Psyllid ID: psy337

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-----
AVLQAHDVVAQEIYGEEAVRVTPPWLTVLALPGWRHLWPCLAGGQLDLAVLQAHDVVAQEIYGEEAVRVTPPPIHPYLNGFKFTRGTLLKKIFSPISRFQMSYPGTFLHSRFPVNNGITLKMNDEGKCIVARIMHGGMIHRQATLHVGDEIKEINGIPVGNQSVNALQKILTPPPIHPYLNGSDDPDDLDTPNGDIDIDNVTRVRLVQFQKNTDEPMREARGSVTFKIVPSYRSAPPPCEVQIYPNLPKYVQSSL
ccccccHHHHHHHHHHHHHHcccccEEccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccEEEccccccccEEEEEcccccEEEEEEccccHHHHHcccccccEEEEEccEEcccccHHHHHHHHcccccccEEccccccccccccccccccccccHHHHccccccccHHHHHccccEEEEEccccccccccccccccccccccccccc
cHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccHHHHcccccHHHHHHHHHHHHHHHHccHHHHccccccccccccccccccccccccccccccHHEEEEEEEEEcccccccccEEEEcccHHHEEEEEEccccHHHHHcccccccEEEEEccEEHHHccHHHHHHHHHcccccEEEEEccccccccccccccccHHEEccEEEEEEEcccccHHHccEEEEEEEEccccccccccEEEEEEcccccccccc
AVLQAHDVVAQeiygeeavrvtppwltvlalpgwrhlwpclaggqlDLAVLQAHDVVAqeiygeeavrvtpppihpylngfkftrgTLLKKifspisrfqmsypgtflhsrfpvnngitlkmndEGKCIVARIMhggmihrqatlhvgdeikeingipvgnqsVNALqkiltpppihpylngsddpddldtpngdididnvTRVRLVQFqkntdepmreargsvtfkivpsyrsapppcevqiypnlpkyvqssl
avlqahdvvaqeiygeeavrvtppWLTVLALPGWRHLWPCLAGGQLDLAVLQAHDVVAQEIYGeeavrvtpppihPYLNGFKFTRGTLLKKIFSPISRFQMSYPGTFLHSRFPVNNGITLKMNDEGKCIVARIMHGGMIHRQATLHVGDEIKEINGIPVGNQSVNALQKILTPPPIHPYLNGSDDPDDLDTPNGDIDIDNVTRVRLVQfqkntdepmreargsvtfkivpsyrsapppcevqiypnlpkyvqssl
AVLQAHDVVAQEIYGEEAVRVTPPWLTVLALPGWRHLWPCLAGGQLDLAVLQAHDVVAQEIYGEEAVRVTPPPIHPYLNGFKFTRGTLLKKIFSPISRFQMSYPGTFLHSRFPVNNGITLKMNDEGKCIVARIMHGGMIHRQATLHVGDEIKEINGIPVGNQSVNALQKILTPPPIHPYlngsddpddldtpngdididNVTRVRLVQFQKNTDEPMREARGSVTFKIVPSYRSAPPPCEVQIYPNLPKYVQSSL
*****HDVVAQEIYGEEAVRVTPPWLTVLALPGWRHLWPCLAGGQLDLAVLQAHDVVAQEIYGEEAVRVTPPPIHPYLNGFKFTRGTLLKKIFSPISRFQMSYPGTFLHSRFPVNNGITLKMNDEGKCIVARIMHGGMIHRQATLHVGDEIKEINGIPVGNQSVNALQKILTPPPIHPY****************IDIDNVTRVRLVQF**************VTFKIVPSY******CEVQIYP**********
******DVVAQEIYGEEAVRV****************WPCLAGGQLDLAVLQAHDVVAQEIY**************************************************PVNNGITLKMNDEGKCIVARIMHGGMIHRQATLHVGDEIKEINGIPVGNQSVNALQKILTPPPIHPYLNGSD***********************************************************************
AVLQAHDVVAQEIYGEEAVRVTPPWLTVLALPGWRHLWPCLAGGQLDLAVLQAHDVVAQEIYGEEAVRVTPPPIHPYLNGFKFTRGTLLKKIFSPISRFQMSYPGTFLHSRFPVNNGITLKMNDEGKCIVARIMHGGMIHRQATLHVGDEIKEINGIPVGNQSVNALQKILTPPPIHPYLNGSDDPDDLDTPNGDIDIDNVTRVRLVQFQKNTDEPMREARGSVTFKIVPSYRSAPPPCEVQIYPNLPKYVQSSL
AVLQAHDVVAQEIYGEEAVRVTPPWLTVLALPGWRHLWPCLAGGQLDLAVLQAHDVVAQEIYGEEAVRVT***IH******************SPISRFQMSYPGTFLHSRFPVNNGITLKMNDEGKCIVARIMHGGMIHRQATLHVGDEIKEINGIPVGNQSVNALQKILTPPPIHPYLNGSDDPDDLDTPNGDIDIDNVTRVRLVQFQKNTDEPMREARGSVTFKIVPSYRSAPPPCEVQIYPNLPKYV****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AVLQAHDVVAQEIYGEEAVRVTPPWLTVLALPGWRHLWPCLAGGQLDLAVLQAHDVVAQEIYGEEAVRVTPPPIHPYLNGFKFTRGTLLKKIFSPISRFQMSYPGTFLHSRFPVNNGITLKMNDEGKCIVARIMHGGMIHRQATLHVGDEIKEINGIPVGNQSVNALQKILTPPPIHPYLNGSDDPDDLDTPNGDIDIDNVTRVRLVQFQKNTDEPMREARGSVTFKIVPSYRSAPPPCEVQIYPNLPKYVQSSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query255 2.2.26 [Sep-21-2011]
Q24210 898 Peripheral plasma membran yes N/A 0.541 0.153 0.479 1e-38
O70589 926 Peripheral plasma membran yes N/A 0.549 0.151 0.435 4e-33
O14936 926 Peripheral plasma membran yes N/A 0.549 0.151 0.435 4e-33
Q62915 909 Peripheral plasma membran yes N/A 0.549 0.154 0.430 3e-32
P54936 961 Protein lin-2 OS=Caenorha no N/A 0.309 0.082 0.48 2e-25
P49697 467 55 kDa erythrocyte membra N/A N/A 0.309 0.169 0.392 1e-16
Q5ZJ00 468 55 kDa erythrocyte membra no N/A 0.215 0.117 0.709 2e-16
P70290 466 55 kDa erythrocyte membra no N/A 0.215 0.118 0.672 2e-15
A9CB74 466 55 kDa erythrocyte membra N/A N/A 0.215 0.118 0.672 3e-15
Q5RDW4 466 55 kDa erythrocyte membra no N/A 0.215 0.118 0.672 3e-15
>sp|Q24210|CSKP_DROME Peripheral plasma membrane protein CASK OS=Drosophila melanogaster GN=CASK PE=1 SV=4 Back     alignment and function desciption
 Score =  160 bits (404), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 94/196 (47%), Positives = 115/196 (58%), Gaps = 58/196 (29%)

Query: 49  AVLQAHDVVAQEIYGEEAVRVTPPPIHPYLNGFKFTR---GTLLKKIFSPISRFQMSYPG 105
           A+L +HDVVA+++YGEEA+RVTPPP+ PYLNG +      G L       + +FQ +   
Sbjct: 445 ALLHSHDVVARDVYGEEALRVTPPPMVPYLNGDELDNVEGGELQHVTRVRLVQFQKN--- 501

Query: 106 TFLHSRFPVNNGITLKMNDEGKCIVARIMHGGMIHRQATLHVGDEIKEINGIPVGNQSVN 165
               +  P+  GITLKM ++G+CIVARIMHGGMIHRQATLHVGDEI+EING PV +QSV 
Sbjct: 502 ----TDEPM--GITLKMTEDGRCIVARIMHGGMIHRQATLHVGDEIREINGQPVQHQSVG 555

Query: 166 ALQKILTPPPIHPYLNGSDDPDDLDTPNGDIDIDNVTRVRLVQFQKNTDEPMREARGSVT 225
            LQ++L                                              REARGSVT
Sbjct: 556 QLQRML----------------------------------------------REARGSVT 569

Query: 226 FKIVPSYRSAPPPCEV 241
           FKIVPSYRSAPPPCE+
Sbjct: 570 FKIVPSYRSAPPPCEI 585
May regulate transmembrane proteins that bind calcium, calmodulin, or nucleotides. Functionally modulates eag potassium channels; increases eag current and whole-cell conductance. Also regulates autophosphorylation of CaMKII.
Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1EC: 7
>sp|O70589|CSKP_MOUSE Peripheral plasma membrane protein CASK OS=Mus musculus GN=Cask PE=1 SV=2 Back     alignment and function description
>sp|O14936|CSKP_HUMAN Peripheral plasma membrane protein CASK OS=Homo sapiens GN=CASK PE=1 SV=3 Back     alignment and function description
>sp|Q62915|CSKP_RAT Peripheral plasma membrane protein CASK OS=Rattus norvegicus GN=Cask PE=1 SV=1 Back     alignment and function description
>sp|P54936|LIN2_CAEEL Protein lin-2 OS=Caenorhabditis elegans GN=lin-2 PE=1 SV=1 Back     alignment and function description
>sp|P49697|EM55_TAKRU 55 kDa erythrocyte membrane protein OS=Takifugu rubripes GN=mpp1 PE=3 SV=1 Back     alignment and function description
>sp|Q5ZJ00|EM55_CHICK 55 kDa erythrocyte membrane protein OS=Gallus gallus GN=MPP1 PE=2 SV=1 Back     alignment and function description
>sp|P70290|EM55_MOUSE 55 kDa erythrocyte membrane protein OS=Mus musculus GN=Mpp1 PE=1 SV=1 Back     alignment and function description
>sp|A9CB74|EM55_PAPAN 55 kDa erythrocyte membrane protein OS=Papio anubis GN=MPP1 PE=3 SV=1 Back     alignment and function description
>sp|Q5RDW4|EM55_PONAB 55 kDa erythrocyte membrane protein OS=Pongo abelii GN=MPP1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query255
322798009246 hypothetical protein SINV_05983 [Solenop 0.658 0.682 0.526 2e-45
307171983241 Calcium/calmodulin-dependent protein kin 0.607 0.643 0.504 9e-45
332018887236 Calcium/calmodulin-dependent protein kin 0.596 0.644 0.502 2e-43
380030816 918 PREDICTED: peripheral plasma membrane pr 0.545 0.151 0.512 2e-42
328779053 918 PREDICTED: peripheral plasma membrane pr 0.545 0.151 0.512 2e-42
383858740 907 PREDICTED: peripheral plasma membrane pr 0.545 0.153 0.512 3e-42
350401683 919 PREDICTED: peripheral plasma membrane pr 0.545 0.151 0.512 3e-42
340718335 895 PREDICTED: peripheral plasma membrane pr 0.545 0.155 0.512 3e-42
340718333 945 PREDICTED: peripheral plasma membrane pr 0.545 0.147 0.512 5e-42
189235646 893 PREDICTED: similar to AGAP001683-PA [Tri 0.545 0.155 0.522 2e-41
>gi|322798009|gb|EFZ19853.1| hypothetical protein SINV_05983 [Solenopsis invicta] Back     alignment and taxonomy information
 Score =  188 bits (477), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 111/211 (52%), Positives = 130/211 (61%), Gaps = 43/211 (20%)

Query: 49  AVLQAHDVVAQEIYGEEAVRVTPPPIHPYLNG---FKFTRGTLLKKIFS-PISRFQMSYP 104
           A+LQAHDV   E+YGEEA RVTPPP+  YLNG    +   G L +KI    + +FQ +  
Sbjct: 1   ALLQAHDVAGHEVYGEEATRVTPPPLLTYLNGGDDLEGQNGDLDEKITRVRLVQFQKNTD 60

Query: 105 GTFLHSRFPVNNGITLKMNDEGKCIVARIMHGGMIHRQATLHVGDEIKEINGIPVGNQSV 164
                       GITLKMN++G+C VARIMHGGMIHRQATLHVGDEI+EINGIPV NQSV
Sbjct: 61  EPM---------GITLKMNEDGQCFVARIMHGGMIHRQATLHVGDEIREINGIPVQNQSV 111

Query: 165 NALQKILTPPPIHPYLNGSDDPDDLDTPNGDIDIDNVTRVRLVQFQKNTDEPMREARGSV 224
           NALQKIL                        I + +   VRL+Q         REARGSV
Sbjct: 112 NALQKILV---------------------SIILVVSEESVRLLQ---------REARGSV 141

Query: 225 TFKIVPSYRSAPPPCEVQIYPNLPKYVQSSL 255
           TFKIVPSYRSAPPPCEVQ+ PN     Q+++
Sbjct: 142 TFKIVPSYRSAPPPCEVQVRPNTQTLPQNTI 172

Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307171983|gb|EFN63592.1| Calcium/calmodulin-dependent protein kinase [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332018887|gb|EGI59436.1| Calcium/calmodulin-dependent protein kinase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|380030816|ref|XP_003699037.1| PREDICTED: peripheral plasma membrane protein CASK-like [Apis florea] Back     alignment and taxonomy information
>gi|328779053|ref|XP_394821.4| PREDICTED: peripheral plasma membrane protein CASK-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|383858740|ref|XP_003704857.1| PREDICTED: peripheral plasma membrane protein CASK-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350401683|ref|XP_003486227.1| PREDICTED: peripheral plasma membrane protein CASK-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340718335|ref|XP_003397624.1| PREDICTED: peripheral plasma membrane protein CASK-like isoform 2 [Bombus terrestris] gi|350401680|ref|XP_003486226.1| PREDICTED: peripheral plasma membrane protein CASK-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340718333|ref|XP_003397623.1| PREDICTED: peripheral plasma membrane protein CASK-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|189235646|ref|XP_968349.2| PREDICTED: similar to AGAP001683-PA [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query255
FB|FBgn0013759 898 CASK "CASK ortholog" [Drosophi 0.447 0.126 0.563 7.3e-39
UNIPROTKB|Q5JS74590 CASK "Peripheral plasma membra 0.458 0.198 0.547 1.5e-35
ZFIN|ZDB-GENE-020802-4 920 cask "calcium/calmodulin-depen 0.458 0.127 0.547 9e-34
UNIPROTKB|F1RX15 799 CASK "Uncharacterized protein" 0.458 0.146 0.547 1.1e-33
UNIPROTKB|J9NZ27 897 CASK "Uncharacterized protein" 0.458 0.130 0.547 1.7e-33
UNIPROTKB|A5D7B9 908 CASK "CASK protein" [Bos tauru 0.458 0.128 0.547 1.8e-33
UNIPROTKB|K7GSB2 908 CASK "Uncharacterized protein" 0.458 0.128 0.547 1.8e-33
UNIPROTKB|F8W998 909 CASK "Peripheral plasma membra 0.458 0.128 0.547 1.8e-33
UNIPROTKB|F1LSI7 909 Cask "Peripheral plasma membra 0.458 0.128 0.547 1.8e-33
UNIPROTKB|E1BWL4 920 CASK "Uncharacterized protein" 0.458 0.127 0.547 1.9e-33
FB|FBgn0013759 CASK "CASK ortholog" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 325 (119.5 bits), Expect = 7.3e-39, Sum P(2) = 7.3e-39
 Identities = 71/126 (56%), Positives = 93/126 (73%)

Query:    49 AVLQAHDVVAQEIYGEEAVRVTPPPIHPYLNGFKF--TRGTLLKKIFSP-ISRFQMSYPG 105
             A+L +HDVVA+++YGEEA+RVTPPP+ PYLNG +     G  L+ +    + +FQ +   
Sbjct:   445 ALLHSHDVVARDVYGEEALRVTPPPMVPYLNGDELDNVEGGELQHVTRVRLVQFQKN--- 501

Query:   106 TFLHSRFPVNNGITLKMNDEGKCIVARIMHGGMIHRQATLHVGDEIKEINGIPVGNQSVN 165
                 +  P+  GITLKM ++G+CIVARIMHGGMIHRQATLHVGDEI+EING PV +QSV 
Sbjct:   502 ----TDEPM--GITLKMTEDGRCIVARIMHGGMIHRQATLHVGDEIREINGQPVQHQSVG 555

Query:   166 ALQKIL 171
              LQ++L
Sbjct:   556 QLQRML 561
GO:0007628 "adult walking behavior" evidence=IMP
GO:0005954 "calcium- and calmodulin-dependent protein kinase complex" evidence=ISS
GO:0004683 "calmodulin-dependent protein kinase activity" evidence=ISS;IDA
GO:0016080 "synaptic vesicle targeting" evidence=NAS
GO:0007269 "neurotransmitter secretion" evidence=NAS
GO:0016081 "synaptic vesicle docking involved in exocytosis" evidence=NAS
GO:0004674 "protein serine/threonine kinase activity" evidence=NAS
GO:0006468 "protein phosphorylation" evidence=IEA;NAS
GO:0007163 "establishment or maintenance of cell polarity" evidence=NAS
GO:0007155 "cell adhesion" evidence=IMP
GO:0008360 "regulation of cell shape" evidence=IMP
GO:0005524 "ATP binding" evidence=IEA
GO:0046928 "regulation of neurotransmitter secretion" evidence=IDA
GO:0008344 "adult locomotory behavior" evidence=IMP
GO:0008049 "male courtship behavior" evidence=IMP
GO:0046331 "lateral inhibition" evidence=IMP
UNIPROTKB|Q5JS74 CASK "Peripheral plasma membrane protein CASK" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-020802-4 cask "calcium/calmodulin-dependent serine protein kinase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RX15 CASK "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZ27 CASK "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A5D7B9 CASK "CASK protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|K7GSB2 CASK "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F8W998 CASK "Peripheral plasma membrane protein CASK" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1LSI7 Cask "Peripheral plasma membrane protein CASK" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BWL4 CASK "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query255
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 5e-09
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 1e-08
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 3e-07
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 3e-06
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 8e-05
COG0793 406 COG0793, Prc, Periplasmic protease [Cell envelope 3e-04
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information 
 Score = 51.4 bits (124), Expect = 5e-09
 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 3/57 (5%)

Query: 117 GITLKMNDEGK--CIVARIMHGGMIHRQATLHVGDEIKEINGIPVGNQSVNALQKIL 171
           G +L+   +      V+R+  GG   R   L VGD I E+NG+ V   +     ++L
Sbjct: 15  GFSLRGGKDSGGGIFVSRVEPGGPAER-GGLRVGDRILEVNGVSVEGLTHEEAVELL 70

May be responsible for specific protein-protein interactions, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of PDZ domains an N-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in proteases. Length = 82
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|223864 COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 255
KOG0609|consensus 542 99.97
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.44
KOG3550|consensus207 99.42
KOG3549|consensus 505 99.13
KOG3605|consensus829 99.06
KOG3606|consensus358 98.98
KOG3209|consensus984 98.95
KOG3551|consensus 506 98.85
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.82
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.71
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.64
KOG3209|consensus984 98.42
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 98.23
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.14
KOG3571|consensus 626 98.08
KOG3938|consensus334 97.98
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 97.89
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 97.69
KOG1892|consensus 1629 97.67
KOG3605|consensus829 97.57
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 97.54
PRK11186 667 carboxy-terminal protease; Provisional 97.53
TIGR00225 334 prc C-terminal peptidase (prc). A C-terminal pepti 97.53
PLN00049 389 carboxyl-terminal processing protease; Provisional 97.34
KOG3580|consensus 1027 97.31
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 97.28
KOG3580|consensus 1027 97.19
KOG3651|consensus 429 97.14
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 97.13
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 97.08
KOG3542|consensus 1283 97.02
KOG3553|consensus124 97.0
KOG3552|consensus 1298 96.92
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 96.48
PF0282856 L27: L27 domain; InterPro: IPR014775 The L27 domai 96.45
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 96.33
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 96.23
KOG1738|consensus 638 95.86
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 95.57
PRK10942473 serine endoprotease; Provisional 95.47
PRK10898353 serine endoprotease; Provisional 95.42
PRK10139455 serine endoprotease; Provisional 95.25
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 95.07
PRK10942473 serine endoprotease; Provisional 95.06
PRK10139455 serine endoprotease; Provisional 94.17
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 93.83
TIGR01713259 typeII_sec_gspC general secretion pathway protein 93.56
PRK10779 449 zinc metallopeptidase RseP; Provisional 93.53
KOG0609|consensus 542 92.85
PRK10779 449 zinc metallopeptidase RseP; Provisional 92.37
KOG1320|consensus473 91.87
KOG3532|consensus 1051 91.26
smart0056955 L27 domain in receptor targeting proteins Lin-2 an 90.48
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 90.44
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 89.76
COG3975558 Predicted protease with the C-terminal PDZ domain 88.89
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 87.18
KOG0606|consensus 1205 85.79
COG0265347 DegQ Trypsin-like serine proteases, typically peri 82.97
>KOG0609|consensus Back     alignment and domain information 
Probab=99.97  E-value=1.8e-30  Score=253.66  Aligned_cols=141  Identities=45%  Similarity=0.651  Sum_probs=124.6

Q ss_pred             chhhHHhhhhhhhHHHhhhCccccccCCCCCCCCCCCccccccccccCcccceeeeeecCCCccccccCCCcceEEEEeC
Q psy337           44 GQLDLAVLQAHDVVAQEIYGEEAVRVTPPPIHPYLNGFKFTRGTLLKKIFSPISRFQMSYPGTFLHSRFPVNNGITLKMN  123 (255)
Q Consensus        44 ~~~~qaLL~aHD~VA~k~y~~~~~~~~ppp~~p~~~~~~~~~~~~~~~~~~RiV~l~K~~~~~~~~s~~~epLGiTIk~~  123 (255)
                      -+|++++|++||+||++ |+.       +|.+|++++..+     .....+|+|+|+|+.         ++|||+|+|.+
T Consensus        86 ~ph~~~~l~ahd~vas~-~~~-------~~~~p~l~~~~~-----e~~~~vriv~i~k~~---------~eplG~Tik~~  143 (542)
T KOG0609|consen   86 TPHLQALLQAHDTVASK-YDQ-------PPFSPYLNPESP-----EPVEAVRIVRIVKNT---------GEPLGATIRVE  143 (542)
T ss_pred             chhHhHHHHHhHHHhhc-cCC-------CCCccccCCCcc-----cccceeEEEEEeecC---------CCccceEEEec
Confidence            59999999999999999 862       344577665321     122357999999998         89999999997


Q ss_pred             CCCcEEEEEeeccchhhhhcccCCCCeEEeECCeeccCCCHHHHHhhcCCCCCccccCCCCCCCCCCCCCCCcccCCcce
Q psy337          124 DEGKCIVARIMHGGMIHRQATLHVGDEIKEINGIPVGNQSVNALQKILTPPPIHPYLNGSDDPDDLDTPNGDIDIDNVTR  203 (255)
Q Consensus       124 e~g~IvIaRIl~GG~AdRsGlLhvGDeIlEVNGi~V~g~~~eel~~iLtppp~~~~~ng~~~p~~~~~p~~~~~~~~~~~  203 (255)
                      +++.|+||||||||+++|+|+||+||+|+||||++|.++.+++++++|                                
T Consensus       144 e~~~~~vARI~~GG~~~r~glL~~GD~i~EvNGi~v~~~~~~e~q~~l--------------------------------  191 (542)
T KOG0609|consen  144 EDTKVVVARIMHGGMADRQGLLHVGDEILEVNGISVANKSPEELQELL--------------------------------  191 (542)
T ss_pred             cCCccEEeeeccCCcchhccceeeccchheecCeecccCCHHHHHHHH--------------------------------
Confidence            766899999999999999999999999999999999999999999999                                


Q ss_pred             eEEEeeeecCCchhhcccCeEEEEEcCCCCCCCCCce-eeeccCCCCcccc
Q psy337          204 VRLVQFQKNTDEPMREARGSVTFKIVPSYRSAPPPCE-VQIYPNLPKYVQS  253 (255)
Q Consensus       204 vrlVq~~K~t~ePLG~~~g~vT~k~~p~~~~~~~~~~-~~~~~~~~~~~~~  253 (255)
                                    ++++|++|||++|+|+ ..++++ +||||+|+|.++.
T Consensus       192 --------------~~~~G~itfkiiP~~~-~~~~~~~~~vra~FdYdP~~  227 (542)
T KOG0609|consen  192 --------------RNSRGSITFKIIPSYR-PPPQQQVVFVRALFDYDPKE  227 (542)
T ss_pred             --------------HhCCCcEEEEEccccc-CCCceeeeeehhhcCcCccc
Confidence                          8899999999999999 788888 9999999998763

>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PF02828 L27: L27 domain; InterPro: IPR014775 The L27 domain is found in receptor targeting proteins Lin-2 and Lin-7, as well as some protein kinases and human MPP2 protein Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>smart00569 L27 domain in receptor targeting proteins Lin-2 and Lin-7 Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query255
1kwa_A88 Human CaskLIN-2 Pdz Domain Length = 88 4e-22
2ev8_A97 Solution Structure Of The Erythroid P55 Pdz Domain 6e-16
2ejy_A97 Solution Structure Of The P55 Pdz T85c Domain Compl 3e-15
2e7k_A91 Solution Structure Of The Pdz Domain From Human Mag 1e-08
3o46_A93 Crystal Structure Of The Pdz Domain Of Mpp7 Length 6e-07
1va8_A113 Solution Structure Of The Pdz Domain Of Pals1 Prote 2e-04
>pdb|1KWA|A Chain A, Human CaskLIN-2 Pdz Domain Length = 88 Back     alignment and structure 
Iteration: 1

 Score =  101 bits (251), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 62/118 (52%), Gaps = 46/118 (38%)
Query: 117 GITLKMNDEGKCIVARIMHGGMIHRQATLHVGDEIKEINGIPVGNQSVNALQKILTPPPI 176
           GITLKMN+   CIVARIMHGGMIHRQ TLHVGDEI+EINGI V NQ+V  LQK+L     
Sbjct: 16  GITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKML----- 70
Query: 177 HPYXXXXXXXXXXXXXXXXXXXXNVTRVRLVQFQKNTDEPMREARGSVTFKIVPSYRS 234
                                                    RE RGS+TFKIVPSYR 
Sbjct: 71  -----------------------------------------REMRGSITFKIVPSYRE 87
>pdb|2EV8|A Chain A, Solution Structure Of The Erythroid P55 Pdz Domain Length = 97 Back     alignment and structure
>pdb|2EJY|A Chain A, Solution Structure Of The P55 Pdz T85c Domain Complexed With The Glycophorin C F127c Peptide Length = 97 Back     alignment and structure
>pdb|2E7K|A Chain A, Solution Structure Of The Pdz Domain From Human Maguk P55 Subfamily Member 2 Length = 91 Back     alignment and structure
>pdb|3O46|A Chain A, Crystal Structure Of The Pdz Domain Of Mpp7 Length = 93 Back     alignment and structure
>pdb|1VA8|A Chain A, Solution Structure Of The Pdz Domain Of Pals1 Protein Length = 113 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query255
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 2e-19
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 1e-18
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 3e-18
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 8e-16
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 3e-15
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 1e-13
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 7e-13
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 8e-13
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 2e-10
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-10
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 7e-09
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 2e-10
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 8e-10
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 1e-07
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 5e-07
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 1e-06
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 1e-06
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 3e-06
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 5e-06
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 6e-06
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 3e-05
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 4e-05
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 4e-05
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 3e-04
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 7e-05
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 7e-05
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 7e-05
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 7e-05
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 7e-05
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 9e-05
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 1e-04
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 2e-04
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 2e-04
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 2e-04
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 3e-04
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 3e-04
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 4e-04
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 6e-04
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 6e-04
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 7e-04
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 7e-04
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 7e-04
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 8e-04
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 8e-04
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 9e-04
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
 Score = 78.9 bits (195), Expect = 2e-19
 Identities = 57/117 (48%), Positives = 62/117 (52%), Gaps = 46/117 (39%)

Query: 117 GITLKMNDEGKCIVARIMHGGMIHRQATLHVGDEIKEINGIPVGNQSVNALQKILTPPPI 176
           GITLKMN+   CIVARIMHGGMIHRQ TLHVGDEI+EINGI V NQ+V  LQK+L     
Sbjct: 16  GITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKML----- 70

Query: 177 HPYLNGSDDPDDLDTPNGDIDIDNVTRVRLVQFQKNTDEPMREARGSVTFKIVPSYR 233
                                                    RE RGS+TFKIVPSYR
Sbjct: 71  -----------------------------------------REMRGSITFKIVPSYR 86
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query255
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.78
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.63
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.63
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.6
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.56
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.5
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.45
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.37
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.35
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 99.34
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.34
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.31
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.28
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.25
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.24
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.24
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 99.24
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.23
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.22
2ego_A96 General receptor for phosphoinositides 1- associat 99.21
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.21
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.21
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.21
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 99.2
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.2
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.2
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.18
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.17
2awx_A105 Synapse associated protein 97; membrane protein, s 99.17
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.16
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.16
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.16
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.16
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.16
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.15
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.15
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.15
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.15
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.15
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.14
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.14
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.14
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.14
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.14
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.13
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.13
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.13
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.13
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.13
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.12
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.12
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.12
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 99.12
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.12
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.11
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.11
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.11
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.11
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.11
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.1
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.1
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.09
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.09
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.08
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.08
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.07
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.07
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.07
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.07
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.06
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.06
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.06
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.06
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.06
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.06
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 99.06
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.05
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.05
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.05
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.04
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.03
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.03
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.03
3k1r_A192 Harmonin; protein-protein complex, alternative spl 99.02
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.02
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.02
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.02
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.01
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.01
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.01
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.01
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 98.57
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 99.0
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.0
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.0
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.0
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 98.99
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 98.99
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 98.99
2djt_A104 Unnamed protein product; PDZ domain, structural ge 98.99
2d90_A102 PDZ domain containing protein 1; structural genomi 98.99
2eei_A106 PDZ domain-containing protein 1; regulatory factor 98.98
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 98.98
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 98.98
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 98.98
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 98.97
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 98.97
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.96
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 98.96
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 98.95
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 98.95
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 98.94
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 98.94
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 98.92
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 98.92
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 98.92
2eeh_A100 PDZ domain-containing protein 7; structural genomi 98.92
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 98.91
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 98.91
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 98.89
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 98.87
3khf_A99 Microtubule-associated serine/threonine-protein ki 98.87
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 98.86
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 98.86
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 98.86
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 98.85
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.85
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 98.85
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 98.83
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 98.83
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 98.82
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 98.81
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 98.81
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 98.8
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 98.8
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 98.79
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 98.79
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.79
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 98.77
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 98.77
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 98.76
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 98.76
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 98.76
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 98.76
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 98.76
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 98.75
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 98.74
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 98.73
2eaq_A90 LIM domain only protein 7; conserved hypothetical 98.72
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 98.71
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 98.71
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 98.69
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.69
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 98.68
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 98.68
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 98.65
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 98.64
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.64
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.62
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 98.58
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 98.57
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.56
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 98.53
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 98.52
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 98.5
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 98.4
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.24
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.2
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 98.17
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 97.99
1y74_B50 MLIN-2/CASK, peripheral plasma membrane protein CA 97.83
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 97.75
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 97.65
3lra_A254 Disks large homolog 1, maguk P55 subfamily member 97.63
2kl1_A94 YLBL protein; structure genomics, structural genom 97.56
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 97.45
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 97.33
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 97.32
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 97.29
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 97.24
4fgm_A597 Aminopeptidase N family protein; structural genomi 97.13
2hga_A125 Conserved protein MTH1368; GFT structural genomics 97.11
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 97.0
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 96.92
3k50_A 403 Putative S41 protease; structural genomics, joint 96.9
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 96.89
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 96.87
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 96.83
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 96.75
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 96.69
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 96.65
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 96.57
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 96.57
1k32_A 1045 Tricorn protease; protein degradation, substrate g 96.44
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 96.43
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 96.33
3uit_A265 INAD-like protein, maguk P55 subfamily member 5, L 96.26
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 96.16
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 96.11
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 95.46
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 94.97
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 94.62
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 93.47
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 89.82
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
Probab=99.78  E-value=5.4e-19  Score=138.71  Aligned_cols=69  Identities=29%  Similarity=0.347  Sum_probs=65.0

Q ss_pred             ccceeeeeecCCCccccccCCCcceEEEEeCCCCcEEEEEeeccchhhhhcccCCCCeEEeECCeeccCCCHHHHHhhc
Q psy337           93 FSPISRFQMSYPGTFLHSRFPVNNGITLKMNDEGKCIVARIMHGGMIHRQATLHVGDEIKEINGIPVGNQSVNALQKIL  171 (255)
Q Consensus        93 ~~RiV~l~K~~~~~~~~s~~~epLGiTIk~~e~g~IvIaRIl~GG~AdRsGlLhvGDeIlEVNGi~V~g~~~eel~~iL  171 (255)
                      ..|.|++.|+.          ++||+||+.+.++.+||+||++||+|||+|.|++||+|++|||++|.+++|+|++++|
T Consensus         5 ~~k~V~l~K~~----------~~LG~tI~~~g~g~~~I~rI~~gg~a~r~g~L~vGD~I~~VNG~~v~g~~h~evv~lL   73 (95)
T 3gge_A            5 IEKEVNVYKSE----------DSLGLTITDNGVGYAFIKRIKDGGVIDSVKTICVGDHIESINGENIVGWRHYDVAKKL   73 (95)
T ss_dssp             EEEEEEEECCS----------SCCCEEEECSSSSCCEEEEECTTSHHHHCTTCCTTCEEEEETTEECTTCCHHHHHHHH
T ss_pred             eEEEEEEEECC----------CCceEEEEcCCCCcEEEEEEcCCChHHhcCCCCCCCEEEEECCEEccCCCHHHHHHHH
Confidence            35889999986          9999999975577899999999999999999999999999999999999999999999
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>1y74_B MLIN-2/CASK, peripheral plasma membrane protein CASK; L27 domain, scaffold protein, protein assembly, cell polarity, transport protein; NMR {Mus musculus} SCOP: a.194.1.1 PDB: 1zl8_B Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>3lra_A Disks large homolog 1, maguk P55 subfamily member protein LIN-7 homolog C; tripartite complex, L27 tetramer, cell junction; 2.95A {Homo sapiens} PDB: 1rso_A Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>3uit_A INAD-like protein, maguk P55 subfamily member 5, LIN-7 homolog B; L27 domain, cell polarization, cell adhesion; 2.05A {Mus musculus} PDB: 1y76_A 1y76_B 1y74_A Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 255
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 1e-09
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 8e-07
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 1e-06
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 4e-06
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 6e-06
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 3e-05
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 3e-05
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 3e-05
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 5e-05
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 9e-05
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 9e-05
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 1e-04
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 1e-04
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 2e-04
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 3e-04
d1y74b150 a.194.1.1 (B:83-132) Peripheral plasma membrane pr 3e-04
d1y74b150 a.194.1.1 (B:83-132) Peripheral plasma membrane pr 3e-04
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 4e-04
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 4e-04
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 5e-04
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 5e-04
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 6e-04
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 7e-04
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 0.001
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 0.001
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 0.002
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 0.002
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 0.002
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 0.002
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 0.002
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 0.002
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 0.003
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure

class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Cask/Lin-2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 51.8 bits (124), Expect = 1e-09
 Identities = 57/117 (48%), Positives = 62/117 (52%), Gaps = 46/117 (39%)

Query: 117 GITLKMNDEGKCIVARIMHGGMIHRQATLHVGDEIKEINGIPVGNQSVNALQKILTPPPI 176
           GITLKMN+   CIVARIMHGGMIHRQ TLHVGDEI+EINGI V NQ+V  LQK+L     
Sbjct: 16  GITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKML----- 70

Query: 177 HPYLNGSDDPDDLDTPNGDIDIDNVTRVRLVQFQKNTDEPMREARGSVTFKIVPSYR 233
                                                    RE RGS+TFKIVPSYR
Sbjct: 71  -----------------------------------------REMRGSITFKIVPSYR 86
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1y74b1 a.194.1.1 (B:83-132) Peripheral plasma membrane protein cask {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1y74b1 a.194.1.1 (B:83-132) Peripheral plasma membrane protein cask {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query255
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.73
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.61
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.59
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.57
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.56
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.55
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.55
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.55
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.55
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.54
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.54
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.53
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.53
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.52
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.52
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.52
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.51
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.51
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.5
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.48
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.48
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.47
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.46
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.46
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.45
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.43
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.42
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.42
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.41
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.41
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.4
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.4
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.39
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.39
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.38
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.38
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.38
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.37
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.36
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.36
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.35
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.35
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.35
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.35
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.32
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.31
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.31
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.29
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.29
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.28
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.27
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.22
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.17
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.1
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.07
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 98.94
d1fc6a392 Photosystem II D1 C-terminal processing protease { 98.85
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.38
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 98.34
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.05
d1y74b150 Peripheral plasma membrane protein cask {Human (Ho 97.96
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 97.64
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 97.52
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 97.31
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 97.23
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 96.42
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Cask/Lin-2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.79  E-value=1.3e-19  Score=136.20  Aligned_cols=86  Identities=70%  Similarity=1.047  Sum_probs=80.6

Q ss_pred             cceeeeeecCCCccccccCCCcceEEEEeCCCCcEEEEEeeccchhhhhcccCCCCeEEeECCeeccCCCHHHHHhhcCC
Q psy337           94 SPISRFQMSYPGTFLHSRFPVNNGITLKMNDEGKCIVARIMHGGMIHRQATLHVGDEIKEINGIPVGNQSVNALQKILTP  173 (255)
Q Consensus        94 ~RiV~l~K~~~~~~~~s~~~epLGiTIk~~e~g~IvIaRIl~GG~AdRsGlLhvGDeIlEVNGi~V~g~~~eel~~iLtp  173 (255)
                      .|.|.+.|++         +++||++++.++++.++|.+|.+||+|+++|.|++||+|++|||++|.++++++++++|  
T Consensus         2 ~R~V~l~k~~---------~~~lG~~l~~~~~~~~~I~~v~~gg~A~~~g~l~~GD~Il~INg~~v~~~~~~~~~~ll--   70 (88)
T d1kwaa_           2 SRLVQFQKNT---------DEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKML--   70 (88)
T ss_dssp             CEEEEEEECS---------SSCCCEEEECSCGGGEEEEEECTTSHHHHHTCCCTTCEEEEETTEEGGGSCHHHHHHHH--
T ss_pred             cEEEEEEeCC---------CCCccEEEEEcCCCCEEEEEECCCCHHHHcCCCccCcEEEEECCEECCCCCHHHHHHHH--
Confidence            4889999998         89999999987777899999999999999999999999999999999999999999999  


Q ss_pred             CCCccccCCCCCCCCCCCCCCCcccCCcceeEEEeeeecCCchhhcccCeEEEEEcCCCCC
Q psy337          174 PPIHPYLNGSDDPDDLDTPNGDIDIDNVTRVRLVQFQKNTDEPMREARGSVTFKIVPSYRS  234 (255)
Q Consensus       174 pp~~~~~ng~~~p~~~~~p~~~~~~~~~~~vrlVq~~K~t~ePLG~~~g~vT~k~~p~~~~  234 (255)
                                                                  ..+.+++||+++|+++.
T Consensus        71 --------------------------------------------~~~~~~v~L~i~p~~~~   87 (88)
T d1kwaa_          71 --------------------------------------------REMRGSITFKIVPSYRE   87 (88)
T ss_dssp             --------------------------------------------HHCCEEEEEEEECCCCC
T ss_pred             --------------------------------------------HcCCCcEEEEEEeCCcC
Confidence                                                        66778999999999875
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y74b1 a.194.1.1 (B:83-132) Peripheral plasma membrane protein cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure