Di-Lysine Tr 5e-13
1gv8_A159 18 Kda Fragment Of N-Ii Domain Of Duck Ovotransferr 2e-17
1gv8_A159 18 Kda Fragment Of N-Ii Domain Of Duck Ovotransferr 7e-14
1gvc_A157 18kda N-Ii Domain Fragment Of Duck Ovotransferrin + 2e-17
1gvc_A157 18kda N-Ii Domain Fragment Of Duck Ovotransferrin + 1e-13
1aov_A 686 Apo Duck Ovotransferrin Length = 686 4e-17
1aov_A686 Apo Duck Ovotransferrin Length = 686 4e-16
1ovb_A159 The Mechanism Of Iron Uptake By Transferrins: The S 5e-17
1ovb_A159 The Mechanism Of Iron Uptake By Transferrins: The S 2e-13
1oqh_A337 Crystal Structure Of The R124a Mutant Of The N-lobe 2e-16
1oqh_A337 Crystal Structure Of The R124a Mutant Of The N-lobe 3e-13
1suv_C329 Structure Of Human Transferrin Receptor-transferrin 2e-16
1suv_C329 Structure Of Human Transferrin Receptor-transferrin 2e-13
1jqf_A334 Human Transferrin N-Lobe Mutant H249q Length = 334 2e-16
1jqf_A334 Human Transferrin N-Lobe Mutant H249q Length = 334 3e-13
1ryo_A327 Human Serum Transferrin, N-Lobe Bound With Oxalate 2e-16
1ryo_A327 Human Serum Transferrin, N-Lobe Bound With Oxalate 3e-13
1n7x_A331 Human Serum Transferrin, N-Lobe Y45e Mutant Length 2e-16
1n7x_A331 Human Serum Transferrin, N-Lobe Y45e Mutant Length 2e-13
1fqf_A331 Crystal Structures Of Mutant (K296a) That Abolish T 2e-16
1fqf_A331 Crystal Structures Of Mutant (K296a) That Abolish T 3e-13
1n84_A331 Human Serum Transferrin, N-Lobe Length = 331 2e-16
1n84_A331 Human Serum Transferrin, N-Lobe Length = 331 3e-13
1n7w_A331 Crystal Structure Of Human Serum Transferrin, N-Lob 2e-16
1n7w_A331 Crystal Structure Of Human Serum Transferrin, N-Lob 3e-13
1oqg_A337 Crystal Structure Of The D63e Mutant Of The N-Lobe 2e-16
1oqg_A337 Crystal Structure Of The D63e Mutant Of The N-Lobe 3e-13
1bp5_A337 Human Serum Transferrin, Recombinant N-Terminal Lob 2e-16
1bp5_A337 Human Serum Transferrin, Recombinant N-Terminal Lob 3e-13
2hav_A 676 Apo-Human Serum Transferrin (Glycosylated) Length = 2e-16
2hav_A676 Apo-Human Serum Transferrin (Glycosylated) Length = 1e-15
3qyt_A 679 Diferric Bound Human Serum Transferrin Length = 679 2e-16
3qyt_A679 Diferric Bound Human Serum Transferrin Length = 679 1e-15
4h0w_A 679 Bismuth Bound Human Serum Transferrin Length = 679 2e-16
4h0w_A679 Bismuth Bound Human Serum Transferrin Length = 679 1e-15
3ve1_B 679 The 2.9 Angstrom Crystal Structure Of Transferrin B 2e-16
3ve1_B679 The 2.9 Angstrom Crystal Structure Of Transferrin B 1e-15
3v83_A 698 The 2.1 Angstrom Crystal Structure Of Diferric Huma 3e-16
3v83_A698 The 2.1 Angstrom Crystal Structure Of Diferric Huma 1e-15
1dtg_A334 Human Transferrin N-Lobe Mutant H249e Length = 334 3e-16
1dtg_A334 Human Transferrin N-Lobe Mutant H249e Length = 334 6e-14
1b3e_A330 Human Serum Transferrin, N-Terminal Lobe, Expressed 3e-16
1b3e_A330 Human Serum Transferrin, N-Terminal Lobe, Expressed 5e-14
3s9l_C 693 Complex Between Transferrin Receptor 1 And Transfer 3e-16
3s9l_C693 Complex Between Transferrin Receptor 1 And Transfer 1e-15
1d3k_A329 Human Serum Transferrin Length = 329 4e-16
1d3k_A329 Human Serum Transferrin Length = 329 6e-13
2hau_A 676 Apo-Human Serum Transferrin (Non-Glycosylated) Leng 5e-16
2hau_A676 Apo-Human Serum Transferrin (Non-Glycosylated) Leng 1e-15
3fgs_A337 Crystal Structure Of G65rK206E DOUBLE MUTANT OF THE 6e-16
3fgs_A337 Crystal Structure Of G65rK206E DOUBLE MUTANT OF THE 7e-13
2o7u_B337 Crystal Structure Of K206eK296E MUTANT OF THE N-Ter 6e-16
2o7u_B337 Crystal Structure Of K206eK296E MUTANT OF THE N-Ter 7e-13
2o84_X337 Crystal Structure Of K206e Mutant Of N-Lobe Human T 6e-16
2o84_X337 Crystal Structure Of K206e Mutant Of N-Lobe Human T 7e-13
1fqe_A331 Crystal Structures Of Mutant (K206a) That Abolish T 8e-16
1fqe_A331 Crystal Structures Of Mutant (K206a) That Abolish T 1e-12
3v89_B343 The Crystal Structure Of Transferrin Binding Protei 1e-15
3skp_A342 The Structure Of Apo-Human Transferrin C-Lobe With 1e-15
1d4n_A329 Human Serum Transferrin Length = 329 1e-15
1d4n_A329 Human Serum Transferrin Length = 329 2e-12
1sdx_A335 Crystal Structure Of The Zinc Saturated C-Terminal 3e-15
1nkx_A348 Crystal Structure Of A Proteolytically Generated Fu 3e-15
2p1s_A344 Crystal Structure Of The C-Terminal Lobe Of Bovine 3e-15
2b65_A345 Crystal Structure Of The Complex Of C-Lobe Of Bovin 4e-15
1b1x_A689 Structure Of Diferric Mare Lactoferrin At 2.62a Res 4e-15
1b1x_A 689 Structure Of Diferric Mare Lactoferrin At 2.62a Res 5e-10
1f9b_A695 Melanin Protein Interaction: X-Ray Structure Of The 4e-15
1f9b_A 695 Melanin Protein Interaction: X-Ray Structure Of The 1e-09
1ce2_A689 Structure Of Diferric Buffalo Lactoferrin At 2.5a R 8e-15
1ce2_A 689 Structure Of Diferric Buffalo Lactoferrin At 2.5a R 1e-11
1biy_A689 Structure Of Diferric Buffalo Lactoferrin Length = 9e-15
1biy_A 689 Structure Of Diferric Buffalo Lactoferrin Length = 1e-11
1blf_A689 Structure Of Diferric Bovine Lactoferrin At 2.8 Ang 2e-14
1blf_A 689 Structure Of Diferric Bovine Lactoferrin At 2.8 Ang 9e-12
1jnf_A676 Rabbit Serum Transferrin At 2.6 A Resolution Length 5e-14
1suv_E345 Structure Of Human Transferrin Receptor-transferrin 5e-14
1tfd_A304 High-Resolution X-Ray Studies On Rabbit Serum Trans 1e-13
1tfd_A304 High-Resolution X-Ray Studies On Rabbit Serum Trans 3e-11
1lfg_A691 Structure Of Diferric Human Lactoferrin Length = 69 4e-13
1lfg_A 691 Structure Of Diferric Human Lactoferrin Length = 69 1e-11
1lfh_A691 Molecular Replacement Solution Of The Structure Of 6e-13
1lfh_A 691 Molecular Replacement Solution Of The Structure Of 1e-11
1lfi_A691 Metal Substitution In Transferrins: The Crystal Str 6e-13
1lfi_A 691 Metal Substitution In Transferrins: The Crystal Str 1e-11
1jw1_A689 Crystallization And Structure Determination Of Goat 6e-13
1jw1_A 689 Crystallization And Structure Determination Of Goat 2e-12
1b0l_A691 Recombinant Human Diferric Lactoferrin Length = 691 6e-13
1b0l_A 691 Recombinant Human Diferric Lactoferrin Length = 691 1e-11
1b0l_A691 Recombinant Human Diferric Lactoferrin Length = 691 5e-09
1n76_A690 Crystal Structure Of Human Seminal Lactoferrin At 3 6e-13
1n76_A 690 Crystal Structure Of Human Seminal Lactoferrin At 3 1e-11
1n76_A690 Crystal Structure Of Human Seminal Lactoferrin At 3 4e-09
2bjj_X692 Structure Of Recombinant Human Lactoferrin Produced 7e-13
2bjj_X 692 Structure Of Recombinant Human Lactoferrin Produced 1e-11
2bjj_X692 Structure Of Recombinant Human Lactoferrin Produced 4e-09
1dtz_A 689 Structure Of Camel Apo-Lactoferrin Demonstrates Its 7e-13
1dtz_A 689 Structure Of Camel Apo-Lactoferrin Demonstrates Its 8e-12
1cb6_A691 Structure Of Human Apolactoferrin At 2.0 A Resoluti 7e-13
1cb6_A 691 Structure Of Human Apolactoferrin At 2.0 A Resoluti 1e-11
1cb6_A691 Structure Of Human Apolactoferrin At 2.0 A Resoluti 5e-09
1fck_A692 Structure Of Diceric Human Lactoferrin Length = 692 7e-13
1fck_A 692 Structure Of Diceric Human Lactoferrin Length = 692 1e-11
1fck_A692 Structure Of Diceric Human Lactoferrin Length = 692 5e-09
1lcf_A691 Crystal Structure Of Copper-And Oxalate-Substituted 7e-13
1lcf_A 691 Crystal Structure Of Copper-And Oxalate-Substituted 1e-11
1lcf_A691 Crystal Structure Of Copper-And Oxalate-Substituted 5e-09
1sqy_A691 Structure Of Human Diferric Lactoferrin At 2.5a Res 1e-12
1sqy_A 691 Structure Of Human Diferric Lactoferrin At 2.5a Res 1e-11
1sqy_A691 Structure Of Human Diferric Lactoferrin At 2.5a Res 5e-09
1vfe_A333 Human Lactoferrin, N-terminal Lobe Mutant With Arg 8e-12
2pms_A344 Crystal Structure Of The Complex Of Human Lactoferr 1e-11
1vfd_A330 Human Lactoferrin, N-Terminal Lobe Mutant With Arg 1e-11
1lct_A333 Structure Of The Recombinant N-Terminal Lobe Of Hum 2e-11
1dsn_A333 D60s N-Terminal Lobe Human Lactoferrin Length = 333 2e-11
1l5t_A332 Crystal Structure Of A Domain-Opened Mutant (R121d) 2e-11
1h43_A334 R210e N-Terminal Lobe Human Lactoferrin Length = 33 2e-11
1eh3_A334 R210k N-Terminal Lobe Human Lactoferrin Length = 33 3e-11
1hse_A334 H253m N Terminal Lobe Of Human Lactoferrin Length = 4e-11
1h44_A334 R210l N-Terminal Lobe Human Lactoferrin Length = 33 6e-11
1h45_A334 R210g N-Terminal Lobe Human Lactoferrin Length = 33 1e-10
1lgb_C159 Interaction Of A Legume Lectin With The N2 Fragment 5e-09
>pdb|3MC2|A Chain A, Crystal Structure Of The Murine Inhibitor Of Carbonic Anhydrase Length = 687 Back     alignment and structure

Iteration: 1

Score = 95.5 bits (236), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 74/247 (29%), Positives = 99/247 (40%), Gaps = 82/247 (33%) Query: 15 LRGKKACFAGVGTQAGWVIPVDVLIRNGGMEVIDCNNHVKSVINYFGPSCAVNALINKYN 74 L+GKK+C VGT GW +P+ ++ G D +F SCA Sbjct: 451 LQGKKSCHTAVGTSEGWNVPMGLIYDQTGSCKFDA---------FFSRSCA--------- 492 Query: 75 PIGDNSDRLCELCIGRVPGEKCTTADPYAGFEGAFRCLVDKGEVAFLKHTTVQEMIEGRI 134 P D LC LC+G G A C + E Sbjct: 493 PGSDPDSPLCALCVG--------------GNNPAHMCAANNAE----------------- 521 Query: 135 DACKYSFLGKELKMSFFYFLLLQYSGGLIEGTGAFRCLVDKGEVAFLKHTTVQEMIEGRI 194 G +GA RCLV+KG+VAF+KH TV + +G+ Sbjct: 522 --------------------------GYHGSSGALRCLVEKGDVAFMKHPTVLQNTDGKN 555 Query: 195 D---AYGLTKENFELLCTDGTRQPVDNYQSCNWGQVPSNAVMTTSAKSTQIRRYYQQFLI 251 A GL E+FELLC DGTR+PV QSC+ +VP+ AV + K+ +RR L Sbjct: 556 PEPWAKGLKHEDFELLCLDGTRKPVTEAQSCHLARVPNRAVFSRKDKADFVRR----ILF 611 Query: 252 KTVQLFG 258 +LFG Sbjct: 612 NQQELFG 618
>pdb|3MC2|A Chain A, Crystal Structure Of The Murine Inhibitor Of Carbonic Anhydrase Length = 687 Back     alignment and structure
>pdb|2D3I|A Chain A, Crystal Structure Of Aluminum-Bound Ovotransferrin At 2.15 Angstrom Resolution Length = 686 Back     alignment and structure
>pdb|2D3I|A Chain A, Crystal Structure Of Aluminum-Bound Ovotransferrin At 2.15 Angstrom Resolution Length = 686 Back     alignment and structure
>pdb|1N04|A Chain A, Diferric Chicken Serum Transferrin At 2.8 A Resolution. Length = 686 Back     alignment and structure
>pdb|1N04|A Chain A, Diferric Chicken Serum Transferrin At 2.8 A Resolution. Length = 686 Back     alignment and structure
>pdb|1IQ7|A Chain A, Ovotransferrin, C-Terminal Lobe, Apo Form Length = 345 Back     alignment and structure
>pdb|1H76|A Chain A, The Crystal Structure Of Diferric Porcine Serum Transferrin Length = 696 Back     alignment and structure
>pdb|1NFT|A Chain A, Ovotransferrin, N-Terminal Lobe, Iron Loaded Open Form Length = 329 Back     alignment and structure
>pdb|1NFT|A Chain A, Ovotransferrin, N-Terminal Lobe, Iron Loaded Open Form Length = 329 Back     alignment and structure
>pdb|1IEJ|A Chain A, Ovotransferrin, N-Terminal Lobe, Holo Form, At 1.65 A Resolution Length = 332 Back     alignment and structure
>pdb|1IEJ|A Chain A, Ovotransferrin, N-Terminal Lobe, Holo Form, At 1.65 A Resolution Length = 332 Back     alignment and structure
>pdb|1NNT|A Chain A, Structural Evidence For A Ph-Sensitive Di-Lysine Trigger In The Hen Ovotransferrin N-Lobe: Implications For Transferrin Iron Release Length = 328 Back     alignment and structure
>pdb|1NNT|A Chain A, Structural Evidence For A Ph-Sensitive Di-Lysine Trigger In The Hen Ovotransferrin N-Lobe: Implications For Transferrin Iron Release Length = 328 Back     alignment and structure
>pdb|1GV8|A Chain A, 18 Kda Fragment Of N-Ii Domain Of Duck Ovotransferrin Length = 159 Back     alignment and structure
>pdb|1GV8|A Chain A, 18 Kda Fragment Of N-Ii Domain Of Duck Ovotransferrin Length = 159 Back     alignment and structure
>pdb|1GVC|A Chain A, 18kda N-Ii Domain Fragment Of Duck Ovotransferrin + Nta Length = 157 Back     alignment and structure
>pdb|1GVC|A Chain A, 18kda N-Ii Domain Fragment Of Duck Ovotransferrin + Nta Length = 157 Back     alignment and structure
>pdb|1AOV|A Chain A, Apo Duck Ovotransferrin Length = 686 Back     alignment and structure
>pdb|1AOV|A Chain A, Apo Duck Ovotransferrin Length = 686 Back     alignment and structure
>pdb|1OVB|A Chain A, The Mechanism Of Iron Uptake By Transferrins: The Structure Of An 18kd Nii-Domain Fragment At 2.3 Angstroms Resolution Length = 159 Back     alignment and structure
>pdb|1OVB|A Chain A, The Mechanism Of Iron Uptake By Transferrins: The Structure Of An 18kd Nii-Domain Fragment At 2.3 Angstroms Resolution Length = 159 Back     alignment and structure
>pdb|1OQH|A Chain A, Crystal Structure Of The R124a Mutant Of The N-lobe Human Transferrin Length = 337 Back     alignment and structure
>pdb|1OQH|A Chain A, Crystal Structure Of The R124a Mutant Of The N-lobe Human Transferrin Length = 337 Back     alignment and structure
>pdb|1SUV|C Chain C, Structure Of Human Transferrin Receptor-transferrin Complex Length = 329 Back     alignment and structure
>pdb|1SUV|C Chain C, Structure Of Human Transferrin Receptor-transferrin Complex Length = 329 Back     alignment and structure
>pdb|1JQF|A Chain A, Human Transferrin N-Lobe Mutant H249q Length = 334 Back     alignment and structure
>pdb|1JQF|A Chain A, Human Transferrin N-Lobe Mutant H249q Length = 334 Back     alignment and structure
>pdb|1RYO|A Chain A, Human Serum Transferrin, N-Lobe Bound With Oxalate Length = 327 Back     alignment and structure
>pdb|1RYO|A Chain A, Human Serum Transferrin, N-Lobe Bound With Oxalate Length = 327 Back     alignment and structure
>pdb|1N7X|A Chain A, Human Serum Transferrin, N-Lobe Y45e Mutant Length = 331 Back     alignment and structure
>pdb|1N7X|A Chain A, Human Serum Transferrin, N-Lobe Y45e Mutant Length = 331 Back     alignment and structure
>pdb|1FQF|A Chain A, Crystal Structures Of Mutant (K296a) That Abolish The Dilysine Interaction In The N-Lobe Of Human Transferrin Length = 331 Back     alignment and structure
>pdb|1FQF|A Chain A, Crystal Structures Of Mutant (K296a) That Abolish The Dilysine Interaction In The N-Lobe Of Human Transferrin Length = 331 Back     alignment and structure
>pdb|1N84|A Chain A, Human Serum Transferrin, N-Lobe Length = 331 Back     alignment and structure
>pdb|1N84|A Chain A, Human Serum Transferrin, N-Lobe Length = 331 Back     alignment and structure
>pdb|1N7W|A Chain A, Crystal Structure Of Human Serum Transferrin, N-Lobe L66w Mutant Length = 331 Back     alignment and structure
>pdb|1N7W|A Chain A, Crystal Structure Of Human Serum Transferrin, N-Lobe L66w Mutant Length = 331 Back     alignment and structure
>pdb|1OQG|A Chain A, Crystal Structure Of The D63e Mutant Of The N-Lobe Human Transferrin Length = 337 Back     alignment and structure
>pdb|1OQG|A Chain A, Crystal Structure Of The D63e Mutant Of The N-Lobe Human Transferrin Length = 337 Back     alignment and structure
>pdb|1BP5|A Chain A, Human Serum Transferrin, Recombinant N-Terminal Lobe, Apo Form Length = 337 Back     alignment and structure
>pdb|1BP5|A Chain A, Human Serum Transferrin, Recombinant N-Terminal Lobe, Apo Form Length = 337 Back     alignment and structure
>pdb|2HAV|A Chain A, Apo-Human Serum Transferrin (Glycosylated) Length = 676 Back     alignment and structure
>pdb|2HAV|A Chain A, Apo-Human Serum Transferrin (Glycosylated) Length = 676 Back     alignment and structure
>pdb|3QYT|A Chain A, Diferric Bound Human Serum Transferrin Length = 679 Back     alignment and structure
>pdb|3QYT|A Chain A, Diferric Bound Human Serum Transferrin Length = 679 Back     alignment and structure
>pdb|4H0W|A Chain A, Bismuth Bound Human Serum Transferrin Length = 679 Back     alignment and structure
>pdb|4H0W|A Chain A, Bismuth Bound Human Serum Transferrin Length = 679 Back     alignment and structure
>pdb|3VE1|B Chain B, The 2.9 Angstrom Crystal Structure Of Transferrin Binding Protein B (Tbpb) From Serogroup B M982 Neisseria Meningitidis In Complex With Human Transferrin Length = 679 Back     alignment and structure
>pdb|3VE1|B Chain B, The 2.9 Angstrom Crystal Structure Of Transferrin Binding Protein B (Tbpb) From Serogroup B M982 Neisseria Meningitidis In Complex With Human Transferrin Length = 679 Back     alignment and structure
>pdb|3V83|A Chain A, The 2.1 Angstrom Crystal Structure Of Diferric Human Transferrin Length = 698 Back     alignment and structure
>pdb|3V83|A Chain A, The 2.1 Angstrom Crystal Structure Of Diferric Human Transferrin Length = 698 Back     alignment and structure
>pdb|1DTG|A Chain A, Human Transferrin N-Lobe Mutant H249e Length = 334 Back     alignment and structure
>pdb|1DTG|A Chain A, Human Transferrin N-Lobe Mutant H249e Length = 334 Back     alignment and structure
>pdb|1B3E|A Chain A, Human Serum Transferrin, N-Terminal Lobe, Expressed In Pichia Pastoris Length = 330 Back     alignment and structure
>pdb|1B3E|A Chain A, Human Serum Transferrin, N-Terminal Lobe, Expressed In Pichia Pastoris Length = 330 Back     alignment and structure
>pdb|3S9L|C Chain C, Complex Between Transferrin Receptor 1 And Transferrin With Iron In The N-Lobe, Cryocooled 2 Length = 693 Back     alignment and structure
>pdb|3S9L|C Chain C, Complex Between Transferrin Receptor 1 And Transferrin With Iron In The N-Lobe, Cryocooled 2 Length = 693 Back     alignment and structure
>pdb|1D3K|A Chain A, Human Serum Transferrin Length = 329 Back     alignment and structure
>pdb|1D3K|A Chain A, Human Serum Transferrin Length = 329 Back     alignment and structure
>pdb|2HAU|A Chain A, Apo-Human Serum Transferrin (Non-Glycosylated) Length = 676 Back     alignment and structure
>pdb|2HAU|A Chain A, Apo-Human Serum Transferrin (Non-Glycosylated) Length = 676 Back     alignment and structure
>pdb|3FGS|A Chain A, Crystal Structure Of G65rK206E DOUBLE MUTANT OF THE N-Lobe Human Transferrin Length = 337 Back     alignment and structure
>pdb|3FGS|A Chain A, Crystal Structure Of G65rK206E DOUBLE MUTANT OF THE N-Lobe Human Transferrin Length = 337 Back     alignment and structure
>pdb|2O7U|B Chain B, Crystal Structure Of K206eK296E MUTANT OF THE N-Terminal Half Molecule Of Human Transferrin Length = 337 Back     alignment and structure
>pdb|2O7U|B Chain B, Crystal Structure Of K206eK296E MUTANT OF THE N-Terminal Half Molecule Of Human Transferrin Length = 337 Back     alignment and structure
>pdb|2O84|X Chain X, Crystal Structure Of K206e Mutant Of N-Lobe Human Transferrin Length = 337 Back     alignment and structure
>pdb|2O84|X Chain X, Crystal Structure Of K206e Mutant Of N-Lobe Human Transferrin Length = 337 Back     alignment and structure
>pdb|1FQE|A Chain A, Crystal Structures Of Mutant (K206a) That Abolish The Dilysine Interaction In The N-Lobe Of Human Transferrin Length = 331 Back     alignment and structure
>pdb|1FQE|A Chain A, Crystal Structures Of Mutant (K206a) That Abolish The Dilysine Interaction In The N-Lobe Of Human Transferrin Length = 331 Back     alignment and structure
>pdb|3V89|B Chain B, The Crystal Structure Of Transferrin Binding Protein A (Tbpa) From Neisseria Meningitidis Serogroup B In Complex With The C-Lobe Of Human Transferrin Length = 343 Back     alignment and structure
>pdb|3SKP|A Chain A, The Structure Of Apo-Human Transferrin C-Lobe With Bound Sulfate Ions Length = 342 Back     alignment and structure
>pdb|1D4N|A Chain A, Human Serum Transferrin Length = 329 Back     alignment and structure
>pdb|1D4N|A Chain A, Human Serum Transferrin Length = 329 Back     alignment and structure
>pdb|1SDX|A Chain A, Crystal Structure Of The Zinc Saturated C-Terminal Half Of Bovine Lactoferrin At 2.0 A Resolution Reveals Two Additional Zinc Binding Sites Length = 335 Back     alignment and structure
>pdb|1NKX|A Chain A, Crystal Structure Of A Proteolytically Generated Functional Monoferric C-Lobe Of Bovine Lactoferrin At 1.9a Resolution Length = 348 Back     alignment and structure
>pdb|2P1S|A Chain A, Crystal Structure Of The C-Terminal Lobe Of Bovine Lactoferrin Complexed With O-Alpha-D-Glucopyranosyl-(1 3)-Alpha-D- Fructofuranosyl- (2 1)- Alpha-D-Glucopyranoside At 1.93 A Resolution Length = 344 Back     alignment and structure
>pdb|2B65|A Chain A, Crystal Structure Of The Complex Of C-Lobe Of Bovine Lactoferrin With Maltose At 1.5a Resolution Length = 345 Back     alignment and structure
>pdb|1B1X|A Chain A, Structure Of Diferric Mare Lactoferrin At 2.62a Resolution Length = 689 Back     alignment and structure
>pdb|1B1X|A Chain A, Structure Of Diferric Mare Lactoferrin At 2.62a Resolution Length = 689 Back     alignment and structure
>pdb|1F9B|A Chain A, Melanin Protein Interaction: X-Ray Structure Of The Complex Of Mare Lactoferrin With Melanin Monomers Length = 695 Back     alignment and structure
>pdb|1F9B|A Chain A, Melanin Protein Interaction: X-Ray Structure Of The Complex Of Mare Lactoferrin With Melanin Monomers Length = 695 Back     alignment and structure
>pdb|1CE2|A Chain A, Structure Of Diferric Buffalo Lactoferrin At 2.5a Resolution Length = 689 Back     alignment and structure
>pdb|1CE2|A Chain A, Structure Of Diferric Buffalo Lactoferrin At 2.5a Resolution Length = 689 Back     alignment and structure
>pdb|1BIY|A Chain A, Structure Of Diferric Buffalo Lactoferrin Length = 689 Back     alignment and structure
>pdb|1BIY|A Chain A, Structure Of Diferric Buffalo Lactoferrin Length = 689 Back     alignment and structure
>pdb|1BLF|A Chain A, Structure Of Diferric Bovine Lactoferrin At 2.8 Angstroms Resolution Length = 689 Back     alignment and structure
>pdb|1BLF|A Chain A, Structure Of Diferric Bovine Lactoferrin At 2.8 Angstroms Resolution Length = 689 Back     alignment and structure
>pdb|1JNF|A Chain A, Rabbit Serum Transferrin At 2.6 A Resolution Length = 676 Back     alignment and structure
>pdb|1SUV|E Chain E, Structure Of Human Transferrin Receptor-transferrin Complex Length = 345 Back     alignment and structure
>pdb|1TFD|A Chain A, High-Resolution X-Ray Studies On Rabbit Serum Transferrin: Preliminary Structure Analysis Of The N-Terminal Half- Molecule At 2.3 Angstroms Resolution Length = 304 Back     alignment and structure
>pdb|1TFD|A Chain A, High-Resolution X-Ray Studies On Rabbit Serum Transferrin: Preliminary Structure Analysis Of The N-Terminal Half- Molecule At 2.3 Angstroms Resolution Length = 304 Back     alignment and structure
>pdb|1LFG|A Chain A, Structure Of Diferric Human Lactoferrin Length = 691 Back     alignment and structure
>pdb|1LFG|A Chain A, Structure Of Diferric Human Lactoferrin Length = 691 Back     alignment and structure
>pdb|1LFH|A Chain A, Molecular Replacement Solution Of The Structure Of Apolactoferrin, A Protein Displaying Large-Scale Conformational Change Length = 691 Back     alignment and structure
>pdb|1LFH|A Chain A, Molecular Replacement Solution Of The Structure Of Apolactoferrin, A Protein Displaying Large-Scale Conformational Change Length = 691 Back     alignment and structure
>pdb|1LFI|A Chain A, Metal Substitution In Transferrins: The Crystal Structure Of Human Copper-lactoferrin At 2.1 Angstroms Resolution Length = 691 Back     alignment and structure
>pdb|1LFI|A Chain A, Metal Substitution In Transferrins: The Crystal Structure Of Human Copper-lactoferrin At 2.1 Angstroms Resolution Length = 691 Back     alignment and structure
>pdb|1JW1|A Chain A, Crystallization And Structure Determination Of Goat Lactoferrin At 4.0 Resolution: A New Form Of Packing In Lactoferrins With A High Solvent Content In Crystals Length = 689 Back     alignment and structure
>pdb|1JW1|A Chain A, Crystallization And Structure Determination Of Goat Lactoferrin At 4.0 Resolution: A New Form Of Packing In Lactoferrins With A High Solvent Content In Crystals Length = 689 Back     alignment and structure
>pdb|1B0L|A Chain A, Recombinant Human Diferric Lactoferrin Length = 691 Back     alignment and structure
>pdb|1B0L|A Chain A, Recombinant Human Diferric Lactoferrin Length = 691 Back     alignment and structure
>pdb|1B0L|A Chain A, Recombinant Human Diferric Lactoferrin Length = 691 Back     alignment and structure
>pdb|1N76|A Chain A, Crystal Structure Of Human Seminal Lactoferrin At 3.4 A Resolution Length = 690 Back     alignment and structure
>pdb|1N76|A Chain A, Crystal Structure Of Human Seminal Lactoferrin At 3.4 A Resolution Length = 690 Back     alignment and structure
>pdb|1N76|A Chain A, Crystal Structure Of Human Seminal Lactoferrin At 3.4 A Resolution Length = 690 Back     alignment and structure
>pdb|2BJJ|X Chain X, Structure Of Recombinant Human Lactoferrin Produced In The Milk Of Transgenic Cows Length = 692 Back     alignment and structure
>pdb|2BJJ|X Chain X, Structure Of Recombinant Human Lactoferrin Produced In The Milk Of Transgenic Cows Length = 692 Back     alignment and structure
>pdb|2BJJ|X Chain X, Structure Of Recombinant Human Lactoferrin Produced In The Milk Of Transgenic Cows Length = 692 Back     alignment and structure
>pdb|1DTZ|A Chain A, Structure Of Camel Apo-Lactoferrin Demonstrates Its Dual Role In Sequestering And Transporting Ferric Ions Simultaneously:crystal Structure Of Camel Apo-Lactoferrin At 2.6a Resolution. Length = 689 Back     alignment and structure
>pdb|1DTZ|A Chain A, Structure Of Camel Apo-Lactoferrin Demonstrates Its Dual Role In Sequestering And Transporting Ferric Ions Simultaneously:crystal Structure Of Camel Apo-Lactoferrin At 2.6a Resolution. Length = 689 Back     alignment and structure
>pdb|1CB6|A Chain A, Structure Of Human Apolactoferrin At 2.0 A Resolution. Length = 691 Back     alignment and structure
>pdb|1CB6|A Chain A, Structure Of Human Apolactoferrin At 2.0 A Resolution. Length = 691 Back     alignment and structure
>pdb|1CB6|A Chain A, Structure Of Human Apolactoferrin At 2.0 A Resolution. Length = 691 Back     alignment and structure
>pdb|1FCK|A Chain A, Structure Of Diceric Human Lactoferrin Length = 692 Back     alignment and structure
>pdb|1FCK|A Chain A, Structure Of Diceric Human Lactoferrin Length = 692 Back     alignment and structure
>pdb|1FCK|A Chain A, Structure Of Diceric Human Lactoferrin Length = 692 Back     alignment and structure
>pdb|1LCF|A Chain A, Crystal Structure Of Copper-And Oxalate-Substituted Human Lactoferrin At 2.0 Angstroms Resolution Length = 691 Back     alignment and structure
>pdb|1LCF|A Chain A, Crystal Structure Of Copper-And Oxalate-Substituted Human Lactoferrin At 2.0 Angstroms Resolution Length = 691 Back     alignment and structure
>pdb|1LCF|A Chain A, Crystal Structure Of Copper-And Oxalate-Substituted Human Lactoferrin At 2.0 Angstroms Resolution Length = 691 Back     alignment and structure
>pdb|1SQY|A Chain A, Structure Of Human Diferric Lactoferrin At 2.5a Resolution Using Crystals Grown At Ph 6.5 Length = 691 Back     alignment and structure
>pdb|1SQY|A Chain A, Structure Of Human Diferric Lactoferrin At 2.5a Resolution Using Crystals Grown At Ph 6.5 Length = 691 Back     alignment and structure
>pdb|1SQY|A Chain A, Structure Of Human Diferric Lactoferrin At 2.5a Resolution Using Crystals Grown At Ph 6.5 Length = 691 Back     alignment and structure
>pdb|1VFE|A Chain A, Human Lactoferrin, N-terminal Lobe Mutant With Arg 121 Replaced By Ser (r121s) Length = 333 Back     alignment and structure
>pdb|2PMS|A Chain A, Crystal Structure Of The Complex Of Human Lactoferrin N-Lobe And Lactoferrin-Binding Domain Of Pneumococcal Surface Protein A Length = 344 Back     alignment and structure
>pdb|1VFD|A Chain A, Human Lactoferrin, N-Terminal Lobe Mutant With Arg 121 Replaced By Glu (R121e) Length = 330 Back     alignment and structure
>pdb|1LCT|A Chain A, Structure Of The Recombinant N-Terminal Lobe Of Human Lactoferrin At 2.0 Angstroms Resolution Length = 333 Back     alignment and structure
>pdb|1DSN|A Chain A, D60s N-Terminal Lobe Human Lactoferrin Length = 333 Back     alignment and structure
>pdb|1L5T|A Chain A, Crystal Structure Of A Domain-Opened Mutant (R121d) Of The Human Lactoferrin N-Lobe Refined From A Merohedrally- Twinned Crystal Form. Length = 332 Back     alignment and structure
>pdb|1H43|A Chain A, R210e N-Terminal Lobe Human Lactoferrin Length = 334 Back     alignment and structure
>pdb|1EH3|A Chain A, R210k N-Terminal Lobe Human Lactoferrin Length = 334 Back     alignment and structure
>pdb|1HSE|A Chain A, H253m N Terminal Lobe Of Human Lactoferrin Length = 334 Back     alignment and structure
>pdb|1H44|A Chain A, R210l N-Terminal Lobe Human Lactoferrin Length = 334 Back     alignment and structure
>pdb|1H45|A Chain A, R210g N-Terminal Lobe Human Lactoferrin Length = 334 Back     alignment and structure
>pdb|1LGB|C Chain C, Interaction Of A Legume Lectin With The N2 Fragment Of Human Lactotransferrin Or With The Isolated Biantennary Glycopeptide: Role Of The Fucose Moiety Length = 159 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query276
1cb6_A 691 Protein (lactoferrin); iron transport, apolactofer 4e-30
1cb6_A691 Protein (lactoferrin); iron transport, apolactofer 5e-24
2d3i_A686 Ovotransferrin; aluminum, metal-binding, transport 3e-27
2d3i_A 686 Ovotransferrin; aluminum, metal-binding, transport 2e-25
2d3i_A 686 Ovotransferrin; aluminum, metal-binding, transport 2e-15
3v83_A 698 Serotransferrin; iron binding domain, iron carrier 8e-27
3v83_A698 Serotransferrin; iron binding domain, iron carrier 1e-24
3v83_A 698 Serotransferrin; iron binding domain, iron carrier 2e-16
3mc2_A687 Inhibitor of carbonic anhydrase; MICA, transferrin 1e-26
3mc2_A 687 Inhibitor of carbonic anhydrase; MICA, transferrin 5e-26
1blf_A 689 Lactoferrin; transferrin, iron-binding protein, ca 1e-26
1blf_A689 Lactoferrin; transferrin, iron-binding protein, ca 2e-23
3tod_A335 Lactotransferrin; C-LOBE, metal binding protein, 1 3e-26
1h45_A334 Lactoferrin; metal transport, iron transport, meta 5e-26
3skp_A342 Serotransferrin; iron binding protein, transferrin 7e-26
1iej_A332 Ovotransferrin; iron, metal binding protein; 1.65A 1e-23
1iej_A332 Ovotransferrin; iron, metal binding protein; 1.65A 4e-16
1ryo_A327 Serotransferrin; iron transport, metal transport; 4e-23
1ryo_A327 Serotransferrin; iron transport, metal transport; 2e-16
>1cb6_A Protein (lactoferrin); iron transport, apolactoferrin, conformational change; 2.00A {Homo sapiens} SCOP: c.94.1.2 c.94.1.2 PDB: 1bka_A 1b0l_A 1lfi_A* 1fck_A 1lcf_A* 2bjj_X* 1lfh_A 1n76_A 1lfg_A* 1sqy_A* 1b1x_A 1b7u_A 1b7z_A 1i6b_A 1qjm_A 3cr9_A* 1f9b_A* 1dtz_A 1i6q_A 1jw1_A ... Length = 691 Back     alignment and structure
 Score =  118 bits (295), Expect = 4e-30
 Identities = 58/259 (22%), Positives = 93/259 (35%), Gaps = 78/259 (30%)

Query: 1   MKKNSLPDLTHISHLRGKKACFAGVGTQAGWVIPVDVLIRNGGMEVIDCNNHVKSVINYF 60
           +KK        ++ L+G K+C  G+   AGW +P+  L                +V  +F
Sbjct: 98  VKKGGS---FQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFL-NWTGPPEPIEAAVARFF 153

Query: 61  GPSCAVNALINKYNPIGDNSDRLCELCIGRVPGEKCTTADPYAGFEGAFRCLVDKGEVAF 120
             SC   A   ++         LC LC G                               
Sbjct: 154 SASCVPGADKGQF-------PNLCRLCAGTGE---------------------------- 178

Query: 121 LKHTTVQEMIEGRIDACKYSFLGKELKMSFFYFLLLQYSGGLIEGTGAFRCLVD-KGEVA 179
                         + C +S                 Y       +GAF+CL D  G+VA
Sbjct: 179 --------------NKCAFSSQEP-------------YFSY----SGAFKCLRDGAGDVA 207

Query: 180 FLKHTTVQEMIEGRIDAYGLTKENFELLCTDGTRQPVDNYQSCNWGQVPSNAVMTTSAKS 239
           F++ +TV E +    +     ++ +ELLC D TR+PVD ++ C+  +VPS+AV+  S   
Sbjct: 208 FIRESTVFEDLSDEAE-----RDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNG 262

Query: 240 TQIRRYYQQFLIKTVQLFG 258
            +        L +  + FG
Sbjct: 263 KEDA--IWNLLRQAQEKFG 279


>1cb6_A Protein (lactoferrin); iron transport, apolactoferrin, conformational change; 2.00A {Homo sapiens} SCOP: c.94.1.2 c.94.1.2 PDB: 1bka_A 1b0l_A 1lfi_A* 1fck_A 1lcf_A* 2bjj_X* 1lfh_A 1n76_A 1lfg_A* 1sqy_A* 1b1x_A 1b7u_A 1b7z_A 1i6b_A 1qjm_A 3cr9_A* 1f9b_A* 1dtz_A 1i6q_A 1jw1_A ... Length = 691 Back     alignment and structure
>2d3i_A Ovotransferrin; aluminum, metal-binding, transport, metal transport; 2.15A {Gallus gallus} SCOP: c.94.1.2 c.94.1.2 PDB: 1ovt_A 1aiv_A* 1n04_A 1ryx_A 1dot_A* 1aov_A* 1iq7_A* Length = 686 Back     alignment and structure
>2d3i_A Ovotransferrin; aluminum, metal-binding, transport, metal transport; 2.15A {Gallus gallus} SCOP: c.94.1.2 c.94.1.2 PDB: 1ovt_A 1aiv_A* 1n04_A 1ryx_A 1dot_A* 1aov_A* 1iq7_A* Length = 686 Back     alignment and structure
>2d3i_A Ovotransferrin; aluminum, metal-binding, transport, metal transport; 2.15A {Gallus gallus} SCOP: c.94.1.2 c.94.1.2 PDB: 1ovt_A 1aiv_A* 1n04_A 1ryx_A 1dot_A* 1aov_A* 1iq7_A* Length = 686 Back     alignment and structure
>3v83_A Serotransferrin; iron binding domain, iron carrier/transporter, transferrin R serum, metal transport; HET: P6G; 2.10A {Homo sapiens} PDB: 3v8x_B* 3qyt_A* 3ve1_B 2hav_A* 3s9l_C* 3s9m_C* 3s9n_C* 2hau_A* 1jnf_A 1h76_A* Length = 698 Back     alignment and structure
>3v83_A Serotransferrin; iron binding domain, iron carrier/transporter, transferrin R serum, metal transport; HET: P6G; 2.10A {Homo sapiens} PDB: 3v8x_B* 3qyt_A* 3ve1_B 2hav_A* 3s9l_C* 3s9m_C* 3s9n_C* 2hau_A* 1jnf_A 1h76_A* Length = 698 Back     alignment and structure
>3v83_A Serotransferrin; iron binding domain, iron carrier/transporter, transferrin R serum, metal transport; HET: P6G; 2.10A {Homo sapiens} PDB: 3v8x_B* 3qyt_A* 3ve1_B 2hav_A* 3s9l_C* 3s9m_C* 3s9n_C* 2hau_A* 1jnf_A 1h76_A* Length = 698 Back     alignment and structure
>3mc2_A Inhibitor of carbonic anhydrase; MICA, transferrin superfamily, lyase inhibitor; 2.40A {Mus musculus} Length = 687 Back     alignment and structure
>3mc2_A Inhibitor of carbonic anhydrase; MICA, transferrin superfamily, lyase inhibitor; 2.40A {Mus musculus} Length = 687 Back     alignment and structure
>1blf_A Lactoferrin; transferrin, iron-binding protein, carbohydrate structure; HET: NAG BMA MAN; 2.80A {Bos taurus} SCOP: c.94.1.2 c.94.1.2 PDB: 1lfc_A Length = 689 Back     alignment and structure
>1blf_A Lactoferrin; transferrin, iron-binding protein, carbohydrate structure; HET: NAG BMA MAN; 2.80A {Bos taurus} SCOP: c.94.1.2 c.94.1.2 PDB: 1lfc_A Length = 689 Back     alignment and structure
>3tod_A Lactotransferrin; C-LOBE, metal binding protein, 1- butyl1-H-pyrazol-5-carboxy hydrolase; HET: NAG XXB; 1.38A {Bos taurus} PDB: 1sdx_A* 3u72_A* 3u8q_A* 3ugw_A* 3uk4_A* 3usd_A* 3v5a_A* 3vdf_A* 4dig_A* 4dxu_A* 2b6d_A* 2b65_A* 2doj_A* 2dp8_A* 2dqv_A* 2ds9_A* 2dsf_A* 2dvc_A* 2dwa_A* 2dwh_A* ... Length = 335 Back     alignment and structure
>1h45_A Lactoferrin; metal transport, iron transport, metal binding; 1.95A {Homo sapiens} SCOP: c.94.1.2 PDB: 1eh3_A 2pms_A* 1h43_A 1h44_A 1dsn_A 1lct_A 1hse_A 1vfe_A 1l5t_A 1vfd_A 1lgb_C* 1z6v_A 1z6w_A Length = 334 Back     alignment and structure
>3skp_A Serotransferrin; iron binding protein, transferrin receptor, TBP metal binding protein; 1.70A {Homo sapiens} PDB: 3v89_B 1suv_E Length = 342 Back     alignment and structure
>1iej_A Ovotransferrin; iron, metal binding protein; 1.65A {Gallus gallus} SCOP: c.94.1.2 PDB: 1tfa_A 1nft_A 1nnt_A 1ovb_A 1gv8_A 1gvc_A* Length = 332 Back     alignment and structure
>1iej_A Ovotransferrin; iron, metal binding protein; 1.65A {Gallus gallus} SCOP: c.94.1.2 PDB: 1tfa_A 1nft_A 1nnt_A 1ovb_A 1gv8_A 1gvc_A* Length = 332 Back     alignment and structure
>1ryo_A Serotransferrin; iron transport, metal transport; 1.20A {Homo sapiens} SCOP: c.94.1.2 PDB: 1bp5_A 1btj_A 1n84_A 1oqg_A 2o84_X 1fqf_A 1fqe_A 1oqh_A 2o7u_B 1jqf_A 1n7x_A 3fgs_A 1a8e_A 1a8f_A 1suv_C 1dtg_A 1d3k_A 1d4n_A 1n7w_A 1b3e_A ... Length = 327 Back     alignment and structure
>1ryo_A Serotransferrin; iron transport, metal transport; 1.20A {Homo sapiens} SCOP: c.94.1.2 PDB: 1bp5_A 1btj_A 1n84_A 1oqg_A 2o84_X 1fqf_A 1fqe_A 1oqh_A 2o7u_B 1jqf_A 1n7x_A 3fgs_A 1a8e_A 1a8f_A 1suv_C 1dtg_A 1d3k_A 1d4n_A 1n7w_A 1b3e_A ... Length = 327 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query276
3skp_A342 Serotransferrin; iron binding protein, transferrin 100.0
3tod_A335 Lactotransferrin; C-LOBE, metal binding protein, 1 100.0
3mc2_A687 Inhibitor of carbonic anhydrase; MICA, transferrin 100.0
3v83_A698 Serotransferrin; iron binding domain, iron carrier 100.0
1iej_A332 Ovotransferrin; iron, metal binding protein; 1.65A 100.0
1h45_A334 Lactoferrin; metal transport, iron transport, meta 100.0
1cb6_A 691 Protein (lactoferrin); iron transport, apolactofer 100.0
2d3i_A 686 Ovotransferrin; aluminum, metal-binding, transport 100.0
3v83_A 698 Serotransferrin; iron binding domain, iron carrier 100.0
3mc2_A 687 Inhibitor of carbonic anhydrase; MICA, transferrin 100.0
2d3i_A686 Ovotransferrin; aluminum, metal-binding, transport 100.0
1blf_A 689 Lactoferrin; transferrin, iron-binding protein, ca 100.0
1ryo_A327 Serotransferrin; iron transport, metal transport; 100.0
1blf_A689 Lactoferrin; transferrin, iron-binding protein, ca 100.0
1cb6_A691 Protein (lactoferrin); iron transport, apolactofer 100.0
3skp_A342 Serotransferrin; iron binding protein, transferrin 98.02
3tod_A335 Lactotransferrin; C-LOBE, metal binding protein, 1 97.97
1iej_A332 Ovotransferrin; iron, metal binding protein; 1.65A 96.57
1h45_A334 Lactoferrin; metal transport, iron transport, meta 96.5
1ryo_A327 Serotransferrin; iron transport, metal transport; 93.34
>3skp_A Serotransferrin; iron binding protein, transferrin receptor, TBP metal binding protein; 1.70A {Homo sapiens} PDB: 3v89_B 1suv_E Back     alignment and structure
Probab=100.00  E-value=1e-59  Score=442.52  Aligned_cols=190  Identities=37%  Similarity=0.727  Sum_probs=163.2

Q ss_pred             CccCCcCCCCccCcCCCCCCCCCCCCCCCcchHhHHHHHhcCCccccCCCchhhhhhhhccCCccCCcccccCCCCCCCc
Q psy3351           1 MKKNSLPDLTHISHLRGKKACFAGVGTQAGWVIPVDVLIRNGGMEVIDCNNHVKSVINYFGPSCAVNALINKYNPIGDNS   80 (276)
Q Consensus         1 vkk~s~~~i~~~~dLkGkksCHtG~g~taGW~~Pv~~L~~~~~i~~~~c~~~~kavs~FFs~SC~PGa~~~~y~~~~~~~   80 (276)
                      |||++  .+.+|+||||||+||||++++|||+||++.|+++..    .|     ++++||++||+||+.         .+
T Consensus        95 VkK~s--~~~tl~dLrGKksCHtg~g~tAGW~iP~g~L~~~~~----~c-----~~s~FFs~sC~PG~~---------~~  154 (342)
T 3skp_A           95 VKKSA--SDLTWDNLKGKKSCHTAVGRTAGWNIPMGLLYNKIN----HC-----RFDEFFSEGCAPGSK---------KD  154 (342)
T ss_dssp             EETTC--SSCCGGGCTTSEEEESCTTCTTTTHHHHHHSGGGCS----TT-----CGGGSSSEEECTTSC---------TT
T ss_pred             EEcCC--CCCCHHHcCCCCccCCCCCCccchhhHHHHHhhccC----CC-----CHHHhhhhcccCCCC---------Cc
Confidence            57754  235799999999999999999999999999988632    24     379999999999983         35


Q ss_pred             hhhchhccCCCCCCCC--CCCCCCCCccccccceecCCcEEEEechhhHhhhhcccccccccccchhhhhhHHHHHhhhc
Q psy3351          81 DRLCELCIGRVPGEKC--TTADPYAGFEGAFRCLVDKGEVAFLKHTTVQEMIEGRIDACKYSFLGKELKMSFFYFLLLQY  158 (276)
Q Consensus        81 ~nLC~lC~g~~~~~~C--~~~e~Y~G~~GAfRCL~e~GDVAFvkh~tV~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~  158 (276)
                      ++||+||.|+ +.++|  ++.|+||||+||||||+|+||||||||+||.++++|++                        
T Consensus       155 ~~LC~lC~g~-~~~~C~~~~~e~Y~Gy~GAfrCL~egGDVAFvkh~tV~~~~~g~~------------------------  209 (342)
T 3skp_A          155 SSLCKLCMGS-GLNLCEPNNKEGYYGYTGAFRCLVEKGDVAFVKHQTVPQNTGGKN------------------------  209 (342)
T ss_dssp             SGGGTTCCCC-GGGTTCSSTTSTTCHHHHHHHHHHHTCSEEEEETTHHHHTSTTSS------------------------
T ss_pred             cchhhhcCCC-CCCCCCCCCCCcCcCCcchheeeccCCcEEEEechhHHhhcCCCC------------------------
Confidence            7999999997 35689  47899999999999999999999999999999987654                        


Q ss_pred             cCCcccCCccceeccccccchhhcchhhhhhhcccccccCCCccCeEEecCCCCCccCCCCccceeeeeCCceEEEcCCc
Q psy3351         159 SGGLIEGTGAFRCLVDKGEVAFLKHTTVQEMIEGRIDAYGLTKENFELLCTDGTRQPVDNYQSCNWGQVPSNAVMTTSAK  238 (276)
Q Consensus       159 s~g~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~dfeLLCpdGtr~pv~~~~~Cnl~~vP~~aVvt~~~~  238 (276)
                                                       ++.|+.+++++|||||||||+|+||++|++|||+++|||+||+|+++
T Consensus       210 ---------------------------------~~~wa~~~~~~dyeLLC~dGtr~pv~~~~~C~la~vP~~aVv~r~~~  256 (342)
T 3skp_A          210 ---------------------------------PDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLARAPNHAVVTRKDK  256 (342)
T ss_dssp             ---------------------------------CSTTTTTCCGGGEEEECTTSCEEEGGGGGGSCSEEECCCEEEECGGG
T ss_pred             ---------------------------------chhhhccCChhhEEEECCCCCcCCCCCCccceEEEccCCeEEecCch
Confidence                                             23599999999999999999999999999999999999999999854


Q ss_pred             chhHHHHHHHHHHHHHHHhCCCCC-----CC--CCCCcceE
Q psy3351         239 STQIRRYYQQFLIKTVQLFGGPVP-----PQ--RTQGKNVI  272 (276)
Q Consensus       239 ~~~~r~~~~~~L~~~~~lfg~~~~-----~~--~~~~~~~~  272 (276)
                          ...|+++|.++|++||++..     |+  .+.+||||
T Consensus       257 ----~~~i~~~L~~~q~~fg~~~~~~~~~F~lF~s~~kdLL  293 (342)
T 3skp_A          257 ----EACVHKILRQQQHLFGSNVTDCSGNFCLFRSETKDLL  293 (342)
T ss_dssp             ----HHHHHHHHHHHHHHHSTTCSCCSSSCCTTCCSSSCSS
T ss_pred             ----HHHHHHHHHHHHHHhCcCCCCCCCCccccCCCCCCcc
Confidence                35789999999999999643     44  33468876



>3tod_A Lactotransferrin; C-LOBE, metal binding protein, 1- butyl1-H-pyrazol-5-carboxy hydrolase; HET: NAG XXB; 1.38A {Bos taurus} PDB: 1sdx_A* 3u72_A* 3u8q_A* 3ugw_A* 3uk4_A* 3usd_A* 3v5a_A* 3vdf_A* 4dig_A* 4dxu_A* 4fim_A* 4fjp_A* 4for_A* 4g2z_A* 4grk_A* 2b6d_A* 2b65_A* 2doj_A* 2dp8_A* 2dqv_A* ... Back     alignment and structure
>3mc2_A Inhibitor of carbonic anhydrase; MICA, transferrin superfamily, lyase inhibitor; 2.40A {Mus musculus} Back     alignment and structure
>3v83_A Serotransferrin; iron binding domain, iron carrier/transporter, transferrin R serum, metal transport; HET: P6G; 2.10A {Homo sapiens} PDB: 3v8x_B* 3qyt_A* 4h0w_A* 3ve1_B 2hav_A* 3s9l_C* 3s9m_C* 3s9n_C* 2hau_A* 1jnf_A 1h76_A* Back     alignment and structure
>1iej_A Ovotransferrin; iron, metal binding protein; 1.65A {Gallus gallus} SCOP: c.94.1.2 PDB: 1tfa_A 1nft_A 1nnt_A 1ovb_A 1gv8_A 1gvc_A* Back     alignment and structure
>1h45_A Lactoferrin; metal transport, iron transport, metal binding; 1.95A {Homo sapiens} SCOP: c.94.1.2 PDB: 1eh3_A 2pms_A* 1h43_A 1h44_A 1dsn_A 1lct_A 1hse_A 1vfe_A 1l5t_A 1vfd_A 1lgb_C* 1z6v_A 1z6w_A Back     alignment and structure
>1cb6_A Protein (lactoferrin); iron transport, apolactoferrin, conformational change; 2.00A {Homo sapiens} SCOP: c.94.1.2 c.94.1.2 PDB: 1bka_A 1b0l_A 1lfi_A* 1fck_A 1lcf_A* 2bjj_X* 1lfh_A 1n76_A 1lfg_A* 1sqy_A* 1b1x_A 1b7u_A 1b7z_A 1i6b_A 1qjm_A 3cr9_A* 1f9b_A* 1dtz_A 1i6q_A 1jw1_A ... Back     alignment and structure
>2d3i_A Ovotransferrin; aluminum, metal-binding, transport, metal transport; 2.15A {Gallus gallus} SCOP: c.94.1.2 c.94.1.2 PDB: 1ovt_A 1aiv_A* 1n04_A 1ryx_A 1dot_A* 1aov_A* 1iq7_A* Back     alignment and structure
>3v83_A Serotransferrin; iron binding domain, iron carrier/transporter, transferrin R serum, metal transport; HET: P6G; 2.10A {Homo sapiens} PDB: 3v8x_B* 3qyt_A* 4h0w_A* 3ve1_B 2hav_A* 3s9l_C* 3s9m_C* 3s9n_C* 2hau_A* 1jnf_A 1h76_A* Back     alignment and structure
>3mc2_A Inhibitor of carbonic anhydrase; MICA, transferrin superfamily, lyase inhibitor; 2.40A {Mus musculus} Back     alignment and structure
>2d3i_A Ovotransferrin; aluminum, metal-binding, transport, metal transport; 2.15A {Gallus gallus} SCOP: c.94.1.2 c.94.1.2 PDB: 1ovt_A 1aiv_A* 1n04_A 1ryx_A 1dot_A* 1aov_A* 1iq7_A* Back     alignment and structure
>1blf_A Lactoferrin; transferrin, iron-binding protein, carbohydrate structure; HET: NAG BMA MAN; 2.80A {Bos taurus} SCOP: c.94.1.2 c.94.1.2 PDB: 1lfc_A Back     alignment and structure
>1ryo_A Serotransferrin; iron transport, metal transport; 1.20A {Homo sapiens} SCOP: c.94.1.2 PDB: 1bp5_A 1btj_A 1n84_A 1oqg_A 2o84_X 1fqf_A 1fqe_A 1oqh_A 2o7u_B 1jqf_A 1n7x_A 3fgs_A 1a8e_A 1a8f_A 1suv_C 1dtg_A 1d3k_A 1d4n_A 1n7w_A 1b3e_A ... Back     alignment and structure
>1blf_A Lactoferrin; transferrin, iron-binding protein, carbohydrate structure; HET: NAG BMA MAN; 2.80A {Bos taurus} SCOP: c.94.1.2 c.94.1.2 PDB: 1lfc_A Back     alignment and structure
>1cb6_A Protein (lactoferrin); iron transport, apolactoferrin, conformational change; 2.00A {Homo sapiens} SCOP: c.94.1.2 c.94.1.2 PDB: 1bka_A 1b0l_A 1lfi_A* 1fck_A 1lcf_A* 2bjj_X* 1lfh_A 1n76_A 1lfg_A* 1sqy_A* 1b1x_A 1b7u_A 1b7z_A 1i6b_A 1qjm_A 3cr9_A* 1f9b_A* 1dtz_A 1i6q_A 1jw1_A ... Back     alignment and structure
>3skp_A Serotransferrin; iron binding protein, transferrin receptor, TBP metal binding protein; 1.70A {Homo sapiens} PDB: 3v89_B 1suv_E Back     alignment and structure
>3tod_A Lactotransferrin; C-LOBE, metal binding protein, 1- butyl1-H-pyrazol-5-carboxy hydrolase; HET: NAG XXB; 1.38A {Bos taurus} PDB: 1sdx_A* 3u72_A* 3u8q_A* 3ugw_A* 3uk4_A* 3usd_A* 3v5a_A* 3vdf_A* 4dig_A* 4dxu_A* 4fim_A* 4fjp_A* 4for_A* 4g2z_A* 4grk_A* 2b6d_A* 2b65_A* 2doj_A* 2dp8_A* 2dqv_A* ... Back     alignment and structure
>1iej_A Ovotransferrin; iron, metal binding protein; 1.65A {Gallus gallus} SCOP: c.94.1.2 PDB: 1tfa_A 1nft_A 1nnt_A 1ovb_A 1gv8_A 1gvc_A* Back     alignment and structure
>1h45_A Lactoferrin; metal transport, iron transport, metal binding; 1.95A {Homo sapiens} SCOP: c.94.1.2 PDB: 1eh3_A 2pms_A* 1h43_A 1h44_A 1dsn_A 1lct_A 1hse_A 1vfe_A 1l5t_A 1vfd_A 1lgb_C* 1z6v_A 1z6w_A Back     alignment and structure
>1ryo_A Serotransferrin; iron transport, metal transport; 1.20A {Homo sapiens} SCOP: c.94.1.2 PDB: 1bp5_A 1btj_A 1n84_A 1oqg_A 2o84_X 1fqf_A 1fqe_A 1oqh_A 2o7u_B 1jqf_A 1n7x_A 3fgs_A 1a8e_A 1a8f_A 1suv_C 1dtg_A 1d3k_A 1d4n_A 1n7w_A 1b3e_A ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 276
d2d3ia2352 c.94.1.2 (A:335-686) Ovotransferrin {Chicken (Gall 1e-32
d1gv8a_159 c.94.1.2 (A:) Ovotransferrin {Duck (Anas platyrhyn 2e-32
d1gv8a_159 c.94.1.2 (A:) Ovotransferrin {Duck (Anas platyrhyn 2e-20
d1ce2a1333 c.94.1.2 (A:1-333) Lactoferrin {Domestic water buf 8e-32
d1lgbc_159 c.94.1.2 (C:) Lactoferrin {Human (Homo sapiens) [T 1e-31
d1h76a2346 c.94.1.2 (A:342-687) Transferrin {Pig (Sus scrofa) 4e-31
d2b6da1344 c.94.1.2 (A:342-685) Lactoferrin {Cow (Bos taurus) 9e-30
d1eh3a_324 c.94.1.2 (A:) Lactoferrin {Human (Homo sapiens) [T 3e-29
d2hava1325 c.94.1.2 (A:340-664) Transferrin {Rabbit (Oryctola 5e-29
d1ieja_329 c.94.1.2 (A:) Ovotransferrin {Chicken (Gallus gall 2e-26
d1ieja_329 c.94.1.2 (A:) Ovotransferrin {Chicken (Gallus gall 2e-18
d1ryoa_324 c.94.1.2 (A:) Transferrin {Human (Homo sapiens) [T 7e-24
d1ryoa_324 c.94.1.2 (A:) Transferrin {Human (Homo sapiens) [T 2e-19
>d2d3ia2 c.94.1.2 (A:335-686) Ovotransferrin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 352 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Transferrin
domain: Ovotransferrin
species: Chicken (Gallus gallus) [TaxId: 9031]
 Score =  120 bits (302), Expect = 1e-32
 Identities = 71/250 (28%), Positives = 104/250 (41%), Gaps = 81/250 (32%)

Query: 12  ISHLRGKKACFAGVGTQAGWVIPVDVLIRNGGMEVIDCNNHVKSVINYFGPSCAVNALIN 71
            ++L+GKK+C   VG  AGWVIP+ ++    G           +   YF   CA      
Sbjct: 111 WNNLKGKKSCHTAVGRTAGWVIPMGLIHNRTG---------TCNFDEYFSEGCA------ 155

Query: 72  KYNPIGDNSDRLCELCIGRVPGEKCTTADPYAGFEGAFRCLVDKGEVAFLKHTTVQEMIE 131
              P    + RLC+LC G              G     +C+    E              
Sbjct: 156 ---PGSPPNSRLCQLCQGS-------------GGIPPEKCVASSHE-------------- 185

Query: 132 GRIDACKYSFLGKELKMSFFYFLLLQYSGGLIEGTGAFRCLVDKGEVAFLKHTTVQEMIE 191
                                    +Y G     TGA RCLV+KG+VAF++H+TV+E   
Sbjct: 186 -------------------------KYFGY----TGALRCLVEKGDVAFIQHSTVEENTG 216

Query: 192 GRID---AYGLTKENFELLCTDGTRQPVDNYQSCNWGQVPSNAVMTTSAKSTQIRRYYQQ 248
           G+     A  L  ++FELLCTDG R  V +Y+ CN  +VP++AV+    K+ +IR   ++
Sbjct: 217 GKNKADWAKNLQMDDFELLCTDGRRANVMDYRECNLAEVPTHAVVVRPEKANKIRDLLER 276

Query: 249 FLIKTVQLFG 258
                 + FG
Sbjct: 277 QE----KRFG 282


>d1gv8a_ c.94.1.2 (A:) Ovotransferrin {Duck (Anas platyrhynchos) [TaxId: 8839]} Length = 159 Back     information, alignment and structure
>d1gv8a_ c.94.1.2 (A:) Ovotransferrin {Duck (Anas platyrhynchos) [TaxId: 8839]} Length = 159 Back     information, alignment and structure
>d1ce2a1 c.94.1.2 (A:1-333) Lactoferrin {Domestic water buffalo (Bubalus arnee bubalis) [TaxId: 89462]} Length = 333 Back     information, alignment and structure
>d1lgbc_ c.94.1.2 (C:) Lactoferrin {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1h76a2 c.94.1.2 (A:342-687) Transferrin {Pig (Sus scrofa) [TaxId: 9823]} Length = 346 Back     information, alignment and structure
>d2b6da1 c.94.1.2 (A:342-685) Lactoferrin {Cow (Bos taurus) [TaxId: 9913]} Length = 344 Back     information, alignment and structure
>d1eh3a_ c.94.1.2 (A:) Lactoferrin {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d2hava1 c.94.1.2 (A:340-664) Transferrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 325 Back     information, alignment and structure
>d1ieja_ c.94.1.2 (A:) Ovotransferrin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 329 Back     information, alignment and structure
>d1ieja_ c.94.1.2 (A:) Ovotransferrin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 329 Back     information, alignment and structure
>d1ryoa_ c.94.1.2 (A:) Transferrin {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d1ryoa_ c.94.1.2 (A:) Transferrin {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query276
d1ieja_329 Ovotransferrin {Chicken (Gallus gallus) [TaxId: 90 100.0
d1ce2a1333 Lactoferrin {Domestic water buffalo (Bubalus arnee 100.0
d1eh3a_324 Lactoferrin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2hava1325 Transferrin {Rabbit (Oryctolagus cuniculus) [TaxId 100.0
d1ryoa_324 Transferrin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1gv8a_159 Ovotransferrin {Duck (Anas platyrhynchos) [TaxId: 100.0
d2d3ia2352 Ovotransferrin {Chicken (Gallus gallus) [TaxId: 90 100.0
d2b6da1344 Lactoferrin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1lgbc_159 Lactoferrin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1h76a2346 Transferrin {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d2hava1325 Transferrin {Rabbit (Oryctolagus cuniculus) [TaxId 97.71
d2d3ia2352 Ovotransferrin {Chicken (Gallus gallus) [TaxId: 90 97.65
d1gv8a_159 Ovotransferrin {Duck (Anas platyrhynchos) [TaxId: 97.59
d1lgbc_159 Lactoferrin {Human (Homo sapiens) [TaxId: 9606]} 97.59
d2b6da1344 Lactoferrin {Cow (Bos taurus) [TaxId: 9913]} 97.47
d1h76a2346 Transferrin {Pig (Sus scrofa) [TaxId: 9823]} 97.45
d1ieja_329 Ovotransferrin {Chicken (Gallus gallus) [TaxId: 90 97.17
d1ce2a1333 Lactoferrin {Domestic water buffalo (Bubalus arnee 97.11
d1eh3a_324 Lactoferrin {Human (Homo sapiens) [TaxId: 9606]} 97.09
d1ryoa_324 Transferrin {Human (Homo sapiens) [TaxId: 9606]} 96.93
>d1ieja_ c.94.1.2 (A:) Ovotransferrin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Transferrin
domain: Ovotransferrin
species: Chicken (Gallus gallus) [TaxId: 9031]
Probab=100.00  E-value=1.6e-56  Score=415.76  Aligned_cols=179  Identities=41%  Similarity=0.822  Sum_probs=158.5

Q ss_pred             CccCCcCCCCccCcCCCCCCCCCCCCCCCcchHhHHHHHhcCCccccCCC--chhhhhhhhccCCccCCcccccCCCCCC
Q psy3351           1 MKKNSLPDLTHISHLRGKKACFAGVGTQAGWVIPVDVLIRNGGMEVIDCN--NHVKSVINYFGPSCAVNALINKYNPIGD   78 (276)
Q Consensus         1 vkk~s~~~i~~~~dLkGkksCHtG~g~taGW~~Pv~~L~~~~~i~~~~c~--~~~kavs~FFs~SC~PGa~~~~y~~~~~   78 (276)
                      |||++  .+ +|++||||||||||++++|||++||++|+++++|++..|+  +..+++++||++||+||++         
T Consensus        95 vkk~s--~~-~~~~LkGkksCHtG~~~~aGw~~P~~~L~~~~~i~~~~~~~~~~~~~v~~FF~~sC~PG~~---------  162 (329)
T d1ieja_          95 VKKGT--EF-TVNDLQGKTSCHTGLGRSAGWNIPIGTLLHRGAIEWEGIESGSVEQAVAKFFSASCVPGAT---------  162 (329)
T ss_dssp             EETTC--CC-CGGGCTTCEEEESCTTCTTTTHHHHHHHHHTTSSCCCCGGGCCHHHHHHHHSSEEECTTCC---------
T ss_pred             EecCC--cc-chhhccCCcccccCCCCcchhhHHHHHHHhcCCCCccCCCCccHHHHHHHHhhhhhhcCCC---------
Confidence            46665  44 7999999999999999999999999999999999987443  5678999999999999964         


Q ss_pred             CchhhchhccCCCCCCCCCCCCCCCCccccccceec-CCcEEEEechhhHhhhhcccccccccccchhhhhhHHHHHhhh
Q psy3351          79 NSDRLCELCIGRVPGEKCTTADPYAGFEGAFRCLVD-KGEVAFLKHTTVQEMIEGRIDACKYSFLGKELKMSFFYFLLLQ  157 (276)
Q Consensus        79 ~~~nLC~lC~g~~~~~~C~~~e~Y~G~~GAfRCL~e-~GDVAFvkh~tV~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~  157 (276)
                      .++|||+||.|. +..+|+.+|+||||+||||||+| +||||||+|+||.+++++                         
T Consensus       163 ~~~~LC~lC~g~-~~~~c~~~~~Y~Gy~GA~rCL~eg~GDVAFvk~~tv~~~~~~-------------------------  216 (329)
T d1ieja_         163 IEQKLCRQCKGD-PKTKCARNAPYSGYSGAFHCLKDGKGDVAFVKHTTVNENAPD-------------------------  216 (329)
T ss_dssp             SCGGGGTTCCSC-TTTTTSTTSTTCHHHHHHHHHHTTSCSEEEEETTHHHHHCTT-------------------------
T ss_pred             CCcchhhhcCCC-CcccCCCCCccccccCHHHHHHcCCCcEEEEechhHhhhccc-------------------------
Confidence            358999999987 45789999999999999999999 699999999999988642                         


Q ss_pred             ccCCcccCCccceeccccccchhhcchhhhhhhcccccccCCCccCeEEecCCCCCccCCCCccceeeeeCCceEEEcCC
Q psy3351         158 YSGGLIEGTGAFRCLVDKGEVAFLKHTTVQEMIEGRIDAYGLTKENFELLCTDGTRQPVDNYQSCNWGQVPSNAVMTTSA  237 (276)
Q Consensus       158 ~s~g~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~dfeLLCpdGtr~pv~~~~~Cnl~~vP~~aVvt~~~  237 (276)
                                                                +++||+||||||+|+|+++|++|||+++|+|+||+|++
T Consensus       217 ------------------------------------------~~~dy~lLC~dg~~~~v~~~~~C~l~~~P~~~vv~r~d  254 (329)
T d1ieja_         217 ------------------------------------------QKDEYELLCLDGSRQPVDNYKTCNWARVAAHAVVARDD  254 (329)
T ss_dssp             ------------------------------------------SGGGEEEECTTSCEEEGGGTTTSCSEEEECCEEEECSS
T ss_pred             ------------------------------------------cccchhhcCCCCCccCcccCcCCcceeccCceEEECCc
Confidence                                                      25689999999999999999999999999999999976


Q ss_pred             cchhHHHHHHHHHHHHHHHhCCCCC
Q psy3351         238 KSTQIRRYYQQFLIKTVQLFGGPVP  262 (276)
Q Consensus       238 ~~~~~r~~~~~~L~~~~~lfg~~~~  262 (276)
                      .   ..++|+++|..+|++||++.+
T Consensus       255 ~---~~~~i~~~L~~~~~~fg~~~~  276 (329)
T d1ieja_         255 N---KVEDIWSFLSKAQSDFGVDTK  276 (329)
T ss_dssp             T---THHHHHHHHHHHHHHHSTTCS
T ss_pred             h---hHHHHHHHHHHHHHHhcCCCC
Confidence            4   235789999999999998765



>d1ce2a1 c.94.1.2 (A:1-333) Lactoferrin {Domestic water buffalo (Bubalus arnee bubalis) [TaxId: 89462]} Back     information, alignment and structure
>d1eh3a_ c.94.1.2 (A:) Lactoferrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hava1 c.94.1.2 (A:340-664) Transferrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1ryoa_ c.94.1.2 (A:) Transferrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv8a_ c.94.1.2 (A:) Ovotransferrin {Duck (Anas platyrhynchos) [TaxId: 8839]} Back     information, alignment and structure
>d2d3ia2 c.94.1.2 (A:335-686) Ovotransferrin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2b6da1 c.94.1.2 (A:342-685) Lactoferrin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lgbc_ c.94.1.2 (C:) Lactoferrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h76a2 c.94.1.2 (A:342-687) Transferrin {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hava1 c.94.1.2 (A:340-664) Transferrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2d3ia2 c.94.1.2 (A:335-686) Ovotransferrin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1gv8a_ c.94.1.2 (A:) Ovotransferrin {Duck (Anas platyrhynchos) [TaxId: 8839]} Back     information, alignment and structure
>d1lgbc_ c.94.1.2 (C:) Lactoferrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b6da1 c.94.1.2 (A:342-685) Lactoferrin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h76a2 c.94.1.2 (A:342-687) Transferrin {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ieja_ c.94.1.2 (A:) Ovotransferrin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ce2a1 c.94.1.2 (A:1-333) Lactoferrin {Domestic water buffalo (Bubalus arnee bubalis) [TaxId: 89462]} Back     information, alignment and structure
>d1eh3a_ c.94.1.2 (A:) Lactoferrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ryoa_ c.94.1.2 (A:) Transferrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure