Psyllid ID: psy3462
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 795 | ||||||
| 110671500 | 122 | putative ribosomal protein L31e [Diaphor | 0.093 | 0.606 | 0.959 | 4e-27 | |
| 241122570 | 128 | ribosomal protein L31, putative [Ixodes | 0.090 | 0.562 | 0.708 | 9e-22 | |
| 346470041 | 128 | hypothetical protein [Amblyomma maculatu | 0.088 | 0.546 | 0.728 | 1e-21 | |
| 194246091 | 128 | ribosomal protein L31 [Dermacentor varia | 0.088 | 0.546 | 0.728 | 1e-21 | |
| 114153208 | 128 | ribosomal protein L31 [Argas monolakensi | 0.083 | 0.515 | 0.757 | 2e-21 | |
| 328714715 | 912 | PREDICTED: Fanconi anemia group J protei | 0.069 | 0.060 | 0.628 | 2e-21 | |
| 328714717 | 918 | PREDICTED: Fanconi anemia group J protei | 0.069 | 0.059 | 0.628 | 2e-21 | |
| 332019760 | 123 | 60S ribosomal protein L31 [Acromyrmex ec | 0.083 | 0.536 | 0.742 | 3e-21 | |
| 264667407 | 124 | ribosomal protein L31 [Chrysomela tremul | 0.083 | 0.532 | 0.727 | 3e-21 | |
| 72153924 | 124 | PREDICTED: 60S ribosomal protein L31-lik | 0.093 | 0.596 | 0.675 | 3e-21 |
| >gi|110671500|gb|ABG82001.1| putative ribosomal protein L31e [Diaphorina citri] | Back alignment and taxonomy information |
|---|
Score = 130 bits (326), Expect = 4e-27, Method: Composition-based stats.
Identities = 71/74 (95%), Positives = 72/74 (97%)
Query: 109 MVKKPATKKKPLNEVVTRDYTIHMHKRLHKVGFKKRAPRAIKVVRAFVKKQMGTEDVRID 168
MVKKP TKKKPLNEVVTRDYTIHMHKRLHKVGFKKRAPRAIKVVRAFVKKQMGTEDVRID
Sbjct: 1 MVKKPTTKKKPLNEVVTRDYTIHMHKRLHKVGFKKRAPRAIKVVRAFVKKQMGTEDVRID 60
Query: 169 TRLNKHIWSKGINN 182
TRLNKHIWSKGI +
Sbjct: 61 TRLNKHIWSKGIKS 74
|
Source: Diaphorina citri Species: Diaphorina citri Genus: Diaphorina Family: Psyllidae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|241122570|ref|XP_002403582.1| ribosomal protein L31, putative [Ixodes scapularis] gi|67084033|gb|AAY66951.1| ribosomal protein L31, partial [Ixodes scapularis] gi|215493472|gb|EEC03113.1| ribosomal protein L31, putative [Ixodes scapularis] | Back alignment and taxonomy information |
|---|
| >gi|346470041|gb|AEO34865.1| hypothetical protein [Amblyomma maculatum] | Back alignment and taxonomy information |
|---|
| >gi|194246091|gb|ACF35537.1| ribosomal protein L31 [Dermacentor variabilis] | Back alignment and taxonomy information |
|---|
| >gi|114153208|gb|ABI52770.1| ribosomal protein L31 [Argas monolakensis] | Back alignment and taxonomy information |
|---|
| >gi|328714715|ref|XP_003245432.1| PREDICTED: Fanconi anemia group J protein homolog isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328714717|ref|XP_001943091.2| PREDICTED: Fanconi anemia group J protein homolog isoform 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|332019760|gb|EGI60224.1| 60S ribosomal protein L31 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|264667407|gb|ACY71289.1| ribosomal protein L31 [Chrysomela tremula] | Back alignment and taxonomy information |
|---|
| >gi|72153924|ref|XP_793832.1| PREDICTED: 60S ribosomal protein L31-like [Strongylocentrotus purpuratus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 795 | ||||||
| UNIPROTKB|J3QSE8 | 994 | BRIP1 "Fanconi anemia group J | 0.101 | 0.081 | 0.566 | 8.3e-27 | |
| UNIPROTKB|J9NVZ8 | 1214 | BRIP1 "Uncharacterized protein | 0.101 | 0.066 | 0.566 | 8.7e-27 | |
| UNIPROTKB|E2RHN5 | 1244 | BRIP1 "Uncharacterized protein | 0.101 | 0.065 | 0.566 | 9.3e-27 | |
| MGI|MGI:2442836 | 1174 | Brip1 "BRCA1 interacting prote | 0.101 | 0.068 | 0.578 | 1e-26 | |
| UNIPROTKB|E1C1X9 | 1249 | BRIP1 "Fanconi anemia group J | 0.100 | 0.064 | 0.560 | 1.3e-26 | |
| UNIPROTKB|Q3YK19 | 1252 | BRIP1 "Fanconi anemia group J | 0.100 | 0.063 | 0.560 | 1.3e-26 | |
| UNIPROTKB|Q9BX63 | 1249 | BRIP1 "Fanconi anemia group J | 0.101 | 0.064 | 0.566 | 1.6e-26 | |
| ZFIN|ZDB-GENE-081107-11 | 1217 | brip1 "BRCA1 interacting prote | 0.108 | 0.070 | 0.539 | 1.2e-25 | |
| RGD|1307659 | 818 | Brip1 "BRCA1 interacting prote | 0.101 | 0.099 | 0.554 | 2e-25 | |
| DICTYBASE|DDB_G0286621 | 1078 | fncJ "DEAD/DEAH box helicase" | 0.090 | 0.066 | 0.541 | 3.8e-25 |
| UNIPROTKB|J3QSE8 BRIP1 "Fanconi anemia group J protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 253 (94.1 bits), Expect = 8.3e-27, Sum P(2) = 8.3e-27
Identities = 47/83 (56%), Positives = 62/83 (74%)
Query: 612 GLLKGGDWYQIQAYRALNQALGRCIRHRYDWGAILLVDQRFYSKNSQ--QGLSKWVRNQV 669
GLL G WY+IQAYRALNQALGRCIRHR DWGA++LVD RF + S+ GLSKWVR Q+
Sbjct: 809 GLLPGRQWYEIQAYRALNQALGRCIRHRNDWGALILVDDRFRNNPSRYISGLSKWVRQQI 868
Query: 670 QNTSSHNTFMENLRNFVRRRMEI 692
Q+ S+ + +E+L F ++ ++
Sbjct: 869 QHHSTFESALESLAEFSKKHQKV 891
|
|
| UNIPROTKB|J9NVZ8 BRIP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RHN5 BRIP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2442836 Brip1 "BRCA1 interacting protein C-terminal helicase 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C1X9 BRIP1 "Fanconi anemia group J protein homolog" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3YK19 BRIP1 "Fanconi anemia group J protein homolog" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9BX63 BRIP1 "Fanconi anemia group J protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-081107-11 brip1 "BRCA1 interacting protein C-terminal helicase 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|1307659 Brip1 "BRCA1 interacting protein C-terminal helicase 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0286621 fncJ "DEAD/DEAH box helicase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 795 | |||
| pfam01198 | 83 | pfam01198, Ribosomal_L31e, Ribosomal protein L31e | 4e-31 | |
| cd00463 | 83 | cd00463, Ribosomal_L31e, Eukaryotic/archaeal ribos | 2e-27 | |
| COG2097 | 89 | COG2097, RPL31A, Ribosomal protein L31E [Translati | 6e-21 | |
| pfam13307 | 165 | pfam13307, Helicase_C_2, Helicase C-terminal domai | 5e-16 | |
| PRK01192 | 89 | PRK01192, PRK01192, 50S ribosomal protein L31e; Re | 1e-12 | |
| PTZ00193 | 188 | PTZ00193, PTZ00193, 60S ribosomal protein L31; Pro | 4e-12 | |
| TIGR00604 | 705 | TIGR00604, rad3, DNA repair helicase (rad3) | 8e-11 | |
| smart00488 | 289 | smart00488, DEXDc2, DEAD-like helicases superfamil | 8e-09 | |
| smart00488 | 289 | smart00488, DEXDc2, DEAD-like helicases superfamil | 1e-08 | |
| smart00491 | 142 | smart00491, HELICc2, helicase superfamily c-termin | 1e-08 | |
| COG1199 | 654 | COG1199, DinG, Rad3-related DNA helicases [Transcr | 2e-07 | |
| COG1199 | 654 | COG1199, DinG, Rad3-related DNA helicases [Transcr | 5e-05 | |
| COG1199 | 654 | COG1199, DinG, Rad3-related DNA helicases [Transcr | 1e-04 | |
| TIGR00604 | 705 | TIGR00604, rad3, DNA repair helicase (rad3) | 3e-04 | |
| TIGR00604 | 705 | TIGR00604, rad3, DNA repair helicase (rad3) | 0.002 | |
| pfam03133 | 291 | pfam03133, TTL, Tubulin-tyrosine ligase family | 0.003 |
| >gnl|CDD|216358 pfam01198, Ribosomal_L31e, Ribosomal protein L31e | Back alignment and domain information |
|---|
Score = 116 bits (292), Expect = 4e-31
Identities = 40/62 (64%), Positives = 47/62 (75%), Gaps = 1/62 (1%)
Query: 121 NEVVTRDYTIHMHKRLHKVGFKKRAPRAIKVVRAFVKKQMGTEDVRIDTRLNKHIWSKGI 180
EVVTR+YTI++ KR V FKKRAPRAIK +R F K M T+DVRID +LNK IWS+GI
Sbjct: 1 EEVVTREYTINLRKR-KGVPFKKRAPRAIKEIRKFAAKHMKTDDVRIDPKLNKAIWSRGI 59
Query: 181 NN 182
N
Sbjct: 60 RN 61
|
Length = 83 |
| >gnl|CDD|199209 cd00463, Ribosomal_L31e, Eukaryotic/archaeal ribosomal protein L31 | Back alignment and domain information |
|---|
| >gnl|CDD|225008 COG2097, RPL31A, Ribosomal protein L31E [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|222037 pfam13307, Helicase_C_2, Helicase C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|234916 PRK01192, PRK01192, 50S ribosomal protein L31e; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|140220 PTZ00193, PTZ00193, 60S ribosomal protein L31; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233047 TIGR00604, rad3, DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >gnl|CDD|214693 smart00488, DEXDc2, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|214693 smart00488, DEXDc2, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|214694 smart00491, HELICc2, helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|224120 COG1199, DinG, Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|224120 COG1199, DinG, Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|224120 COG1199, DinG, Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233047 TIGR00604, rad3, DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >gnl|CDD|233047 TIGR00604, rad3, DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >gnl|CDD|217380 pfam03133, TTL, Tubulin-tyrosine ligase family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 795 | |||
| KOG1131|consensus | 755 | 100.0 | ||
| KOG1133|consensus | 821 | 100.0 | ||
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 100.0 | |
| KOG1132|consensus | 945 | 100.0 | ||
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 99.95 | |
| PTZ00193 | 188 | 60S ribosomal protein L31; Provisional | 99.94 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 99.93 | |
| PF01198 | 83 | Ribosomal_L31e: Ribosomal protein L31e; InterPro: | 99.93 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 99.93 | |
| PRK01192 | 89 | 50S ribosomal protein L31e; Reviewed | 99.92 | |
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 99.92 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 99.92 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 99.91 | |
| KOG0893|consensus | 125 | 99.91 | ||
| COG2097 | 89 | RPL31A Ribosomal protein L31E [Translation, riboso | 99.89 | |
| smart00491 | 142 | HELICc2 helicase superfamily c-terminal domain. | 99.88 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 99.88 | |
| PF13307 | 167 | Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 | 99.85 | |
| smart00492 | 141 | HELICc3 helicase superfamily c-terminal domain. | 99.85 | |
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 99.55 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 99.55 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 99.52 | |
| KOG1133|consensus | 821 | 99.47 | ||
| KOG1132|consensus | 945 | 99.36 | ||
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 99.28 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 99.24 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 99.08 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 99.01 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 98.78 | |
| KOG1131|consensus | 755 | 98.73 | ||
| PF06733 | 174 | DEAD_2: DEAD_2; InterPro: IPR010614 This represent | 98.64 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 98.63 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 98.57 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 98.24 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 98.19 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 98.11 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 98.07 | |
| PTZ00110 | 545 | helicase; Provisional | 98.06 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 98.05 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 98.0 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 97.98 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 97.98 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 97.98 | |
| PTZ00424 | 401 | helicase 45; Provisional | 97.96 | |
| KOG0345|consensus | 567 | 97.93 | ||
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 97.87 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 97.84 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 97.83 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 97.79 | |
| KOG0348|consensus | 708 | 97.77 | ||
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 97.71 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 97.66 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 97.62 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 97.55 | |
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 97.52 | |
| KOG0331|consensus | 519 | 97.52 | ||
| PRK02362 | 737 | ski2-like helicase; Provisional | 97.51 | |
| KOG0342|consensus | 543 | 97.46 | ||
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 97.45 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 97.44 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 97.41 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 97.4 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 97.4 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 97.35 | |
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 97.35 | |
| KOG0348|consensus | 708 | 97.34 | ||
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 97.31 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 97.31 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 97.3 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 97.3 | |
| KOG0335|consensus | 482 | 97.29 | ||
| PTZ00424 | 401 | helicase 45; Provisional | 97.29 | |
| KOG0345|consensus | 567 | 97.23 | ||
| PRK00254 | 720 | ski2-like helicase; Provisional | 97.23 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 97.23 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 97.23 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 97.22 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 97.22 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 97.21 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 97.19 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 97.14 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 97.09 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 97.08 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 97.05 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 97.0 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 97.0 | |
| PTZ00110 | 545 | helicase; Provisional | 96.97 | |
| KOG0344|consensus | 593 | 96.95 | ||
| KOG0331|consensus | 519 | 96.9 | ||
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 96.9 | |
| KOG0330|consensus | 476 | 96.85 | ||
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 96.84 | |
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 96.82 | |
| KOG0346|consensus | 569 | 96.79 | ||
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 96.7 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 96.67 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 96.67 | |
| KOG0333|consensus | 673 | 96.66 | ||
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 96.65 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 96.6 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 96.49 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 96.48 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 96.45 | |
| KOG0350|consensus | 620 | 96.43 | ||
| PRK14701 | 1638 | reverse gyrase; Provisional | 96.4 | |
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 96.37 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 96.32 | |
| KOG0330|consensus | 476 | 96.32 | ||
| KOG0338|consensus | 691 | 96.27 | ||
| KOG0336|consensus | 629 | 96.24 | ||
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 96.23 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 96.21 | |
| KOG0340|consensus | 442 | 96.1 | ||
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 96.04 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 96.04 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 96.03 | |
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 95.98 | |
| KOG0343|consensus | 758 | 95.94 | ||
| KOG0347|consensus | 731 | 95.93 | ||
| KOG0350|consensus | 620 | 95.92 | ||
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 95.92 | |
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 95.88 | |
| KOG0335|consensus | 482 | 95.86 | ||
| PRK09694 | 878 | helicase Cas3; Provisional | 95.82 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 95.81 | |
| KOG0334|consensus | 997 | 95.77 | ||
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 95.75 | |
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 95.72 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 95.7 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 95.65 | |
| KOG0334|consensus | 997 | 95.61 | ||
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 95.5 | |
| KOG0344|consensus | 593 | 95.47 | ||
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 95.45 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 95.41 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 95.38 | |
| KOG0339|consensus | 731 | 95.34 | ||
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 95.31 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 95.21 | |
| KOG0342|consensus | 543 | 95.17 | ||
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 95.04 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 95.01 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 94.93 | |
| KOG0333|consensus | 673 | 94.92 | ||
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 94.91 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 94.73 | |
| KOG0346|consensus | 569 | 94.67 | ||
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 94.52 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 94.49 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 94.46 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 94.41 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 94.33 | |
| KOG0326|consensus | 459 | 94.3 | ||
| PRK13766 | 773 | Hef nuclease; Provisional | 94.28 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 94.13 | |
| KOG0337|consensus | 529 | 94.05 | ||
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 94.05 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 94.04 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 93.97 | |
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 93.93 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 93.85 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 93.64 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 93.53 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 93.41 | |
| KOG0352|consensus | 641 | 93.35 | ||
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 93.14 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 93.11 | |
| KOG0343|consensus | 758 | 93.09 | ||
| KOG0952|consensus | 1230 | 93.06 | ||
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 93.03 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 92.62 | |
| KOG0327|consensus | 397 | 92.54 | ||
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 91.94 | |
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 91.93 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 91.93 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 91.89 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 91.6 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 91.58 | |
| COG1203 | 733 | CRISPR-associated helicase Cas3 [Defense mechanism | 91.12 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 91.05 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 91.05 | |
| PRK15483 | 986 | type III restriction-modification system StyLTI en | 91.04 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 90.92 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 90.59 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 90.59 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 90.33 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 90.26 | |
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 90.04 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 89.94 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 89.87 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 89.84 | |
| KOG0354|consensus | 746 | 89.6 | ||
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 89.55 | |
| KOG0349|consensus | 725 | 89.1 | ||
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 88.87 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 88.75 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 88.74 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 88.43 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 88.34 | |
| KOG0341|consensus | 610 | 88.32 | ||
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 88.01 | |
| PRK15483 | 986 | type III restriction-modification system StyLTI en | 87.65 | |
| KOG0351|consensus | 941 | 87.55 | ||
| KOG0354|consensus | 746 | 87.41 | ||
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 87.06 | |
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 86.71 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 86.26 | |
| KOG0353|consensus | 695 | 86.16 | ||
| KOG0328|consensus | 400 | 86.14 | ||
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 86.0 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 85.95 | |
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 85.83 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 85.71 | |
| KOG0340|consensus | 442 | 85.71 | ||
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 85.64 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 85.42 | |
| KOG4284|consensus | 980 | 85.37 | ||
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 85.29 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 85.24 | |
| PHA02244 | 383 | ATPase-like protein | 85.13 | |
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 85.12 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 85.11 | |
| KOG0952|consensus | 1230 | 85.08 | ||
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 85.05 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 84.78 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 84.62 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 84.62 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 84.25 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 84.04 | |
| PHA02244 | 383 | ATPase-like protein | 83.95 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 83.59 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 83.42 | |
| COG4889 | 1518 | Predicted helicase [General function prediction on | 83.21 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 83.17 | |
| PRK08181 | 269 | transposase; Validated | 83.08 | |
| KOG0920|consensus | 924 | 82.84 | ||
| PRK09183 | 259 | transposase/IS protein; Provisional | 82.8 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 82.61 | |
| COG1203 | 733 | CRISPR-associated helicase Cas3 [Defense mechanism | 82.4 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 82.34 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 82.3 | |
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 82.21 | |
| PRK08181 | 269 | transposase; Validated | 82.01 | |
| KOG0347|consensus | 731 | 82.0 | ||
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 81.98 | |
| TIGR02688 | 449 | conserved hypothetical protein TIGR02688. Members | 81.7 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 81.58 | |
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 81.57 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 81.44 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 81.37 | |
| PRK06526 | 254 | transposase; Provisional | 81.37 | |
| COG0630 | 312 | VirB11 Type IV secretory pathway, VirB11 component | 81.25 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 81.22 | |
| PRK06526 | 254 | transposase; Provisional | 81.06 | |
| KOG0336|consensus | 629 | 81.04 | ||
| KOG0349|consensus | 725 | 80.98 | ||
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 80.97 | |
| PF00158 | 168 | Sigma54_activat: Sigma-54 interaction domain; Inte | 80.65 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 80.34 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 80.18 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 80.13 |
| >KOG1131|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.2e-56 Score=487.71 Aligned_cols=355 Identities=22% Similarity=0.349 Sum_probs=309.9
Q ss_pred cceeeCCeeeccCCC-CCHHHHHHHHHHHHHhcCCccccccchhhhhHHHHHhhccccCcEEEeCCCCCChhHHHHHHHH
Q psy3462 235 TSYTIGGVKVEFPVK-AYPSQISMMNQVSNLFEQPNHFLKYSSCKILHLQVIQGCNKAKNCLLESPTGSGKTLALLCSVL 313 (795)
Q Consensus 235 ~~~~~~~~~~~fpy~-~yp~Q~~mm~~i~~~l~~~~~~~~~~~~~~~~~~~i~al~~~~~~l~EaPTGTGKTlayL~~~l 313 (795)
|+|.|+++.|.|||. .||.|+.+|.+++++|++ ++|+++|+|+|||||.|+|.-++
T Consensus 1 Mk~~id~l~v~FPY~~iYPEQ~~YM~elKrsLDa-----------------------kGh~llEMPSGTGKTvsLLSli~ 57 (755)
T KOG1131|consen 1 MKFYIDDLLVYFPYDYIYPEQYEYMRELKRSLDA-----------------------KGHCLLEMPSGTGKTVSLLSLII 57 (755)
T ss_pred CeeeecCeeEecCCcccCHHHHHHHHHHHHhhcc-----------------------CCcEEEECCCCCCcchHHHHHHH
Confidence 679999999999997 699999999999999986 58999999999999999999999
Q ss_pred HHHHHhhHHHHHHHHhhhhhhhhhcCCCCceEEEecccccccccchhhHHHHHHhHHHHHHHHHHHHhhcccccceeeec
Q psy3462 314 AWQRKEKELVQQKMFEQRTQDLQKIPFRKLKISRLKAKDFSTNNGMEQQLLTCITTINQQEDELRQSTKKTRVDKLKVLN 393 (795)
Q Consensus 314 ~~~~~~~k~LQ~Ql~~kdip~l~~i~~~~l~~~~~KGr~~~~~~~~~~~L~~~~rt~~q~e~el~~~~~~~~~~~~~~l~ 393 (795)
+|+..++. ...+|+||+||+.++|+.|.+++. ++.
T Consensus 58 aYq~~~p~-------------------------------------~~~KliYCSRTvpEieK~l~El~~--------l~~ 92 (755)
T KOG1131|consen 58 AYQLHYPD-------------------------------------EHRKLIYCSRTVPEIEKALEELKR--------LMD 92 (755)
T ss_pred HHHHhCCc-------------------------------------ccceEEEecCcchHHHHHHHHHHH--------HHH
Confidence 99988753 467899999999999999999997 899
Q ss_pred ccccccccchhhh-hhccccccceeecccchhhHHhhh-hhcccccccccccccccccccchhhhHhhhcccC---CCCc
Q psy3462 394 GRSKNLVSSIDFI-LGLLYKGIQTCITTINQQEDELRQ-STKKTKVDKLKVLNGRSKNLVSSIDFILGLLYKG---VNCE 468 (795)
Q Consensus 394 sR~~~~~~~~~~~-~~~~~~~~~lCi~~~~~~v~~~~~-~~~~~~c~~l~~~~~~~~~~~~~~~~~~~~~~~~---~~C~ 468 (795)
.|.|++|..++|+ |||++| ||||| ||+|..+|. ++||++||+| +++ |+++++..+ ..|+
T Consensus 93 y~~k~~g~~~~flglglssR-KNlCi---~~~v~~~r~g~~VD~~Cr~l--tas----------~vr~~~~ed~~~~~C~ 156 (755)
T KOG1131|consen 93 YREKHLGYPEPFLGLGLSSR-KNLCI---HPEVLKERNGNVVDAACRKL--TAS----------YVRAKLAEDPNVELCD 156 (755)
T ss_pred HHHHhcCCCCceeeeeeccc-ccccc---CHHHHHHhcCCchhHHHHHH--hHH----------HHHHHHhcCCCcchhh
Confidence 9999999999999 999999 99999 779999999 5889999888 444 455555544 3599
Q ss_pred cchhcccchhhhhhhhhhhhhcccccCccccccCCCCChhHHHHHhhhCCccccchhhhhh-----------HH------
Q psy3462 469 DYHVCMESSVAFDQLIQLDLMLDEHLNPYVLKVKDTPCIEDLEQFSTRALVSPCFQLIQLD-----------LM------ 531 (795)
Q Consensus 469 ~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dL~~~~~~~~~cpyf~~~q~~-----------~~------ 531 (795)
||||+++ ....+|+|| |++|||++||++++|||||++|+-= +.
T Consensus 157 -f~en~~~-------------~~~~lp~gv------y~~~dL~~~g~~k~~CPYflaR~~I~~~nvivYsYhYllDPkIa 216 (755)
T KOG1131|consen 157 -FFENLED-------------KESLLPVGV------YTLEDLKEYGEKKGWCPYFLARRMIPFANVIVYSYHYLLDPKIA 216 (755)
T ss_pred -HHhhhhc-------------ccccCCccc------ccHHHHHHhhhcCCcChHHHHHHhhhcccEEEEehhhhcChHHH
Confidence 7788777 123588887 9999999999999999999986410 00
Q ss_pred --------------------------------------------------------------HH----------------
Q psy3462 532 --------------------------------------------------------------LD---------------- 533 (795)
Q Consensus 532 --------------------------------------------------------------~~---------------- 533 (795)
|+
T Consensus 217 ~~VSkels~~svVvFDEAHNIDnvCIeslSv~i~r~~l~ra~~~l~~l~~~v~r~k~~d~~kl~~eY~klvegL~~~~~~ 296 (755)
T KOG1131|consen 217 ELVSKELSKESVVVFDEAHNIDNVCIESLSVDITRRTLERASRNLNSLEQLVNRVKETDSQKLQDEYEKLVEGLKDASAE 296 (755)
T ss_pred HHHHHhhCcCcEEEecccccccchhhhhhhhhhhHHHHHHHHHHHHHHHHHHHhhhhcchhHHHHHHHHHHHHhhccccc
Confidence 00
Q ss_pred --------------------------------------------------------------------------------
Q psy3462 534 -------------------------------------------------------------------------------- 533 (795)
Q Consensus 534 -------------------------------------------------------------------------------- 533 (795)
T Consensus 297 ~~~d~~lanPvLP~dvl~EavPGniR~aeHFv~fLkR~~ey~ktrl~~~hv~~Esp~sFl~~i~~~~~IerKplrFCaeR 376 (755)
T KOG1131|consen 297 RDEDQFLANPVLPDDVLKEAVPGNIRRAEHFVSFLKRLLEYLKTRLKVHHVIQESPASFLKSIKSLTFIERKPLRFCAER 376 (755)
T ss_pred cCccchhcCCCCchhhhhhhCCcchhhHHHHHHHHHHHHHHHHHhhhheeeeccCcHHHHHHHHHhhhhhccchHHHHHH
Confidence
Q ss_pred --------------------------------------------------------------------------------
Q psy3462 534 -------------------------------------------------------------------------------- 533 (795)
Q Consensus 534 -------------------------------------------------------------------------------- 533 (795)
T Consensus 377 L~~L~~tLeitd~~df~~l~~v~~faTlVstY~kGF~iIiEPfd~~~~tv~npil~~sClDaSiAikPVf~RFqsViITS 456 (755)
T KOG1131|consen 377 LSSLVRTLEITDVEDFGALKTVADFATLVSTYSKGFSIIIEPFDDRNPTVPNPILRFSCLDASIAIKPVFERFQSVIITS 456 (755)
T ss_pred HHHHHHHhccCchhhhhHHHHHHHHHHHHHHHhcCcEEEEcccccCCCCCCCCeeEEeecccchhhhHHHHhhheEEEec
Confidence
Q ss_pred --------------------------------------------------------------------------------
Q psy3462 534 -------------------------------------------------------------------------------- 533 (795)
Q Consensus 534 -------------------------------------------------------------------------------- 533 (795)
T Consensus 457 GTlspldmyPk~lnf~pv~~~s~~mtLaR~c~~PmiitrG~Dqv~iss~fe~r~d~~VvrnyG~llve~sk~vpdG~v~f 536 (755)
T KOG1131|consen 457 GTLSPLDMYPKILNFGPVVGASFTMTLARNCLLPLIITRGNDQVAISSKFEARGDPSVVRNYGNLLVEMSKIVPDGIVCF 536 (755)
T ss_pred CcccccccCchhhccCcccchhhheecccccccceeeecCCcchhhhhhhhhccChHHHhhcCcceeeecccCCCceEEE
Confidence
Q ss_pred ----HhhhHHHHHhccccchHHhhccCcEEEcCCCcchhhHHhhhcccce--------eEeecCc---------cccceE
Q psy3462 534 ----EHLNPYVLKVKDTPCIEDLVLKRNIFYDTLMLCDVQTKETKHRDSV--------KQVMGKG---------NLELCK 592 (795)
Q Consensus 534 ----~~me~iv~~W~~tgil~~I~~~K~IFiE~kd~~e~~~~L~~Y~~ai--------fAV~GGK---------nl~rcV 592 (795)
-|||+++++|+++||+++++++|++|+|++|..++.-+|++|+.+| |+|+||| ++||||
T Consensus 537 f~sylYmesiv~~w~~~gil~ei~k~KL~fIetpD~~ETs~al~ny~~aC~~gRGavl~sVargkVsEgidF~hhyGR~V 616 (755)
T KOG1131|consen 537 FPSYLYMESIVSRWYEQGILDEIMKYKLLFIETPDFRETSLALANYRYACDNGRGAVLLSVARGKVSEGIDFDHHYGREV 616 (755)
T ss_pred EehHHHHHHHHHHHHHHhHHHHHhhCceEEEeCCchhhhHHHHHHHHHHhcCCCCceEEEEecCccccCcccccccCceE
Confidence 1556666666677999999999999999999999999999998887 8999998 599999
Q ss_pred EEEecCCCCCCCccccc------ccccCCcccchHHHHHHHHHhccCccccccCceeEEEEeecccCChhhhhhHhHHHH
Q psy3462 593 GVFWTRFPNTCQYSVVY------PTGLLKGGDWYQIQAYRALNQALGRCIRHRYDWGAILLVDQRFYSKNSQQGLSKWVR 666 (795)
Q Consensus 593 iVVGIPYPn~~d~~Lk~------~~~~~~G~ewY~~~AmRaVNQAIGRvIRHknDyGaIiLlD~Rf~~~~~~~~LP~WIr 666 (795)
+|.||||.++.+..+++ ....+..++|.+++|||...||+||++|.++|||.+||.|+||...+.+.+||+|++
T Consensus 617 iM~gIP~qytesriLkarle~Lrd~~~irE~dflTFDAmRhaAQC~GrvLr~K~dYg~mI~aDkRf~R~dKR~klp~wi~ 696 (755)
T KOG1131|consen 617 IMEGIPYQYTESRILKARLEYLRDQFQIRENDFLTFDAMRHAAQCLGRVLRGKTDYGLMIFADKRFSRGDKRSKLPKWIR 696 (755)
T ss_pred EEEeccchhhHHHHHHHHHHHHHHHhcccccceechHhHHHHHHHHHHHHhccccceeeEeeehhhccccchhhhhHHHH
Confidence 99999999999888773 345677899999999999999999999999999999999999999999999999999
Q ss_pred hhcccc---CChhHHHHHHHHHHHHHHHhh
Q psy3462 667 NQVQNT---SSHNTFMENLRNFVRRRMEIQ 693 (795)
Q Consensus 667 ~~l~~~---~sfe~~~~~l~~Ffk~~k~~~ 693 (795)
+++... -+.+.+....+.|++.|.+..
T Consensus 697 ~~l~~~~~nlstd~a~~varrflR~maQp~ 726 (755)
T KOG1131|consen 697 NHLFDAKLNLSTDMANQVARRFLRLMAQPF 726 (755)
T ss_pred hhhhhhccCCCcchhHHHHHHHHHHhcCCC
Confidence 998654 378889999999999998865
|
|
| >KOG1133|consensus | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >KOG1132|consensus | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PTZ00193 60S ribosomal protein L31; Provisional | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >PF01198 Ribosomal_L31e: Ribosomal protein L31e; InterPro: IPR000054 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PRK01192 50S ribosomal protein L31e; Reviewed | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >KOG0893|consensus | Back alignment and domain information |
|---|
| >COG2097 RPL31A Ribosomal protein L31E [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >smart00491 HELICc2 helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A | Back alignment and domain information |
|---|
| >smart00492 HELICc3 helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >KOG1133|consensus | Back alignment and domain information |
|---|
| >KOG1132|consensus | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >KOG1131|consensus | Back alignment and domain information |
|---|
| >PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >KOG0345|consensus | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >KOG0348|consensus | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0331|consensus | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0342|consensus | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0348|consensus | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >KOG0335|consensus | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >KOG0345|consensus | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0344|consensus | Back alignment and domain information |
|---|
| >KOG0331|consensus | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >KOG0330|consensus | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0346|consensus | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >KOG0333|consensus | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0350|consensus | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >KOG0330|consensus | Back alignment and domain information |
|---|
| >KOG0338|consensus | Back alignment and domain information |
|---|
| >KOG0336|consensus | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >KOG0340|consensus | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0343|consensus | Back alignment and domain information |
|---|
| >KOG0347|consensus | Back alignment and domain information |
|---|
| >KOG0350|consensus | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0335|consensus | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0334|consensus | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >KOG0334|consensus | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >KOG0344|consensus | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >KOG0339|consensus | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >KOG0342|consensus | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >KOG0333|consensus | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >KOG0346|consensus | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >KOG0326|consensus | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0337|consensus | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >KOG0352|consensus | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >KOG0343|consensus | Back alignment and domain information |
|---|
| >KOG0952|consensus | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >KOG0327|consensus | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >KOG0354|consensus | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >KOG0349|consensus | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >KOG0341|consensus | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional | Back alignment and domain information |
|---|
| >KOG0351|consensus | Back alignment and domain information |
|---|
| >KOG0354|consensus | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >KOG0353|consensus | Back alignment and domain information |
|---|
| >KOG0328|consensus | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0340|consensus | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >KOG4284|consensus | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0952|consensus | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >COG4889 Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >KOG0920|consensus | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >KOG0347|consensus | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >TIGR02688 conserved hypothetical protein TIGR02688 | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >KOG0336|consensus | Back alignment and domain information |
|---|
| >KOG0349|consensus | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 795 | ||||
| 2zkr_x | 125 | Structure Of A Mammalian Ribosomal 60s Subunit With | 1e-21 | ||
| 2go5_6 | 123 | Structure Of Signal Recognition Particle Receptor ( | 3e-18 | ||
| 3izr_g | 123 | Localization Of The Large Subunit Ribosomal Protein | 2e-16 | ||
| 1s1i_W | 112 | Structure Of The Ribosomal 80s-Eef2-Sordarin Comple | 4e-16 | ||
| 2ww9_M | 113 | Cryo-Em Structure Of The Active Yeast Ssh1 Complex | 4e-16 | ||
| 4a17_W | 111 | T.Thermophila 60s Ribosomal Subunit In Complex With | 7e-15 | ||
| 3jyw_W | 79 | Structure Of The 60s Proteins For Eukaryotic Riboso | 8e-14 | ||
| 3zf7_h | 188 | High-resolution Cryo-electron Microscopy Structure | 4e-09 | ||
| 3j21_a | 95 | Promiscuous Behavior Of Proteins In Archaeal Riboso | 1e-04 |
| >pdb|2ZKR|XX Chain x, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 125 | Back alignment and structure |
|
| >pdb|2GO5|6 Chain 6, Structure Of Signal Recognition Particle Receptor (Sr) In Complex With Signal Recognition Particle (Srp) And Ribosome Nascent Chain Complex Length = 123 | Back alignment and structure |
| >pdb|3IZR|GG Chain g, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 123 | Back alignment and structure |
| >pdb|1S1I|W Chain W, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1i, Contains 60s Subunit. The 40s Ribosomal Subunit Is In File 1s1h Length = 112 | Back alignment and structure |
| >pdb|2WW9|M Chain M, Cryo-Em Structure Of The Active Yeast Ssh1 Complex Bound To The Yeast 80s Ribosome Length = 113 | Back alignment and structure |
| >pdb|4A17|W Chain W, T.Thermophila 60s Ribosomal Subunit In Complex With Initiation Factor 6. This File Contains 5s Rrna, 5.8s Rrna And Proteins Of Molecule 2. Length = 111 | Back alignment and structure |
| >pdb|3JYW|W Chain W, Structure Of The 60s Proteins For Eukaryotic Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 79 | Back alignment and structure |
| >pdb|3ZF7|HH Chain h, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 188 | Back alignment and structure |
| >pdb|3J21|AA Chain a, Promiscuous Behavior Of Proteins In Archaeal Ribosomes Revealed By Cryo-em: Implications For Evolution Of Eukaryotic Ribosomes (50s Ribosomal Proteins) Length = 95 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 795 | |||
| 3iz5_G | 219 | 60S ribosomal protein L6 (L6E); eukaryotic ribosom | 2e-30 | |
| 3u5e_D | 297 | 60S ribosomal protein L5; translation, ribosome, r | 4e-29 | |
| 2zkr_x | 125 | 60S ribosomal protein L31; protein-RNA complex, 60 | 7e-29 | |
| 4a17_W | 111 | RPL31, 60S ribosomal protein L31; eukaryotic ribos | 5e-28 | |
| 1vq8_X | 92 | 50S ribosomal protein L31E; ribosome 50S, protein- | 1e-27 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 2e-17 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 4e-04 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 1e-15 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 5e-04 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 4e-13 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-09 |
| >3u5e_D 60S ribosomal protein L5; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_D 3izc_Q 3izs_Q 3o58_E 3o5h_E 3jyw_E 1s1i_E Length = 297 | Back alignment and structure |
|---|
| >2zkr_x 60S ribosomal protein L31; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 125 | Back alignment and structure |
|---|
| >4a17_W RPL31, 60S ribosomal protein L31; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_W 4a1c_W 4a1e_W Length = 111 | Back alignment and structure |
|---|
| >1vq8_X 50S ribosomal protein L31E; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.29.1.1 PDB: 1vq4_X* 1vq5_X* 1vq6_X* 1vq7_X* 1s72_X* 1vq9_X* 1vqk_X* 1vql_X* 1vqm_X* 1vqn_X* 1vqo_X* 1vqp_X* 1yhq_X* 1yi2_X* 1yij_X* 1yit_X* 1yj9_X* 1yjn_X* 1yjw_X* 2otj_X* ... Length = 92 | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Length = 551 | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Length = 551 | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Length = 540 | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Length = 540 | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Length = 620 | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Length = 620 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 795 | |||
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 99.97 | |
| 3iz5_g | 123 | 60S ribosomal protein L31 (L31E); eukaryotic ribos | 99.96 | |
| 3u5e_d | 113 | L34, YL28, 60S ribosomal protein L31-A; translatio | 99.96 | |
| 2zkr_x | 125 | 60S ribosomal protein L31; protein-RNA complex, 60 | 99.96 | |
| 3j21_a | 95 | 50S ribosomal protein L31E; archaea, archaeal, KIN | 99.96 | |
| 4a17_W | 111 | RPL31, 60S ribosomal protein L31; eukaryotic ribos | 99.95 | |
| 1vq8_X | 92 | 50S ribosomal protein L31E; ribosome 50S, protein- | 99.95 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 99.91 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 99.88 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 99.24 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 99.02 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 98.95 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 98.39 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 98.36 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 98.31 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 98.28 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 98.26 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 98.25 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 98.24 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 98.22 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 98.21 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 98.2 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 98.19 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 98.15 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 98.15 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 98.15 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 98.1 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 98.08 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 98.07 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 98.03 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 98.0 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 97.97 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 97.97 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 97.96 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 97.91 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 97.88 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 97.87 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 97.85 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 97.82 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 97.81 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 97.81 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 97.8 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 97.78 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 97.77 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 97.76 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 97.76 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 97.72 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 97.71 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 97.7 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 97.7 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 97.7 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 97.69 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 97.68 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 97.64 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 97.61 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 97.59 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 97.57 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 97.56 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 97.56 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 97.55 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 97.53 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 97.53 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 97.52 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 97.5 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 97.49 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 97.47 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 97.45 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 97.45 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 97.44 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 97.44 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 97.41 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 97.38 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 97.37 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 97.31 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 97.29 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 97.28 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 97.27 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 97.26 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 97.26 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 97.25 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 97.25 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 97.23 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 97.22 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 97.22 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 97.2 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 97.19 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 97.17 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 97.13 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 97.11 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 97.1 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 97.09 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 97.08 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 97.08 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 97.07 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 97.06 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 97.02 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 97.0 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 96.98 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 96.97 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 96.96 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 96.96 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 96.94 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 96.9 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 96.9 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 96.88 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 96.83 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 96.83 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 96.82 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 96.82 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 96.82 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 96.81 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 96.8 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 96.78 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 96.73 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 96.73 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 96.68 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 96.66 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 96.62 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 96.55 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 96.55 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 96.54 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 96.48 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 96.4 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 96.4 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 96.4 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 96.37 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 96.32 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 96.3 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 96.25 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 96.24 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 96.12 | |
| 2ipc_A | 997 | Preprotein translocase SECA subunit; nucleotide bi | 96.08 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 96.08 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 96.03 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 96.03 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 95.83 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 95.79 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 95.79 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 95.75 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 95.75 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 95.7 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 95.7 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 95.54 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 95.41 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 95.07 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 94.91 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 94.68 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 94.47 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 94.43 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 93.72 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 93.57 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 93.53 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 93.08 | |
| 2ipc_A | 997 | Preprotein translocase SECA subunit; nucleotide bi | 92.66 | |
| 3jux_A | 822 | Protein translocase subunit SECA; protein transloc | 92.52 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 91.93 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 91.61 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 91.22 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 91.16 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 90.77 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 90.67 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 90.64 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 90.32 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 90.21 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 89.32 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 88.92 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 88.4 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 88.38 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 88.28 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 87.93 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 87.52 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 87.42 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 87.35 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 87.34 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 87.13 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 86.96 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 86.55 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 86.32 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 86.21 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 86.13 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 86.06 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 85.88 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 85.6 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 85.42 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 85.39 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 85.29 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 85.0 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 84.45 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 83.5 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 82.73 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 82.11 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 81.93 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 81.8 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 81.5 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 81.48 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 81.23 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 80.89 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 80.87 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 80.71 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 80.08 |
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
Probab=99.97 E-value=7.6e-32 Score=308.55 Aligned_cols=101 Identities=19% Similarity=0.138 Sum_probs=82.0
Q ss_pred eEeecCc---------cccceEEEEecCCCCCCCccccccc-----ccCCcccc-hHHHHHHHHHhccCccccccCceeE
Q psy3462 580 KQVMGKG---------NLELCKGVFWTRFPNTCQYSVVYPT-----GLLKGGDW-YQIQAYRALNQALGRCIRHRYDWGA 644 (795)
Q Consensus 580 fAV~GGK---------nl~rcViVVGIPYPn~~d~~Lk~~~-----~~~~G~ew-Y~~~AmRaVNQAIGRvIRHknDyGa 644 (795)
|||+||+ +.++||||+|||||++ |+.++... ...+|+.| |..+||++|+||+||+|||++|||+
T Consensus 499 ~~v~~gsf~EGiD~~g~~l~~viI~~lPfp~~-~p~~~ar~~~~~~~~g~~~~~~y~~pa~~~l~Qa~GRlIR~~~D~G~ 577 (620)
T 4a15_A 499 FAVSGGRLSEGINFPGNELEMIILAGLPFPRP-DAINRSLFDYYERKYGKGWEYSVVYPTAIKIRQEIGRLIRSAEDTGA 577 (620)
T ss_dssp EEETTSCC--------CCCCEEEESSCCCCCC-CHHHHHHHHHHHHHHSCHHHHHTHHHHHHHHHHHHHTTCCSTTCCEE
T ss_pred EEEecCceeccccCCCCceEEEEEEcCCCCCC-CHHHHHHHHHHHHhhCCCchHHhHHHHHHHHHHHhCccccCCCceEE
Confidence 8999996 6899999999999999 68776321 12233444 8899999999999999999999999
Q ss_pred EEEeecccCChhhhhhHhHHHHhhccccCChhHHHHHHHHHHHHHHH
Q psy3462 645 ILLVDQRFYSKNSQQGLSKWVRNQVQNTSSHNTFMENLRNFVRRRME 691 (795)
Q Consensus 645 IiLlD~Rf~~~~~~~~LP~WIr~~l~~~~sfe~~~~~l~~Ffk~~k~ 691 (795)
|+|+|+|| +++++.||. ++.... ..+.+.+||...+.
T Consensus 578 v~llD~R~--~~~~~~LP~-~~~~~~-------~~~~~~~f~~~~~~ 614 (620)
T 4a15_A 578 CVILDKRA--GQFRKFIPD-MKKTSD-------PASDIYNFFISAQA 614 (620)
T ss_dssp EEEECGGG--GGGGGGSTT-CEEESC-------HHHHHHHHHHHHHT
T ss_pred EEEEccch--HHHHHhCCc-hhhhcC-------cHHHHHHHHhChhh
Confidence 99999999 889999999 655433 34678899987743
|
| >3u5e_d L34, YL28, 60S ribosomal protein L31-A; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 2wwa_M 2ww9_M 3izc_g 3izs_g 2wwb_M 3o5h_a 3o58_a 3u5i_d 4b6a_d 1s1i_W 3jyw_W | Back alignment and structure |
|---|
| >2zkr_x 60S ribosomal protein L31; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} | Back alignment and structure |
|---|
| >3j21_a 50S ribosomal protein L31E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >4a17_W RPL31, 60S ribosomal protein L31; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_W 4a1c_W 4a1e_W | Back alignment and structure |
|---|
| >1vq8_X 50S ribosomal protein L31E; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.29.1.1 PDB: 1vq4_X* 1vq5_X* 1vq6_X* 1vq7_X* 1s72_X* 1vq9_X* 1vqk_X* 1vql_X* 1vqm_X* 1vqn_X* 1vqo_X* 1vqp_X* 1yhq_X* 1yi2_X* 1yij_X* 1yit_X* 1yj9_X* 1yjn_X* 1yjw_X* 2otj_X* ... | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 795 | ||||
| d1vqox1 | 82 | d.29.1.1 (X:7-88) Ribosomal protein L31e {Archaeon | 2e-22 |
| >d1vqox1 d.29.1.1 (X:7-88) Ribosomal protein L31e {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 82 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ribosomal protein L31e superfamily: Ribosomal protein L31e family: Ribosomal protein L31e domain: Ribosomal protein L31e species: Archaeon Haloarcula marismortui [TaxId: 2238]
Score = 89.7 bits (223), Expect = 2e-22
Identities = 16/59 (27%), Positives = 30/59 (50%), Gaps = 3/59 (5%)
Query: 126 RDYTIHMHKRLHKVGFKKRAPRAIKVVRAFVKKQMGTED--VRIDTRLNKHIWSKGINN 182
R TI + + KRA +A+ ++R + K ++ VR+D +N+ W++G N
Sbjct: 2 RVVTIPL-RDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRAN 59
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 795 | |||
| d1vqox1 | 82 | Ribosomal protein L31e {Archaeon Haloarcula marism | 99.91 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 98.56 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 98.53 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 98.5 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 98.44 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 98.43 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 98.35 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 98.31 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 98.29 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 98.14 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 98.07 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 98.05 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 98.02 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 98.0 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 97.93 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 97.89 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 97.87 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 97.73 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 97.73 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 97.69 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 97.67 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 97.65 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 97.56 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 97.54 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 97.54 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 97.29 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 97.01 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 96.99 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 96.99 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 96.9 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 96.73 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 96.6 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 96.48 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 96.39 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 96.38 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 95.78 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 95.61 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 95.6 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 95.18 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 93.17 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 91.73 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 91.52 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 91.03 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 90.72 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 90.72 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 90.01 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 89.55 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 88.81 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 88.58 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 88.51 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 87.54 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 86.3 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 86.16 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 85.81 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 85.56 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 85.41 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 85.2 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 84.58 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 84.55 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 84.24 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 83.59 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 83.16 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 83.07 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 82.98 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 82.7 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 82.67 | |
| d1z63a1 | 230 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 81.98 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 81.91 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 81.29 |
| >d1vqox1 d.29.1.1 (X:7-88) Ribosomal protein L31e {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ribosomal protein L31e superfamily: Ribosomal protein L31e family: Ribosomal protein L31e domain: Ribosomal protein L31e species: Archaeon Haloarcula marismortui [TaxId: 2238]
Probab=99.91 E-value=1.6e-25 Score=194.30 Aligned_cols=69 Identities=23% Similarity=0.374 Sum_probs=66.1
Q ss_pred eeEEEEecCccccccCCCCcchHHHHHHHHHHHhhhCCCC--eEeCccchHHHHhcCCCCCCCceEEEeccc
Q psy3462 125 TRDYTIHMHKRLHKVGFKKRAPRAIKVVRAFVKKQMGTED--VRIDTRLNKHIWSKGINNHTLGTAYFDSAA 194 (795)
Q Consensus 125 treyTInL~K~v~g~~fkkRAprAik~IrkFa~K~mkt~d--VrID~~LNk~IWsrGirnpP~rirV~~s~~ 194 (795)
+|+|||||++ +++++++||||+||++||+||+|||||+| |+|||+||++||++|++|||++|+|+++..
T Consensus 1 Er~yTI~Lr~-~~~~~~~kRA~rAik~Ir~f~~khmkt~d~~V~ID~~lN~~IWsrGi~~pP~rIRVr~~r~ 71 (82)
T d1vqox1 1 ERVVTIPLRD-ARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARF 71 (82)
T ss_dssp CEEEEEECGG-GGGSCGGGHHHHHHHHHHHHHHHHTTCCGGGEEECHHHHHHHTTTCTTCCCSEEEEEEEEE
T ss_pred CeEEEEEcHH-hhCCCcccccHHHHHHHHHHHHHHhCCCCCeEEECcHHHHHHHhccCcCCCCeEEEEEEEe
Confidence 5899999988 89999999999999999999999999997 999999999999999999999999998764
|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|