Psyllid ID: psy3381


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------
MDRIARDSSAVVCPVIDVLDDSSLEFHFRDSTGILKEALACIGVGWLEPLLDRIARDNSTVVSPVIELIRDDDFALRFCRPQFIQIGGFSWSLEVRS
ccccccccccEEEEEEEEEcccccEEEccEEEEEEcccEEccccccHHHHHHHHHHcccEEEEcEEccccccccEEEEccccccEEEEEEEEEEEEc
cccccccccEEEEEEEEEEccccEEEEEEccccHHHHHHHHcccccHHHHHHHHHccccEEEEEEEEEEccccEEEEEEcccccEEccEEcEEEEcc
mdriardssavvcpvidvlddsslefhfrdSTGILKEALACIgvgwleplldriardnstvvspvielirdddfalrfcrpqfiqiggfswslevrs
mdriardssavvcpvidvlDDSSLEFHFRDSTGILKEALACIGVGWLEPLLDRIARDNSTVVSPVIELIRDDDFALRFCRPQFiqiggfswslevrs
MDRIARDSSAVVCPVIDVLDDSSLEFHFRDSTGILKEALACIGVGWLEPLLDRIARDNSTVVSPVIELIRDDDFALRFCRPQFIQIGGFSWSLEVRS
*********AVVCPVIDVLDDSSLEFHFRDSTGILKEALACIGVGWLEPLLDRIARDNSTVVSPVIELIRDDDFALRFCRPQFIQIGGFSWSL****
*******SSAVVCPVIDVLDDSSLEFHFRDSTGILKEALACIGVGWLEPLLDRIARDNSTVVSPVIELIRDDDFALRFCRPQFIQIGGFSWSLEVRS
********SAVVCPVIDVLDDSSLEFHFRDSTGILKEALACIGVGWLEPLLDRIARDNSTVVSPVIELIRDDDFALRFCRPQFIQIGGFSWSLEVRS
**RIARDSSAVVCPVIDVLDDSSLEFHFRDSTGILKEALACIGVGWLEPLLDRIARDNSTVVSPVIELIRDDDFALRFCRPQFIQIGGFSWSLEVR*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDRIARDSSAVVCPVIDVLDDSSLEFHFRDSTGILKEALACIGVGWLEPLLDRIARDNSTVVSPVIELIRDDDFALRFCRPQFIQIGGFSWSLEVRS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query97 2.2.26 [Sep-21-2011]
Q95ZJ1 626 Polypeptide N-acetylgalac yes N/A 0.515 0.079 0.52 2e-10
Q8MRC9 650 Putative polypeptide N-ac yes N/A 0.515 0.076 0.5 3e-09
Q07537 559 Polypeptide N-acetylgalac yes N/A 0.525 0.091 0.490 2e-07
Q29121 559 Polypeptide N-acetylgalac yes N/A 0.525 0.091 0.490 2e-07
Q10473 559 Polypeptide N-acetylgalac yes N/A 0.525 0.091 0.490 2e-07
Q10472 559 Polypeptide N-acetylgalac yes N/A 0.525 0.091 0.490 2e-07
Q8IUC8 556 Polypeptide N-acetylgalac no N/A 0.525 0.091 0.471 5e-07
Q6UE39 556 Polypeptide N-acetylgalac no N/A 0.525 0.091 0.471 6e-07
Q8CF93 556 Polypeptide N-acetylgalac yes N/A 0.525 0.091 0.471 6e-07
O08912 559 Polypeptide N-acetylgalac no N/A 0.515 0.089 0.480 6e-07
>sp|Q95ZJ1|GALT5_CAEEL Polypeptide N-acetylgalactosaminyltransferase 5 OS=Caenorhabditis elegans GN=gly-5 PE=2 SV=2 Back     alignment and function desciption
 Score = 64.3 bits (155), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 34/50 (68%)

Query: 45  GWLEPLLDRIARDNSTVVSPVIELIRDDDFALRFCRPQFIQIGGFSWSLE 94
           GW+EPLLDRI RD +TVV PVI++I D+ F     +  F  +GGF W L+
Sbjct: 276 GWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQ 325




Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.
Caenorhabditis elegans (taxid: 6239)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 4EC: 1
>sp|Q8MRC9|GALT9_DROME Putative polypeptide N-acetylgalactosaminyltransferase 9 OS=Drosophila melanogaster GN=pgant9 PE=2 SV=2 Back     alignment and function description
>sp|Q07537|GALT1_BOVIN Polypeptide N-acetylgalactosaminyltransferase 1 OS=Bos taurus GN=GALNT1 PE=1 SV=1 Back     alignment and function description
>sp|Q29121|GALT1_PIG Polypeptide N-acetylgalactosaminyltransferase 1 OS=Sus scrofa GN=GALNT1 PE=2 SV=1 Back     alignment and function description
>sp|Q10473|GALT1_RAT Polypeptide N-acetylgalactosaminyltransferase 1 OS=Rattus norvegicus GN=Galnt1 PE=1 SV=1 Back     alignment and function description
>sp|Q10472|GALT1_HUMAN Polypeptide N-acetylgalactosaminyltransferase 1 OS=Homo sapiens GN=GALNT1 PE=1 SV=1 Back     alignment and function description
>sp|Q8IUC8|GLT13_HUMAN Polypeptide N-acetylgalactosaminyltransferase 13 OS=Homo sapiens GN=GALNT13 PE=2 SV=2 Back     alignment and function description
>sp|Q6UE39|GLT13_RAT Polypeptide N-acetylgalactosaminyltransferase 13 OS=Rattus norvegicus GN=Galnt13 PE=2 SV=1 Back     alignment and function description
>sp|Q8CF93|GLT13_MOUSE Polypeptide N-acetylgalactosaminyltransferase 13 OS=Mus musculus GN=Galnt13 PE=2 SV=1 Back     alignment and function description
>sp|O08912|GALT1_MOUSE Polypeptide N-acetylgalactosaminyltransferase 1 OS=Mus musculus GN=Galnt1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query97
324507488 632 Polypeptide N-acetylgalactosaminyltransf 0.515 0.079 0.54 7e-10
427779849 683 Putative polypeptide n-acetylgalactosami 0.793 0.112 0.395 3e-09
3047195 624 GLY5c [Caenorhabditis elegans] 0.515 0.080 0.52 8e-09
3047193 626 GLY5b [Caenorhabditis elegans] 0.515 0.079 0.52 8e-09
3047191 623 GLY5a [Caenorhabditis elegans] 0.515 0.080 0.52 8e-09
71993513 623 Protein GLY-5, isoform b [Caenorhabditis 0.515 0.080 0.52 8e-09
71993517 624 Protein GLY-5, isoform c [Caenorhabditis 0.515 0.080 0.52 8e-09
71993511 626 Protein GLY-5, isoform a [Caenorhabditis 0.515 0.079 0.52 8e-09
170572320 576 glycosyl transferase, group 2 family pro 0.515 0.086 0.52 9e-09
268576200 630 C. briggsae CBR-GLY-5 protein [Caenorhab 0.515 0.079 0.52 9e-09
>gi|324507488|gb|ADY43175.1| Polypeptide N-acetylgalactosaminyltransferase 5 [Ascaris suum] Back     alignment and taxonomy information
 Score = 67.8 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 37/50 (74%)

Query: 45  GWLEPLLDRIARDNSTVVSPVIELIRDDDFALRFCRPQFIQIGGFSWSLE 94
           GW+EPLLDRI R++STVV PVI++I D+ F   + +  F  +GGF WSL+
Sbjct: 282 GWIEPLLDRIKRNSSTVVCPVIDVIDDETFEYHYSKAYFTNVGGFDWSLQ 331




Source: Ascaris suum

Species: Ascaris suum

Genus: Ascaris

Family: Ascarididae

Order: Ascaridida

Class: Chromadorea

Phylum: Nematoda

Superkingdom: Eukaryota

>gi|427779849|gb|JAA55376.1| Putative polypeptide n-acetylgalactosaminyltransferase [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|3047195|gb|AAC13673.1| GLY5c [Caenorhabditis elegans] Back     alignment and taxonomy information
>gi|3047193|gb|AAC13672.1| GLY5b [Caenorhabditis elegans] Back     alignment and taxonomy information
>gi|3047191|gb|AAC13671.1| GLY5a [Caenorhabditis elegans] Back     alignment and taxonomy information
>gi|71993513|ref|NP_001022851.1| Protein GLY-5, isoform b [Caenorhabditis elegans] gi|14530626|emb|CAC42368.1| Protein GLY-5, isoform b [Caenorhabditis elegans] Back     alignment and taxonomy information
>gi|71993517|ref|NP_001022852.1| Protein GLY-5, isoform c [Caenorhabditis elegans] gi|14530627|emb|CAC42369.1| Protein GLY-5, isoform c [Caenorhabditis elegans] Back     alignment and taxonomy information
>gi|71993511|ref|NP_001022850.1| Protein GLY-5, isoform a [Caenorhabditis elegans] gi|51316068|sp|Q95ZJ1.2|GALT5_CAEEL RecName: Full=Polypeptide N-acetylgalactosaminyltransferase 5; Short=pp-GaNTase 5; AltName: Full=Protein-UDP acetylgalactosaminyltransferase 5; AltName: Full=UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 5 gi|5824785|emb|CAB54435.1| Protein GLY-5, isoform a [Caenorhabditis elegans] Back     alignment and taxonomy information
>gi|170572320|ref|XP_001892064.1| glycosyl transferase, group 2 family protein [Brugia malayi] gi|158602953|gb|EDP39125.1| glycosyl transferase, group 2 family protein [Brugia malayi] Back     alignment and taxonomy information
>gi|268576200|ref|XP_002643080.1| C. briggsae CBR-GLY-5 protein [Caenorhabditis briggsae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query97
WB|WBGene00001630 626 gly-5 [Caenorhabditis elegans 0.515 0.079 0.52 3.2e-09
FB|FBgn0050463 650 CG30463 [Drosophila melanogast 0.515 0.076 0.5 1.5e-08
UNIPROTKB|I3LM72112 LOC100520461 "Uncharacterized 0.525 0.455 0.471 4.2e-08
UNIPROTKB|K7EJV8 387 GALNT1 "Polypeptide N-acetylga 0.525 0.131 0.490 1.6e-07
UNIPROTKB|Q07537 559 GALNT1 "Polypeptide N-acetylga 0.525 0.091 0.490 2.3e-07
UNIPROTKB|E2RM54 559 GALNT1 "Uncharacterized protei 0.525 0.091 0.490 2.3e-07
UNIPROTKB|F1SAI6 559 LOC100738545 "Uncharacterized 0.525 0.091 0.490 2.3e-07
UNIPROTKB|Q29121 559 GALNT1 "Polypeptide N-acetylga 0.525 0.091 0.490 2.3e-07
UNIPROTKB|F5GY99 499 GALNT1 "Polypeptide N-acetylga 0.525 0.102 0.490 2.5e-07
UNIPROTKB|Q10472 559 GALNT1 "Polypeptide N-acetylga 0.525 0.091 0.490 3e-07
WB|WBGene00001630 gly-5 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 146 (56.5 bits), Expect = 3.2e-09, P = 3.2e-09
 Identities = 26/50 (52%), Positives = 34/50 (68%)

Query:    45 GWLEPLLDRIARDNSTVVSPVIELIRDDDFALRFCRPQFIQIGGFSWSLE 94
             GW+EPLLDRI RD +TVV PVI++I D+ F     +  F  +GGF W L+
Sbjct:   276 GWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQ 325


GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0016757 "transferase activity, transferring glycosyl groups" evidence=IEA
GO:0046854 "phosphatidylinositol phosphorylation" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0018243 "protein O-linked glycosylation via threonine" evidence=IDA
GO:0004653 "polypeptide N-acetylgalactosaminyltransferase activity" evidence=IDA
FB|FBgn0050463 CG30463 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|I3LM72 LOC100520461 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|K7EJV8 GALNT1 "Polypeptide N-acetylgalactosaminyltransferase 1 soluble form" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q07537 GALNT1 "Polypeptide N-acetylgalactosaminyltransferase 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RM54 GALNT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SAI6 LOC100738545 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q29121 GALNT1 "Polypeptide N-acetylgalactosaminyltransferase 1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F5GY99 GALNT1 "Polypeptide N-acetylgalactosaminyltransferase 1 soluble form" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q10472 GALNT1 "Polypeptide N-acetylgalactosaminyltransferase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q95ZJ1GALT5_CAEEL2, ., 4, ., 1, ., 4, 10.520.51540.0798yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query97
cd02510 299 cd02510, pp-GalNAc-T, pp-GalNAc-T initiates the fo 3e-14
cd02510299 cd02510, pp-GalNAc-T, pp-GalNAc-T initiates the fo 6e-05
>gnl|CDD|133004 cd02510, pp-GalNAc-T, pp-GalNAc-T initiates the formation of mucin-type O-linked glycans Back     alignment and domain information
 Score = 65.7 bits (161), Expect = 3e-14
 Identities = 26/52 (50%), Positives = 30/52 (57%), Gaps = 4/52 (7%)

Query: 44  VGWLEPLLDRIARDNSTVVSPVIELIRDDDFALRFCRPQF-IQIGGFSWSLE 94
           VGWLEPLL RIA +  TVV P+I++I  D F     R       GGF WSL 
Sbjct: 98  VGWLEPLLARIAENRKTVVCPIIDVIDADTFEY---RGSSGDARGGFDWSLH 146


UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferases (pp-GalNAc-T) initiate the formation of mucin-type, O-linked glycans by catalyzing the transfer of alpha-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to hydroxyl groups of Ser or Thr residues of core proteins to form the Tn antigen (GalNAc-a-1-O-Ser/Thr). These enzymes are type II membrane proteins with a GT-A type catalytic domain and a lectin domain located on the lumen side of the Golgi apparatus. In human, there are 15 isozymes of pp-GalNAc-Ts, representing the largest of all glycosyltransferase families. Each isozyme has unique but partially redundant substrate specificity for glycosylation sites on acceptor proteins. Length = 299

>gnl|CDD|133004 cd02510, pp-GalNAc-T, pp-GalNAc-T initiates the formation of mucin-type O-linked glycans Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 97
KOG3736|consensus 578 99.95
KOG3738|consensus 559 99.95
KOG3737|consensus 603 99.85
KOG3736|consensus 578 99.63
KOG3738|consensus 559 99.55
KOG3737|consensus 603 99.01
cd02510299 pp-GalNAc-T pp-GalNAc-T initiates the formation of 98.48
PF10111281 Glyco_tranf_2_2: Glycosyltransferase like family 2 92.97
cd02510 299 pp-GalNAc-T pp-GalNAc-T initiates the formation of 92.78
PF0270978 Glyco_transf_7C: N-terminal domain of galactosyltr 92.43
cd00899219 b4GalT Beta-4-Galactosyltransferase is involved in 82.47
>KOG3736|consensus Back     alignment and domain information
Probab=99.95  E-value=3e-29  Score=200.48  Aligned_cols=94  Identities=29%  Similarity=0.425  Sum_probs=81.7

Q ss_pred             CcccccCCCeEEeceEEEEeCCCceEEec--CCcceEecccceeeeeecc-chhhhhh-cC-CCeEecceee----eEcc
Q psy3381           1 MDRIARDSSAVVCPVIDVLDDSSLEFHFR--DSTGILKEALACIGVGWLE-PLLDRIA-RD-NSTVVSPVIE----LIRD   71 (97)
Q Consensus         1 l~ri~~~~~~vv~PvID~Id~~tf~~~~~--~~~G~f~w~l~~~~~~Wl~-pll~ri~-~~-~~~i~sP~i~----~Id~   71 (97)
                      |+||++|+++|||||||+||.+||+|...  ...|+|+|.   ++|+|.. |+-...+ ++ ..||+||+|+    ||||
T Consensus       248 L~~I~~~r~tvv~PvID~Id~~tf~y~~~~~~~rGgFdW~---l~f~w~~lP~~~~~~~~~~t~PirsPtMaGglFAI~r  324 (578)
T KOG3736|consen  248 LARIAEDRKTVVCPVIDVIDDNTFEYEKQSELMRGGFDWE---LTFKWERLPLPEEKRRELPTDPIRSPTMAGGLFAIDR  324 (578)
T ss_pred             HHHhhhcCceeecceEEeecCcCceecccCccceeeeecc---eeEEeccCCccHhhcccCCCCCcCCcccCCceEEeeH
Confidence            68999999999999999999999999983  345999999   6699964 4433333 44 4689999999    9999


Q ss_pred             cchhhhcc-CCCCceeEEEeeEEEEeC
Q psy3381          72 DDFALRFC-RPQFIQIGGFSWSLEVRS   97 (97)
Q Consensus        72 ~~F~~~g~-d~g~~~~Gg~nwelsfr~   97 (97)
                      +||+++|+ |+||++|||||+|||||+
T Consensus       325 ~yF~eiG~yD~gMdiwGGENlElSfrv  351 (578)
T KOG3736|consen  325 KYFGELGSYDEGMDIWGGENLELSFRV  351 (578)
T ss_pred             HHHhhccCccccccccChhhceeeEEE
Confidence            99999998 999999999999999984



>KOG3738|consensus Back     alignment and domain information
>KOG3737|consensus Back     alignment and domain information
>KOG3736|consensus Back     alignment and domain information
>KOG3738|consensus Back     alignment and domain information
>KOG3737|consensus Back     alignment and domain information
>cd02510 pp-GalNAc-T pp-GalNAc-T initiates the formation of mucin-type O-linked glycans Back     alignment and domain information
>PF10111 Glyco_tranf_2_2: Glycosyltransferase like family 2; InterPro: IPR019290 This conserved domain is found in a set of prokaryotic proteins including putative glucosyltransferases, which are involved in bacterial capsule biosynthesis [, ] Back     alignment and domain information
>cd02510 pp-GalNAc-T pp-GalNAc-T initiates the formation of mucin-type O-linked glycans Back     alignment and domain information
>PF02709 Glyco_transf_7C: N-terminal domain of galactosyltransferase; InterPro: IPR003859 This is a family of galactosyltransferases from a wide range of metazoa with three related galactosyltransferase activities; all three of which are possessed by one sequence in some cases Back     alignment and domain information
>cd00899 b4GalT Beta-4-Galactosyltransferase is involved in the formation of the poly-N-acetyllactosamine core structures present in glycoproteins and glycosphingolipids Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query97
1xhb_A 472 The Crystal Structure Of Udp-Galnac: Polypeptide Al 6e-08
2ffu_A 501 Crystal Structure Of Human Ppgalnact-2 Complexed Wi 2e-06
2d7i_A 570 Crsytal Structure Of Pp-Galnac-T10 With Udp, Galnac 4e-06
>pdb|1XHB|A Chain A, The Crystal Structure Of Udp-Galnac: Polypeptide Alpha-N- Acetylgalactosaminyltransferase-T1 Length = 472 Back     alignment and structure

Iteration: 1

Score = 52.4 bits (124), Expect = 6e-08, Method: Composition-based stats. Identities = 25/52 (48%), Positives = 31/52 (59%), Gaps = 2/52 (3%) Query: 45 GWLEPLLDRIARDNSTVVSPVIELIRDDDFALRFCRPQFIQIGGFSWSLEVR 96 GWLEPLL RI D TVV P+I++I DD F + + GGF+W L R Sbjct: 130 GWLEPLLARIKHDRRTVVCPIIDVISDDTF--EYMAGSDMTYGGFNWKLNFR 179
>pdb|2FFU|A Chain A, Crystal Structure Of Human Ppgalnact-2 Complexed With Udp And Ea2 Length = 501 Back     alignment and structure
>pdb|2D7I|A Chain A, Crsytal Structure Of Pp-Galnac-T10 With Udp, Galnac And Mn2+ Length = 570 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query97
2ffu_A 501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 5e-12
2ffu_A 501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 2e-04
2d7i_A 570 Polypeptide N-acetylgalactosaminyltransferase 10; 1e-10
2d7i_A 570 Polypeptide N-acetylgalactosaminyltransferase 10; 5e-05
1xhb_A 472 Polypeptide N-acetylgalactosaminyltransferase 1; g 7e-10
1xhb_A 472 Polypeptide N-acetylgalactosaminyltransferase 1; g 1e-04
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Length = 501 Back     alignment and structure
 Score = 59.0 bits (142), Expect = 5e-12
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 44  VGWLEPLLDRIARDNSTVVSPVIELIRDDDFALRFCRPQFIQIGGFSWSL 93
             WLEPLL+R+A D + VVSP+I++I  D+F            GGF W+L
Sbjct: 161 EHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASAD--LKGGFDWNL 208


>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Length = 501 Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Length = 570 Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Length = 570 Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Length = 472 Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Length = 472 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query97
1xhb_A 472 Polypeptide N-acetylgalactosaminyltransferase 1; g 98.67
2d7i_A 570 Polypeptide N-acetylgalactosaminyltransferase 10; 98.6
2ffu_A 501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 98.57
1xhb_A 472 Polypeptide N-acetylgalactosaminyltransferase 1; g 94.64
2ffu_A 501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 94.45
2d7i_A 570 Polypeptide N-acetylgalactosaminyltransferase 10; 91.86
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure
Probab=98.67  E-value=3.8e-09  Score=80.46  Aligned_cols=92  Identities=28%  Similarity=0.433  Sum_probs=71.0

Q ss_pred             cccccCCCeEEeceEEEEeCCCceEEecCC--cceEecccceeeeeecc--ch-hhhhhcC-CCeEecceee----eEcc
Q psy3381           2 DRIARDSSAVVCPVIDVLDDSSLEFHFRDS--TGILKEALACIGVGWLE--PL-LDRIARD-NSTVVSPVIE----LIRD   71 (97)
Q Consensus         2 ~ri~~~~~~vv~PvID~Id~~tf~~~~~~~--~G~f~w~l~~~~~~Wl~--pl-l~ri~~~-~~~i~sP~i~----~Id~   71 (97)
                      +.+++++..+++|.++.++.++++|.....  .|+|+|.+   .+.|..  +. ..+...+ ..++.+|.+.    +|.|
T Consensus       137 ~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~irr  213 (472)
T 1xhb_A          137 ARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKL---NFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDR  213 (472)
T ss_dssp             HHHHHCTTEEEEEEEEEECSSSCCEECCCTTEEEEECTTC---CEEEEECCHHHHHHTTTCTTSCEECSBCCSSSEEEEH
T ss_pred             HHHHhCCCEEEEeeeeeEcCCCceeccCCCcccceeeccc---eeecccCCHHHHhcccCCCCCcccCccccceeEEEEH
Confidence            456789999999999999999999976433  38999984   577753  21 1112222 3368888876    8999


Q ss_pred             cchhhhcc-CCCCceeEEEeeEEEEe
Q psy3381          72 DDFALRFC-RPQFIQIGGFSWSLEVR   96 (97)
Q Consensus        72 ~~F~~~g~-d~g~~~~Gg~nwelsfr   96 (97)
                      +.|+.+|+ |+++..||+|+++|++|
T Consensus       214 ~~~~~iGgfde~~~~~g~ED~dl~~R  239 (472)
T 1xhb_A          214 DYFQEIGTYDAGMDIWGGENLEISFR  239 (472)
T ss_dssp             HHHHHTTSCCTTSCTTCCCCSHHHHH
T ss_pred             HHHHHcCCCCCcccccCchhHHHHHH
Confidence            99999998 99999999999999876



>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query97
d1xhba2328 Polypeptide N-acetylgalactosaminyltransferase 1, N 98.35
d1xhba2 328 Polypeptide N-acetylgalactosaminyltransferase 1, N 90.37
>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain
domain: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=98.35  E-value=3.6e-08  Score=69.63  Aligned_cols=91  Identities=29%  Similarity=0.448  Sum_probs=69.0

Q ss_pred             ccccCCCeEEeceEEEEeCCCceEEecCCc--ceEecccceeeeeecc-chhh--hhhcC-CCeEecceee----eEccc
Q psy3381           3 RIARDSSAVVCPVIDVLDDSSLEFHFRDST--GILKEALACIGVGWLE-PLLD--RIARD-NSTVVSPVIE----LIRDD   72 (97)
Q Consensus         3 ri~~~~~~vv~PvID~Id~~tf~~~~~~~~--G~f~w~l~~~~~~Wl~-pll~--ri~~~-~~~i~sP~i~----~Id~~   72 (97)
                      .+++++..+++|.++.|+.++++|......  |.|.|.+   .+.|.. +...  ....+ ..++.+|.+.    .|.|+
T Consensus       131 ~~~~~~~~~v~~~~~~i~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~irr~  207 (328)
T d1xhba2         131 RIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKL---NFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRD  207 (328)
T ss_dssp             HHHHCTTEEEEEEEEEECSSSCCEECCCTTEEEEECTTC---CEEEEECCHHHHHHTTTCTTSCEECSBCCSSSEEEEHH
T ss_pred             HHhcCCCeEEecceeeeccCceeeccCCccccccccccc---cccccccchhhhhccccccccccccceecceeeeeeHH
Confidence            467889999999999999999999875443  8899984   466653 2222  22222 2346666664    78999


Q ss_pred             chhhhcc-CCCCceeEEEeeEEEEe
Q psy3381          73 DFALRFC-RPQFIQIGGFSWSLEVR   96 (97)
Q Consensus        73 ~F~~~g~-d~g~~~~Gg~nwelsfr   96 (97)
                      .|..+|+ |+++..+|||+++|++|
T Consensus       208 ~f~~vGgfDe~~~~~g~ED~Dl~~R  232 (328)
T d1xhba2         208 YFQEIGTYDAGMDIWGGENLEISFR  232 (328)
T ss_dssp             HHHHTTSCCTTSCTTCCCCSHHHHH
T ss_pred             HHHHhCCCCCCCcCcCchHHHHHHH
Confidence            9999999 99999999999998775



>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure