Psyllid ID: psy3356


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180
ACSSKWITSPSVTFDINIQKNPLVFIPACVFRFSVENEKRFFFFSFLFGPLLVPQIHMRTHTGERPFECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPACEGMFTTKQNLE
cccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccc
cccccEccccHHHHHHHHccccccccccccEEcccccccccccccccEccccHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHccccHHccccEEccccccEEccHHHHHHHcHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEcccccccEccccccEEccccccc
acsskwitspsvtfdiniqknplvfipacvfrfsvenekRFFFfsflfgpllvpqihmrthtgerpfecdvcgkrfaqkstlnthkRVHISYlhvkdkpyhcteceatFSWKQNLEVHMrthtgerpyeceicgkrfsqksacnthkrthipylprvhpkdrpfhcpacegmfttkqnle
acsskwitspsvtfdiniqknPLVFIPACVFRFSVENEKRFFFFSFLFGPLLVPQIHMRTHTGERPFECDVCGKRFAqkstlnthkrvHISYLHVKDKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQKSACNTHKRthipylprvhpkDRPFHCPACEGMFTTKQNLE
ACSSKWITSPSVTFDINIQKNPLVFIPACVFRFSVENEKRffffsflfGPLLVPQIHMRTHTGERPFECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPACEGMFTTKQNLE
*****WITSPSVTFDINIQKNPLVFIPACVFRFSVENEKRFFFFSFLFGPLLVPQIHMRTHTGERPFECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPACEGM********
ACSSKWITSPSVTFDINIQKNPLVFIPACVFRFSVENEKRFFFFSFLFGPLLVPQIHMRTHTGERPFECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPACEGMFTTK**L*
ACSSKWITSPSVTFDINIQKNPLVFIPACVFRFSVENEKRFFFFSFLFGPLLVPQIHMRTHTGERPFECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPACEGMFTTKQNLE
*CSSKWITSPSVTFDINIQKNPLVFIPACVFRFSVENEKRFFFFSFLFGPLLVPQIHMRTHTGERPFECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPACEGMFT******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ACSSKWITSPSVTFDINIQKNPLVFIPACVFRFSVENEKRFFFFSFLFGPLLVPQIHMRTHTGERPFECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPACEGMFTTKQNLE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query180 2.2.26 [Sep-21-2011]
Q6NX49 715 Zinc finger protein 544 O yes N/A 0.616 0.155 0.508 6e-29
P17025639 Zinc finger protein 182 O no N/A 0.661 0.186 0.444 1e-27
Q5R9S5620 Zinc finger protein 182 O yes N/A 0.661 0.191 0.444 1e-27
Q96RE9 604 Zinc finger protein 300 O no N/A 0.661 0.197 0.430 1e-26
Q7Z7L9 614 Zinc finger and SCAN doma no N/A 0.666 0.195 0.451 1e-26
Q5RCD9 645 Zinc finger and SCAN doma no N/A 0.666 0.186 0.451 2e-26
Q8BI99563 Zinc finger protein 879 O no N/A 0.661 0.211 0.409 4e-26
Q6P560627 Zinc finger protein 182 O no N/A 0.661 0.189 0.430 4e-26
Q5MCW4686 Zinc finger protein 569 O no N/A 0.705 0.185 0.414 5e-26
Q6ZMW2699 Zinc finger protein 782 O no N/A 0.661 0.170 0.454 7e-26
>sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=2 SV=1 Back     alignment and function desciption
 Score =  126 bits (317), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 63/124 (50%), Positives = 76/124 (61%), Gaps = 13/124 (10%)

Query: 56  IHMRTHTGERPFECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNL 115
           IH RTHTGE+P+ECD+CGK F Q+S L TH+R+H       +KPY C EC  +F W  NL
Sbjct: 397 IHQRTHTGEKPYECDLCGKSFTQRSKLITHQRIHTG-----EKPYQCIECRKSFRWNSNL 451

Query: 116 EVHMRTHTGERPYECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPACEGMFTT 175
            VH R HTGE+PYEC  CGK FSQ     THKRTH          ++PF C  C   F+ 
Sbjct: 452 IVHQRIHTGEKPYECTHCGKSFSQSYELVTHKRTHTG--------EKPFKCTQCGKSFSQ 503

Query: 176 KQNL 179
           K +L
Sbjct: 504 KYDL 507




May be involved in transcriptional regulation.
Homo sapiens (taxid: 9606)
>sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=1 SV=2 Back     alignment and function description
>sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 Back     alignment and function description
>sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=2 SV=1 Back     alignment and function description
>sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 Back     alignment and function description
>sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 Back     alignment and function description
>sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 Back     alignment and function description
>sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 Back     alignment and function description
>sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query180
357609605 1280 zinc finger protein [Danaus plexippus] 0.611 0.085 0.565 3e-32
157105982 567 zinc finger protein [Aedes aegypti] gi|1 0.655 0.208 0.539 4e-30
2843171 715 zinc finger protein [Homo sapiens] 0.616 0.155 0.508 2e-27
397491460 1119 PREDICTED: LOW QUALITY PROTEIN: neurotro 0.616 0.099 0.508 2e-27
332857648 710 PREDICTED: LOW QUALITY PROTEIN: zinc fin 0.616 0.156 0.508 3e-27
221046280 687 unnamed protein product [Homo sapiens] 0.616 0.161 0.508 3e-27
155722996 715 zinc finger protein 544 [Homo sapiens] g 0.616 0.155 0.508 3e-27
119592974 715 zinc finger protein 544, isoform CRA_a [ 0.616 0.155 0.508 3e-27
194384504 687 unnamed protein product [Homo sapiens] 0.616 0.161 0.508 3e-27
158261617 573 unnamed protein product [Homo sapiens] 0.616 0.193 0.508 5e-27
>gi|357609605|gb|EHJ66538.1| zinc finger protein [Danaus plexippus] Back     alignment and taxonomy information
 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 69/122 (56%), Positives = 84/122 (68%), Gaps = 12/122 (9%)

Query: 55   QIHMRTHTGERPFECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQN 114
            +IH RTHTGERP++CDVC KRFAQKSTLN HKR H     V+ +PY C EC A F+ K  
Sbjct: 1011 EIHNRTHTGERPYQCDVCLKRFAQKSTLNIHKRTHT----VQGRPYQCMECPAAFTCKPY 1066

Query: 115  LEVHMRTHTGERPYECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPACEGMFT 174
            LE+HMRTHTGERP+EC++C KRF+QKS  N HK        R+H  +RP+ C  C+  F 
Sbjct: 1067 LEIHMRTHTGERPFECDVCYKRFTQKSTLNIHK--------RIHTGERPYACDICQKRFA 1118

Query: 175  TK 176
             K
Sbjct: 1119 VK 1120




Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157105982|ref|XP_001649111.1| zinc finger protein [Aedes aegypti] gi|108879937|gb|EAT44162.1| AAEL004444-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|2843171|gb|AAC01956.1| zinc finger protein [Homo sapiens] Back     alignment and taxonomy information
>gi|397491460|ref|XP_003816681.1| PREDICTED: LOW QUALITY PROTEIN: neurotrophin receptor-interacting factor homolog [Pan paniscus] Back     alignment and taxonomy information
>gi|332857648|ref|XP_003316817.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 544 [Pan troglodytes] Back     alignment and taxonomy information
>gi|221046280|dbj|BAH14817.1| unnamed protein product [Homo sapiens] Back     alignment and taxonomy information
>gi|155722996|ref|NP_055295.2| zinc finger protein 544 [Homo sapiens] gi|74762345|sp|Q6NX49.1|ZN544_HUMAN RecName: Full=Zinc finger protein 544 gi|45501063|gb|AAH67271.1| Zinc finger protein 544 [Homo sapiens] Back     alignment and taxonomy information
>gi|119592974|gb|EAW72568.1| zinc finger protein 544, isoform CRA_a [Homo sapiens] gi|119592975|gb|EAW72569.1| zinc finger protein 544, isoform CRA_a [Homo sapiens] gi|158256744|dbj|BAF84345.1| unnamed protein product [Homo sapiens] gi|306921387|dbj|BAJ17773.1| zinc finger protein 544 [synthetic construct] Back     alignment and taxonomy information
>gi|194384504|dbj|BAG59412.1| unnamed protein product [Homo sapiens] Back     alignment and taxonomy information
>gi|158261617|dbj|BAF82986.1| unnamed protein product [Homo sapiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query180
UNIPROTKB|J3KQC8 687 ZNF544 "Zinc finger protein 54 0.616 0.161 0.508 7.7e-30
UNIPROTKB|Q6NX49 715 ZNF544 "Zinc finger protein 54 0.616 0.155 0.508 8.6e-30
UNIPROTKB|F1SCQ3 622 F1SCQ3 "Uncharacterized protei 0.616 0.178 0.467 3e-29
UNIPROTKB|F1MUM4460 ZNF500 "Uncharacterized protei 0.555 0.217 0.504 7.1e-29
ZFIN|ZDB-GENE-080218-13260 zgc:175008 "zgc:175008" [Danio 0.622 0.430 0.456 1.5e-28
MGI|MGI:107611 645 Zfp93 "zinc finger protein 93" 0.594 0.165 0.475 1.8e-28
RGD|1561277196 RGD1561277 "RGD1561277" [Rattu 0.616 0.566 0.451 2.4e-28
UNIPROTKB|F1NNA7 385 ZFP3 "Uncharacterized protein" 0.605 0.283 0.495 3.9e-28
UNIPROTKB|F1M3V5530 RGD1561277 "Protein RGD1561277 0.616 0.209 0.451 7.3e-28
UNIPROTKB|J9P0A1 463 ZFP2 "Uncharacterized protein" 0.611 0.237 0.455 1e-27
UNIPROTKB|J3KQC8 ZNF544 "Zinc finger protein 544" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 338 (124.0 bits), Expect = 7.7e-30, P = 7.7e-30
 Identities = 63/124 (50%), Positives = 76/124 (61%)

Query:    56 IHMRTHTGERPFECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNL 115
             IH RTHTGE+P+ECD+CGK F Q+S L TH+R+H       +KPY C EC  +F W  NL
Sbjct:   369 IHQRTHTGEKPYECDLCGKSFTQRSKLITHQRIHTG-----EKPYQCIECRKSFRWNSNL 423

Query:   116 EVHMRTHTGERPYECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPACEGMFTT 175
              VH R HTGE+PYEC  CGK FSQ     THKRTH          ++PF C  C   F+ 
Sbjct:   424 IVHQRIHTGEKPYECTHCGKSFSQSYELVTHKRTHTG--------EKPFKCTQCGKSFSQ 475

Query:   176 KQNL 179
             K +L
Sbjct:   476 KYDL 479


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
UNIPROTKB|Q6NX49 ZNF544 "Zinc finger protein 544" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SCQ3 F1SCQ3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MUM4 ZNF500 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080218-13 zgc:175008 "zgc:175008" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:107611 Zfp93 "zinc finger protein 93" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1561277 RGD1561277 "RGD1561277" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNA7 ZFP3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1M3V5 RGD1561277 "Protein RGD1561277" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9P0A1 ZFP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6NX49ZN544_HUMANNo assigned EC number0.50800.61660.1552yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 4e-06
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 3e-05
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
 Score = 41.6 bits (98), Expect = 4e-06
 Identities = 18/26 (69%), Positives = 21/26 (80%)

Query: 114 NLEVHMRTHTGERPYECEICGKRFSQ 139
           NL  HMRTHTGE+PY+C +CGK FS 
Sbjct: 1   NLRRHMRTHTGEKPYKCPVCGKSFSS 26


Length = 26

>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 180
KOG2462|consensus279 99.96
KOG2462|consensus279 99.91
KOG3608|consensus467 99.84
KOG1074|consensus 958 99.76
KOG3608|consensus 467 99.76
KOG1074|consensus 958 99.72
KOG3576|consensus267 99.69
KOG3576|consensus267 99.65
KOG3623|consensus 1007 99.57
KOG3623|consensus 1007 99.56
PLN03086567 PRLI-interacting factor K; Provisional 99.32
PLN03086567 PRLI-interacting factor K; Provisional 99.29
PHA00733128 hypothetical protein 99.16
PHA0276855 hypothetical protein; Provisional 99.12
PHA00733128 hypothetical protein 98.99
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.81
PHA0276855 hypothetical protein; Provisional 98.77
KOG3993|consensus500 98.66
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.65
KOG3993|consensus500 98.49
PHA0061644 hypothetical protein 98.4
PHA0073279 hypothetical protein 98.29
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.26
PHA0061644 hypothetical protein 98.23
PHA0073279 hypothetical protein 98.13
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.03
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.99
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.83
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.82
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.76
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.73
KOG2231|consensus 669 97.67
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.61
COG5189423 SFP1 Putative transcriptional repressor regulating 97.47
COG5189423 SFP1 Putative transcriptional repressor regulating 97.41
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.37
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.34
smart0035526 ZnF_C2H2 zinc finger. 97.14
PRK04860160 hypothetical protein; Provisional 97.07
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.94
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.86
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.81
smart0035526 ZnF_C2H2 zinc finger. 96.73
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.45
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.4
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.25
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.18
KOG2231|consensus 669 96.13
KOG1146|consensus 1406 96.03
PRK04860160 hypothetical protein; Provisional 95.98
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 95.24
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 94.72
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 94.61
COG5236 493 Uncharacterized conserved protein, contains RING Z 94.12
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 94.06
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 93.65
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 93.42
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 92.66
PF1371736 zinc_ribbon_4: zinc-ribbon domain 92.64
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 92.49
KOG2482|consensus423 91.96
KOG2893|consensus 341 91.93
COG1592166 Rubrerythrin [Energy production and conversion] 91.74
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 91.37
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 90.9
PF1371937 zinc_ribbon_5: zinc-ribbon domain 90.86
KOG4173|consensus253 90.51
KOG1146|consensus1406 90.38
KOG1280|consensus 381 90.2
KOG4173|consensus253 90.02
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 90.0
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 89.93
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 89.8
COG404965 Uncharacterized protein containing archaeal-type C 89.8
KOG2186|consensus 276 89.74
PHA0062659 hypothetical protein 89.41
KOG2893|consensus 341 89.37
KOG2482|consensus423 89.32
KOG2186|consensus 276 88.48
COG5236 493 Uncharacterized conserved protein, contains RING Z 88.35
COG404965 Uncharacterized protein containing archaeal-type C 88.09
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 87.21
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 86.8
smart00531147 TFIIE Transcription initiation factor IIE. 86.54
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 86.43
COG5048467 FOG: Zn-finger [General function prediction only] 86.07
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 85.7
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 85.26
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 84.7
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 84.49
PF0030147 Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubred 83.69
KOG2071|consensus579 83.11
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 81.54
PRK06266178 transcription initiation factor E subunit alpha; V 80.67
>KOG2462|consensus Back     alignment and domain information
Probab=99.96  E-value=1.1e-30  Score=178.76  Aligned_cols=130  Identities=35%  Similarity=0.688  Sum_probs=117.7

Q ss_pred             cCCcccccccceeeeecCCeeEeeeecccCCCchhhhHhhhcCC---CCCcccccchhhccChHHHHHHHHhccCCCcCC
Q psy3356          20 KNPLVFIPACVFRFSVENEKRFFFFSFLFGPLLVPQIHMRTHTG---ERPFECDVCGKRFAQKSTLNTHKRVHISYLHVK   96 (180)
Q Consensus        20 ~~~~~~c~~C~~~~~~~~~~~~~~C~~~~~~~~~l~~H~~~h~~---~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~   96 (180)
                      ..+.++|+.||+.+.               +...|.+|.++|-.   .+.+.|++|++.|.+-..|..|+++|       
T Consensus       127 ~~~r~~c~eCgk~ys---------------T~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH-------  184 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYS---------------TSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTH-------  184 (279)
T ss_pred             cCCceeccccccccc---------------cccccchhhcccccccccccccCCCCCceeeehHHHhhHhhcc-------
Confidence            445667777777777               99999999998854   56799999999999999999999987       


Q ss_pred             CcceeccccCcccCChhhHHHHHhhcCCCCceeccccccccCChHHHHHHHHHcCCCCCCcCCCCCCcccCCCcccCCCc
Q psy3356          97 DKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPACEGMFTTK  176 (180)
Q Consensus        97 ~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~h~~~~~~~C~~C~~~F~~~  176 (180)
                      ..+..|.+||+.|...+.|+.|+++|+|+|||.|+.|++.|.++++|+.|+++        |.+.|+|+|..|+++|+..
T Consensus       185 ~l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQT--------HS~~K~~qC~~C~KsFsl~  256 (279)
T KOG2462|consen  185 TLPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQT--------HSDVKKHQCPRCGKSFALK  256 (279)
T ss_pred             CCCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHh--------hcCCccccCcchhhHHHHH
Confidence            47899999999999999999999999999999999999999999999999998        7889999999999999987


Q ss_pred             cCC
Q psy3356         177 QNL  179 (180)
Q Consensus       177 ~~L  179 (180)
                      +-|
T Consensus       257 SyL  259 (279)
T KOG2462|consen  257 SYL  259 (279)
T ss_pred             HHH
Confidence            655



>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG1280|consensus Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PF00301 Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier [] Back     alignment and domain information
>KOG2071|consensus Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 6e-25
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 7e-18
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 2e-14
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-15
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-14
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 6e-14
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 5e-07
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 7e-14
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 1e-13
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 2e-13
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 2e-04
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 2e-13
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 1e-05
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-13
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 3e-13
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 4e-13
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 5e-13
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 5e-13
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 3e-11
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 3e-11
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 1e-10
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 3e-10
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 4e-06
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 5e-10
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 2e-09
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 1e-07
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 3e-09
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 1e-05
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 6e-09
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 1e-08
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 5e-07
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-08
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 5e-07
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 2e-08
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 3e-08
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 5e-08
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 8e-08
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 1e-07
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 2e-07
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 1e-05
2ct1_A77 Solution Structure Of The Zinc Finger Domain Of Tra 3e-07
2ct1_A77 Solution Structure Of The Zinc Finger Domain Of Tra 4e-05
2dlk_A79 Solution Structure Of The First And The Second Zf-C 1e-06
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 2e-05
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 2e-04
2ytf_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-05
2ytq_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-05
2en6_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-05
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 3e-05
2eog_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-05
2eof_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-05
1x6h_A86 Solution Structures Of The C2h2 Type Zinc Finger Do 1e-04
1x6h_A86 Solution Structures Of The C2h2 Type Zinc Finger Do 8e-04
2eov_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2el4_A46 Solution Structure Of The 15th Zf-C2h2 Domain From 2e-04
2yrj_A46 Solution Structure Of The C2h2-Type Zinc Finger Dom 2e-04
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 2e-04
2en1_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2yth_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 5e-04
2ena_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2eol_A42 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-04
2eml_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-04
1bbo_A57 High-Resolution Solution Structure Of The Double Cy 8e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 110 bits (274), Expect = 6e-25, Method: Compositional matrix adjust. Identities = 55/123 (44%), Positives = 71/123 (57%), Gaps = 13/123 (10%) Query: 57 HMRTHTGERPFECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNLE 116 H RTHTGE+P++C CGK F+ K L H+R H +KPY C EC +FS + NL Sbjct: 40 HQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTG-----EKPYKCPECGKSFSQRANLR 94 Query: 117 VHMRTHTGERPYECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPACEGMFTTK 176 H RTHTGE+PY C CGK FSQ + H+RTH ++P+ CP C F+ + Sbjct: 95 AHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHT--------GEKPYKCPECGKSFSRE 146 Query: 177 QNL 179 NL Sbjct: 147 DNL 149
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2CT1|A Chain A, Solution Structure Of The Zinc Finger Domain Of Transcriptional Repressor Ctcf Protein Length = 77 Back     alignment and structure
>pdb|2CT1|A Chain A, Solution Structure Of The Zinc Finger Domain Of Transcriptional Repressor Ctcf Protein Length = 77 Back     alignment and structure
>pdb|2DLK|A Chain A, Solution Structure Of The First And The Second Zf-C2h2 Domains Of Zinc Finger Protein 692 Length = 79 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|2YTF|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 607- 639) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2YTQ|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 775- 807) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2EN6|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 887- 919) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|2EOG|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 693- 723) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2EOF|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 411- 441) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|1X6H|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Transcriptional Repressor Ctcf Length = 86 Back     alignment and structure
>pdb|1X6H|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Transcriptional Repressor Ctcf Length = 86 Back     alignment and structure
>pdb|2EOV|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 519- 551) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EL4|A Chain A, Solution Structure Of The 15th Zf-C2h2 Domain From Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2YRJ|A Chain A, Solution Structure Of The C2h2-Type Zinc Finger Domain (781- 813) From Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2EN1|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 563- 595) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2YTH|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 479- 511) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|2ENA|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 311- 343) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EOL|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 581- 609) Of Human Zinc Finger Protein 268 Length = 42 Back     alignment and structure
>pdb|2EML|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 752- 784) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|1BBO|A Chain A, High-Resolution Solution Structure Of The Double Cys2His2 Zinc Finger From The Human Enhancer Binding Protein Mbp-1 Length = 57 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-40
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-31
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-40
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 9e-31
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-26
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-14
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 5e-40
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-33
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 7e-21
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-40
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-35
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-22
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-39
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-39
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-39
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 8e-26
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-25
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 1e-15
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-38
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-35
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-08
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-36
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-32
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-27
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 6e-36
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-16
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 6e-35
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-25
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-23
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-34
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-33
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-26
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-34
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-31
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 6e-21
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-16
2gli_A 155 Protein (five-finger GLI); protein/DNA complex, tr 4e-07
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 9e-34
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-27
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 6e-22
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-14
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-33
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-33
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-25
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-19
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-15
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-11
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 8e-33
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 8e-20
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-32
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-20
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-29
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-07
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-29
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-26
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-25
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-29
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-26
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-14
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-29
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-20
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 6e-13
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-27
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 4e-26
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 7e-13
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-27
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 6e-16
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 5e-14
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-26
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-12
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-26
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-21
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 6e-18
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-24
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-14
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-13
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-24
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-17
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-19
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 9e-17
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 4e-12
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-07
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 9e-19
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 8e-12
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-18
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-15
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-15
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 5e-17
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-12
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-16
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 9e-15
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 5e-07
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-15
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-14
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-15
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-14
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 4e-15
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-08
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-15
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-13
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-15
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-13
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-15
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-14
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-15
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-13
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-15
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-12
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-14
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-12
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-14
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-13
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-14
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-12
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-14
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 4e-12
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-14
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-12
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-14
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-13
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-14
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-13
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-14
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-13
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-14
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 8e-13
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-14
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-13
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-14
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-12
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-14
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 7e-14
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-14
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-12
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-14
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-13
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-14
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-13
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-14
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-13
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-14
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-12
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-14
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-13
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-14
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-12
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-14
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-13
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-14
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-12
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-14
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-12
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-14
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-14
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-12
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-14
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-12
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-14
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-12
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 8e-14
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 3e-11
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-05
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-14
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-13
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-12
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-14
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-11
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-14
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-13
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-14
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-13
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-14
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-12
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 9e-14
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 4e-12
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 9e-14
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-12
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 9e-14
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 8e-13
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-13
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-13
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-13
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 8e-13
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-12
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-13
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-12
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-13
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-12
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-13
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 9e-12
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-13
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-12
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-13
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-11
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-13
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-12
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-13
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-12
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-13
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-11
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-13
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-12
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-13
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-12
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-13
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-12
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-13
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-12
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-13
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-12
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-13
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-12
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-13
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-12
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-13
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 4e-13
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 3e-13
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 3e-13
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-13
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-12
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-13
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-12
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-13
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-11
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-13
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-12
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-13
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-12
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-13
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-12
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-13
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-12
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-13
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-12
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-13
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-12
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-13
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-11
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-13
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-12
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-13
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-11
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-13
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-11
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-13
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-12
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-13
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-13
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-12
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-13
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-12
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 7e-13
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-12
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 9e-12
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-13
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-11
2epa_A72 Krueppel-like factor 10; transforming growth facto 7e-13
2epa_A72 Krueppel-like factor 10; transforming growth facto 1e-09
2epa_A72 Krueppel-like factor 10; transforming growth facto 7e-06
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-13
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-11
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 8e-13
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-12
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 6e-06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-13
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-12
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-12
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-12
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-12
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-12
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-12
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-11
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-12
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-11
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-12
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-11
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-11
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-09
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 5e-11
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 5e-11
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-10
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 5e-11
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 2e-10
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-10
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-10
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 8e-10
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 9e-10
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 2e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 1e-09
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 1e-09
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 6e-09
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-08
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 7e-08
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 4e-06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 3e-08
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-05
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 8e-08
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 1e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 1e-05
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 6e-06
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 2e-04
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 7e-05
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 3e-04
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 7e-05
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 3e-04
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
 Score =  131 bits (331), Expect = 2e-40
 Identities = 32/91 (35%), Positives = 46/91 (50%), Gaps = 5/91 (5%)

Query: 60  THTGERPFECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNLEVHM 119
           +     P +C+VCGK F++K  L TH R H        KPY C  C+   +   +L  H+
Sbjct: 2   SSGSSGPHKCEVCGKCFSRKDKLKTHMRCHTG-----VKPYKCKTCDYAAADSSSLNKHL 56

Query: 120 RTHTGERPYECEICGKRFSQKSACNTHKRTH 150
           R H+ ERP++C+IC       S    H R+H
Sbjct: 57  RIHSDERPFKCQICPYASRNSSQLTVHLRSH 87


>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 45 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 45 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 36 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Length = 35 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query180
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.97
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.96
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.94
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.94
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.93
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.93
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.92
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.92
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.91
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.91
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.9
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.9
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.9
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.88
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.87
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.85
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.83
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.83
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.82
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.82
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.81
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.8
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.8
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.8
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.77
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.75
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.74
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.74
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.73
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.73
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.73
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.72
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.71
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.7
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.69
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.69
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.69
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.69
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.68
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.67
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.67
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.66
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.65
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.64
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.63
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.62
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.59
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.59
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.58
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.58
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.58
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.57
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.57
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.53
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.53
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.53
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.51
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.51
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.51
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.5
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.5
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.49
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.49
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.48
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.48
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.46
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.45
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.45
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.45
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.44
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.43
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.43
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.42
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.4
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.4
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.4
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.39
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.39
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.37
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.35
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.33
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.33
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.32
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.32
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.32
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.32
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.32
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.32
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.32
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.31
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.31
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.31
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.31
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.31
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.31
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.31
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.31
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.3
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.29
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.29
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.28
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.28
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.28
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.28
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.28
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.27
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.27
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.26
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.25
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.25
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.24
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.21
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.2
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.19
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.19
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.19
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.19
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.18
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.18
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.18
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.17
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.17
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.17
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.16
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.16
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.16
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.15
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.15
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.15
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.15
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.15
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.15
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.15
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.15
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.14
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.14
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.14
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.14
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.14
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.14
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.14
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.14
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.14
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.13
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.13
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.13
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.13
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.12
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.12
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.12
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.11
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.11
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.11
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.11
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.1
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.1
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.1
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.09
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.08
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.08
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.08
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.08
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.06
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.06
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.05
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.05
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.03
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.02
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.02
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.0
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.99
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.99
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.98
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.98
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.97
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.97
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.95
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.95
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.93
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.93
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.93
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.92
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.91
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.9
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.9
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.89
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.88
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.88
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.86
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.84
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.83
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.82
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.81
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.8
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.79
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.78
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.75
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.71
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.68
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.65
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.65
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.64
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.62
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.61
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.59
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.55
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.53
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.52
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.51
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.48
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.45
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.44
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.43
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.41
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.4
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.38
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.37
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.37
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.36
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.35
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.34
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.33
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.29
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.27
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.26
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.23
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.23
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.23
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.21
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.21
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.21
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.2
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.2
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.18
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.18
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.17
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.16
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.15
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.14
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.13
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.12
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.12
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.38
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.09
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.08
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.07
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.06
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.03
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.03
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.03
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.0
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.25
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.99
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.98
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.98
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.97
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.96
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.18
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.92
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.92
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.91
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.9
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.89
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.87
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.85
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.85
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.84
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.84
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.83
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.81
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.99
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.98
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.73
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.9
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.51
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.29
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.56
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.45
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.31
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.95
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.91
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 95.66
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.31
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 94.94
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.21
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 93.97
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 91.88
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 91.43
2k5c_A95 Uncharacterized protein PF0385; structural genomic 91.0
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 90.55
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 89.15
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 88.04
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 85.0
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 84.72
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 84.44
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 83.5
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 83.11
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 82.32
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 81.5
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.97  E-value=9.1e-33  Score=187.86  Aligned_cols=157  Identities=38%  Similarity=0.735  Sum_probs=124.3

Q ss_pred             Cceeeeeeccc-CCcccccccceeeeecC-------------CeeEeeeecccCCCchhhhHhhhcCCCCCcccccchhh
Q psy3356          10 PSVTFDINIQK-NPLVFIPACVFRFSVEN-------------EKRFFFFSFLFGPLLVPQIHMRTHTGERPFECDVCGKR   75 (180)
Q Consensus        10 ~~~~~~~~~~~-~~~~~c~~C~~~~~~~~-------------~~~~~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~   75 (180)
                      ..|..|+.... ...+.|+.|++.|....             .+.|..|++.|.+...|..|++.|.++++|.|++|++.
T Consensus         7 ~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~   86 (190)
T 2i13_A            7 SSSVAQAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKS   86 (190)
T ss_dssp             ------------------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCE
T ss_pred             ccchhhhhhcCCCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCCc
Confidence            34445544332 23458888888887543             46677788888899999999999999999999999999


Q ss_pred             ccChHHHHHHHHhccCCCcCCCcceeccccCcccCChhhHHHHHhhcCCCCceeccccccccCChHHHHHHHHHcCCCCC
Q psy3356          76 FAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQKSACNTHKRTHIPYLP  155 (180)
Q Consensus        76 f~~~~~l~~H~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~  155 (180)
                      |.+...|..|+..|     .+++++.|+.|++.|.+...|..|+..|.++++|.|+.|++.|.+...|..|+++      
T Consensus        87 f~~~~~l~~H~~~h-----~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~------  155 (190)
T 2i13_A           87 FSQRANLRAHQRTH-----TGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRT------  155 (190)
T ss_dssp             ESCHHHHHHHHHHH-----HTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHH------
T ss_pred             cCCHHHHHHHHHhc-----CCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHHh------
Confidence            99999999999998     7889999999999999999999999999999999999999999999999999997      


Q ss_pred             CcCCCCCCcccCCCcccCCCccCC
Q psy3356         156 RVHPKDRPFHCPACEGMFTTKQNL  179 (180)
Q Consensus       156 ~~h~~~~~~~C~~C~~~F~~~~~L  179 (180)
                        |.+++||.|++|++.|.+.++|
T Consensus       156 --H~~~~~~~C~~C~~~f~~~~~L  177 (190)
T 2i13_A          156 --HTGEKPYKCPECGKSFSRRDAL  177 (190)
T ss_dssp             --HHCCCCEECTTTCCEESSHHHH
T ss_pred             --cCCCCCeECCCCCCccCCHHHH
Confidence              6789999999999999998766



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 180
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-12
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 3e-12
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-11
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-07
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-11
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-11
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-07
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 4e-11
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-10
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 2e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 4e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-11
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 7e-11
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-09
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 9e-11
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-10
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 6e-08
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-10
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-10
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 9e-06
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 1e-08
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 2e-08
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 1e-06
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-08
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 4e-07
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 7e-07
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 3e-08
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.002
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-08
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-06
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-06
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 6e-08
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 6e-08
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 1e-07
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 4e-07
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-05
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 5e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 1e-06
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 4e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 4e-05
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 3e-06
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 5e-06
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 9e-06
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 3e-06
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 6e-06
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 3e-05
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 1e-05
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-05
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 4e-05
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 2e-05
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 2e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 3e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 3e-05
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 8e-05
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 1e-04
d1a1ia328 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) 9e-05
d1a1ia328 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) 0.001
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 0.002
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 0.002
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 0.004
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Kruppel-like factor 3, Bklf
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 57.0 bits (138), Expect = 1e-12
 Identities = 11/35 (31%), Positives = 19/35 (54%)

Query: 57 HMRTHTGERPFECDVCGKRFAQKSTLNTHKRVHIS 91
            R  TG +PF+C  C + F++   L  H++ H+ 
Sbjct: 2  STRGSTGIKPFQCPDCDRSFSRSDHLALHRKRHML 36


>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query180
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.63
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.55
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.43
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.17
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.12
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.12
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.09
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.08
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.06
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.03
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.03
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.0
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.98
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.97
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.96
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.93
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.93
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.9
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.89
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.84
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.81
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.77
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.74
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.73
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.72
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.67
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.65
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.62
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.62
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.54
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.54
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.43
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.43
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.4
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.38
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.32
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.24
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.19
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.14
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.09
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.09
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.07
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.06
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.02
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.02
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.89
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.88
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.77
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.77
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.75
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.75
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.66
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.55
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.48
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.44
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.42
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.36
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.35
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.34
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.27
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.26
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.25
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.21
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.16
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.1
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.08
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.07
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.04
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.94
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.94
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.9
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.87
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.86
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.86
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.72
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.68
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.64
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.6
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.56
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.51
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.42
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.29
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.13
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.92
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.66
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.51
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.46
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.45
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.23
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.14
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.12
d1y0jb136 U-shaped transcription factor, different fingers { 95.0
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.76
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.72
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.46
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 94.45
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 94.04
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 94.01
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 93.68
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 92.91
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 92.26
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 92.25
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 91.98
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 91.21
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.0
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 90.6
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 90.43
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 89.75
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 89.57
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 87.98
d2glia132 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 86.94
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 86.49
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 85.11
d2ghfa158 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 85.02
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 82.61
d1fu9a_36 U-shaped transcription factor, different fingers { 81.63
d1lkoa244 Rubrerythrin, C-terminal domain {Desulfovibrio vul 81.55
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 81.5
d1brfa_53 Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2 80.81
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 80.17
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.63  E-value=1.5e-16  Score=83.62  Aligned_cols=53  Identities=42%  Similarity=0.862  Sum_probs=42.8

Q ss_pred             CcceeccccCcccCChhhHHHHHhhcCCCCceeccccccccCChHHHHHHHHHc
Q psy3356          97 DKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQKSACNTHKRTH  150 (180)
Q Consensus        97 ~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h  150 (180)
                      +++|.|. ||+.|.....|..|+++|.+++||.|.+|++.|.....|..|+++|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            4678884 8888888888888888888888888888888888888888887753



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia1 g.37.1.1 (A:103-134) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1lkoa2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1brfa_ g.41.5.1 (A:) Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure