Psyllid ID: psy3469


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MILGQYGPAVCLVAASYTGCDPYLTVGILTIGLGFNGAVYSGFKVNHLDISPRFAGILMSFTNCLANLAGLLAPIIAGYVIQGKPTQAAWRVVFVAAAVVYLFSSTFYIFAASGDRQPWDNPNNDAPTPRAATKRDASNNNRTSYASDVEDTVQ
cEEEcHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHccccccccccccccccccc
ccHHHHHHHHHHHHHHHcccccEEEEEEEEEEEHccHHHHccccEccccccccHHHHHHHHHHHHHcHHHcHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHcc
milgqygpAVCLVAAsytgcdpyltVGILTIglgfngavysgfkvnhldisprFAGILMSFTNCLANLAGLLAPIIagyviqgkptQAAWRVVFVAAAVVYLFSSTFYIFaasgdrqpwdnpnndaptpraatkrdasnnnrtsyasdvedtvq
MILGQYGPAVCLVAASYTGCDPYLTVGILTIGLGFNGAVYSGFKVNHLDISPRFAGILMSFTNCLANLAGLLAPIIAGYVIQGKPTQAAWRVVFVAAAVVYLFSSTFYIFAAsgdrqpwdnpnnDAPTpraatkrdasnnnrtsyasdvedtvq
MILGQYGPAVCLVAASYTGCDPYLTVGILTIGLGFNGAVYSGFKVNHLDISPRFAGILMSFTNCLANLAGLLAPIIAGYVIQGKPTQaawrvvfvaaavvYLFSSTFYIFAASGDRQPWDNPNNDAPTPRAATKRDASNNNRTSYASDVEDTVQ
**LGQYGPAVCLVAASYTGCDPYLTVGILTIGLGFNGAVYSGFKVNHLDISPRFAGILMSFTNCLANLAGLLAPIIAGYVIQGKPTQAAWRVVFVAAAVVYLFSSTFYIFAA******************************************
MILGQYGPAVCLVAASYTGCDPYLTVGILTIGLGFNGAVYSGFKVNHLDISPRFAGILMSFTNCLANLAGLLAPIIAGYVIQGKPTQAAWRVVFVAAAVVYLFSSTFYIFAASGDRQPWD**********************************
MILGQYGPAVCLVAASYTGCDPYLTVGILTIGLGFNGAVYSGFKVNHLDISPRFAGILMSFTNCLANLAGLLAPIIAGYVIQGKPTQAAWRVVFVAAAVVYLFSSTFYIFAASGDRQPWDNPNNDA****************************
MILGQYGPAVCLVAASYTGCDPYLTVGILTIGLGFNGAVYSGFKVNHLDISPRFAGILMSFTNCLANLAGLLAPIIAGYVIQGKPTQAAWRVVFVAAAVVYLFSSTFYIFAASGDR**************************************
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILGQYGPAVCLVAASYTGCDPYLTVGILTIGLGFNGAVYSGFKVNHLDISPRFAGILMSFTNCLANLAGLLAPIIAGYVIQGKPTQAAWRVVFVAAAVVYLFSSTFYIFAASGDRQPWDNPNNDAPTPRAATKRDASNNNRTSYASDVEDTVQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query154 2.2.26 [Sep-21-2011]
Q9V7S5529 Putative inorganic phosph yes N/A 0.850 0.247 0.609 3e-42
O61369483 Putative inorganic phosph N/A N/A 0.941 0.300 0.567 3e-41
Q9MZD1495 Sialin OS=Ovis aries GN=S N/A N/A 0.759 0.236 0.423 8e-20
Q9NRA2495 Sialin OS=Homo sapiens GN yes N/A 0.759 0.236 0.423 1e-19
Q8BN82495 Sialin OS=Mus musculus GN yes N/A 0.759 0.236 0.432 2e-19
Q9JI12582 Vesicular glutamate trans no N/A 0.636 0.168 0.424 3e-19
Q9P2U8582 Vesicular glutamate trans no N/A 0.636 0.168 0.424 4e-19
A6QLI1582 Vesicular glutamate trans no N/A 0.636 0.168 0.424 4e-19
Q8BLE7582 Vesicular glutamate trans no N/A 0.636 0.168 0.414 1e-18
Q6INC8576 Vesicular glutamate trans N/A N/A 0.636 0.170 0.414 3e-18
>sp|Q9V7S5|PICO_DROME Putative inorganic phosphate cotransporter OS=Drosophila melanogaster GN=Picot PE=1 SV=1 Back     alignment and function desciption
 Score =  170 bits (431), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 81/133 (60%), Positives = 96/133 (72%), Gaps = 2/133 (1%)

Query: 3   LGQYGPAVCLVAASYTGCDPYLTVGILTIGLGFNGAVYSGFKVNHLDISPRFAGILMSFT 62
           +GQYGP V L+AASYTGCD  LT+ ILTIG+G NG +YSGFK+NHLD++PRFAG LMS T
Sbjct: 375 IGQYGPGVALIAASYTGCDRALTLAILTIGVGLNGGIYSGFKINHLDLTPRFAGFLMSIT 434

Query: 63  NCLANLAGLLAPIIAGYVIQ--GKPTQAAWRVVFVAAAVVYLFSSTFYIFAASGDRQPWD 120
           NC ANLAGLLAPI AG++I    KP    W++VF  AA VY+   TFY    SG+RQ WD
Sbjct: 435 NCSANLAGLLAPIAAGHLISDPSKPMMGQWQIVFFIAAFVYIICGTFYNIFGSGERQYWD 494

Query: 121 NPNNDAPTPRAAT 133
           NP +D   P   T
Sbjct: 495 NPEDDEQKPALQT 507




May be an inorganic phosphate cotransporter.
Drosophila melanogaster (taxid: 7227)
>sp|O61369|PICO_DROAN Putative inorganic phosphate cotransporter OS=Drosophila ananassae GN=Picot PE=3 SV=1 Back     alignment and function description
>sp|Q9MZD1|S17A5_SHEEP Sialin OS=Ovis aries GN=SLC17A5 PE=2 SV=1 Back     alignment and function description
>sp|Q9NRA2|S17A5_HUMAN Sialin OS=Homo sapiens GN=SLC17A5 PE=1 SV=2 Back     alignment and function description
>sp|Q8BN82|S17A5_MOUSE Sialin OS=Mus musculus GN=Slc17a5 PE=2 SV=2 Back     alignment and function description
>sp|Q9JI12|VGLU2_RAT Vesicular glutamate transporter 2 OS=Rattus norvegicus GN=Slc17a6 PE=1 SV=1 Back     alignment and function description
>sp|Q9P2U8|VGLU2_HUMAN Vesicular glutamate transporter 2 OS=Homo sapiens GN=SLC17A6 PE=1 SV=1 Back     alignment and function description
>sp|A6QLI1|VGLU2_BOVIN Vesicular glutamate transporter 2 OS=Bos taurus GN=SLC17A6 PE=2 SV=1 Back     alignment and function description
>sp|Q8BLE7|VGLU2_MOUSE Vesicular glutamate transporter 2 OS=Mus musculus GN=Slc17a6 PE=1 SV=1 Back     alignment and function description
>sp|Q6INC8|VGLU1_XENLA Vesicular glutamate transporter 1 OS=Xenopus laevis GN=slc17a7 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
328709271 617 PREDICTED: putative inorganic phosphate 0.954 0.238 0.664 5e-53
328709269 632 PREDICTED: putative inorganic phosphate 0.954 0.232 0.664 6e-53
193709300 553 PREDICTED: putative inorganic phosphate 0.941 0.262 0.664 4e-51
345489012 537 PREDICTED: putative inorganic phosphate 0.948 0.271 0.611 5e-50
157114768 530 inorganic phosphate cotransporter, putat 0.935 0.271 0.625 3e-48
170038579 522 inorganic phosphate cotransporter [Culex 0.857 0.252 0.666 4e-47
48097362 517 PREDICTED: putative inorganic phosphate 0.863 0.257 0.671 4e-47
312378402 569 hypothetical protein AND_10069 [Anophele 0.811 0.219 0.688 4e-47
307212339 474 Putative inorganic phosphate cotransport 0.928 0.301 0.622 2e-46
118792381 530 AGAP012251-PA [Anopheles gambiae str. PE 0.922 0.267 0.620 2e-46
>gi|328709271|ref|XP_001951876.2| PREDICTED: putative inorganic phosphate cotransporter-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  212 bits (539), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 118/152 (77%), Gaps = 5/152 (3%)

Query: 3   LGQYGPAVCLVAASYTGCDPYLTVGILTIGLGFNGAVYSGFKVNHLDISPRFAGILMSFT 62
           +GQ+GPA+ L+AASYTGCDPYLTV ILT+G+G NGA+YSGFKVNHLDISPRFAGILMS T
Sbjct: 471 IGQFGPAIALIAASYTGCDPYLTVAILTVGVGLNGAIYSGFKVNHLDISPRFAGILMSLT 530

Query: 63  NCLANLAGLLAPIIAGYVIQGKPTQAAWRVVFVAAAVVYLFSSTFYIFAASGDRQPWDNP 122
           NCLANLAGLLAPI+AGYVI  +PTQAAWRVVF+ +AVVY+   T Y+   +G RQPWDNP
Sbjct: 531 NCLANLAGLLAPIVAGYVIDKRPTQAAWRVVFITSAVVYMVCCTIYLVFGNGTRQPWDNP 590

Query: 123 NNDAPTPRAATKRDASNNNRTSYASDVEDTVQ 154
           +ND             N  +   A D+EDTVQ
Sbjct: 591 SND-----QMNLEHKKNKKKNKMAMDIEDTVQ 617




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328709269|ref|XP_003243916.1| PREDICTED: putative inorganic phosphate cotransporter-like isoform 2 [Acyrthosiphon pisum] gi|328709273|ref|XP_003243917.1| PREDICTED: putative inorganic phosphate cotransporter-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|193709300|ref|XP_001950194.1| PREDICTED: putative inorganic phosphate cotransporter [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|345489012|ref|XP_001602874.2| PREDICTED: putative inorganic phosphate cotransporter [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|157114768|ref|XP_001652412.1| inorganic phosphate cotransporter, putative [Aedes aegypti] gi|108883565|gb|EAT47790.1| AAEL001113-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170038579|ref|XP_001847126.1| inorganic phosphate cotransporter [Culex quinquefasciatus] gi|167882325|gb|EDS45708.1| inorganic phosphate cotransporter [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|48097362|ref|XP_393759.1| PREDICTED: putative inorganic phosphate cotransporter [Apis mellifera] Back     alignment and taxonomy information
>gi|312378402|gb|EFR24986.1| hypothetical protein AND_10069 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|307212339|gb|EFN88143.1| Putative inorganic phosphate cotransporter [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|118792381|ref|XP_320291.3| AGAP012251-PA [Anopheles gambiae str. PEST] gi|116116873|gb|EAA00281.4| AGAP012251-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
FB|FBgn0024315529 Picot "Picot" [Drosophila mela 0.850 0.247 0.563 2.7e-36
UNIPROTKB|O61369483 Picot "Putative inorganic phos 0.935 0.298 0.530 7.2e-36
FB|FBgn0029727479 CG6978 [Drosophila melanogaste 0.753 0.242 0.487 5.3e-27
FB|FBgn0031307512 MFS3 "Major Facilitator Superf 0.798 0.240 0.358 5.1e-18
FB|FBgn0034394491 CG15096 [Drosophila melanogast 0.779 0.244 0.363 7.6e-18
ZFIN|ZDB-GENE-060929-1158489 slc17a5 "solute carrier family 0.759 0.239 0.389 1.2e-17
FB|FBgn0034392497 MFS15 "Major Facilitator Super 0.909 0.281 0.312 7.5e-17
RGD|1311388495 Slc17a5 "solute carrier family 0.759 0.236 0.389 1.2e-16
UNIPROTKB|Q9NRA2495 SLC17A5 "Sialin" [Homo sapiens 0.759 0.236 0.381 1.6e-16
UNIPROTKB|Q5ZL94484 SLC17A5 "Uncharacterized prote 0.759 0.241 0.372 1.9e-16
FB|FBgn0024315 Picot "Picot" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 391 (142.7 bits), Expect = 2.7e-36, P = 2.7e-36
 Identities = 75/133 (56%), Positives = 88/133 (66%)

Query:     3 LGQYGPAVCLVAASYTGCDPYLTVGILTIGLGFNGAVYSGFKVNHLDISPRFAGILMSFT 62
             +GQYGP V L+AASYTGCD  LT+ ILTIG+G NG +YSGFK+NHLD++PRFAG LMS T
Sbjct:   375 IGQYGPGVALIAASYTGCDRALTLAILTIGVGLNGGIYSGFKINHLDLTPRFAGFLMSIT 434

Query:    63 NCLANLAGLLAPIIAGYVIQ--GKPTQXXXXXXXXXXXXXYLFSSTFYIFAASGDRQPWD 120
             NC ANLAGLLAPI AG++I    KP               Y+   TFY    SG+RQ WD
Sbjct:   435 NCSANLAGLLAPIAAGHLISDPSKPMMGQWQIVFFIAAFVYIICGTFYNIFGSGERQYWD 494

Query:   121 NPNNDAPTPRAAT 133
             NP +D   P   T
Sbjct:   495 NPEDDEQKPALQT 507




GO:0005316 "high affinity inorganic phosphate:sodium symporter activity" evidence=NAS
GO:0006817 "phosphate ion transport" evidence=NAS
GO:0016021 "integral to membrane" evidence=IEA;NAS
GO:0015114 "phosphate ion transmembrane transporter activity" evidence=IEA
GO:0035435 "phosphate ion transmembrane transport" evidence=IEA
UNIPROTKB|O61369 Picot "Putative inorganic phosphate cotransporter" [Drosophila ananassae (taxid:7217)] Back     alignment and assigned GO terms
FB|FBgn0029727 CG6978 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0031307 MFS3 "Major Facilitator Superfamily Transporter 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0034394 CG15096 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060929-1158 slc17a5 "solute carrier family 17 (anion/sugar transporter), member 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0034392 MFS15 "Major Facilitator Superfamily Transporter 15" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|1311388 Slc17a5 "solute carrier family 17 (anion/sugar transporter), member 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NRA2 SLC17A5 "Sialin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZL94 SLC17A5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9V7S5PICO_DROMENo assigned EC number0.60900.85060.2476yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
TIGR00894465 TIGR00894, 2A0114euk, Na(+)-dependent inorganic ph 2e-29
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 1e-04
TIGR00893399 TIGR00893, 2A0114, D-galactonate transporter 0.002
>gnl|CDD|129972 TIGR00894, 2A0114euk, Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
 Score =  110 bits (278), Expect = 2e-29
 Identities = 38/123 (30%), Positives = 59/123 (47%), Gaps = 1/123 (0%)

Query: 3   LGQYGPAVCLVAASYTGCDPYLTVGILTIGLGFNGAVYSGFKVNHLDISPRFAGILMSFT 62
           +G  GP +   A  Y     YLT+ ILT+    +    +G  +N LD++PRF G +   T
Sbjct: 342 IGGLGPGIFAYALPYLSAAFYLTIIILTLANAVSSGPLAGVLINSLDLAPRFLGFIKGIT 401

Query: 63  NCLANLAGLLAPIIAGYVIQGKPTQAAWRVVFVAAAVVYLFSSTFYIFAASGDRQPWDNP 122
                + GL+A  +AG  I  + ++  W +VF+  A V +    FY+   S +RQ W   
Sbjct: 402 GLPGFIGGLIASTLAG-NILSQDSKNVWLIVFLIMAFVNILCVIFYLIFGSAERQDWAKE 460

Query: 123 NND 125
             D
Sbjct: 461 EKD 463


[Transport and binding proteins, Anions]. Length = 465

>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|233174 TIGR00893, 2A0114, D-galactonate transporter Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 154
KOG2532|consensus466 99.66
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 99.38
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.3
TIGR00893 399 2A0114 d-galactonate transporter. 98.96
PRK11663 434 regulatory protein UhpC; Provisional 98.93
TIGR00892455 2A0113 monocarboxylate transporter 1. 98.9
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 98.82
TIGR00880141 2_A_01_02 Multidrug resistance protein. 98.8
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 98.79
PLN00028476 nitrate transmembrane transporter; Provisional 98.73
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 98.72
TIGR00895 398 2A0115 benzoate transport. 98.71
TIGR00900 365 2A0121 H+ Antiporter protein. 98.7
PRK10054 395 putative transporter; Provisional 98.7
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 98.7
PRK10489417 enterobactin exporter EntS; Provisional 98.7
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 98.69
PRK14995 495 methyl viologen resistance protein SmvA; Provision 98.68
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 98.67
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 98.67
PRK10473 392 multidrug efflux system protein MdtL; Provisional 98.66
PRK10213 394 nepI ribonucleoside transporter; Reviewed 98.65
PRK05122399 major facilitator superfamily transporter; Provisi 98.64
PRK03545 390 putative arabinose transporter; Provisional 98.62
PRK11646 400 multidrug resistance protein MdtH; Provisional 98.6
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 98.6
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 98.58
PRK12382392 putative transporter; Provisional 98.57
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 98.55
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 98.55
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 98.54
KOG2532|consensus 466 98.54
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 98.54
PRK03699 394 putative transporter; Provisional 98.53
TIGR00892 455 2A0113 monocarboxylate transporter 1. 98.51
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 98.51
PRK09874408 drug efflux system protein MdtG; Provisional 98.5
TIGR00891 405 2A0112 putative sialic acid transporter. 98.49
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 98.48
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 98.48
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 98.47
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 98.47
PRK10091 382 MFS transport protein AraJ; Provisional 98.47
KOG2504|consensus509 98.47
PRK15403 413 multidrug efflux system protein MdtM; Provisional 98.46
PRK10504 471 putative transporter; Provisional 98.45
PRK15462 493 dipeptide/tripeptide permease D; Provisional 98.44
PRK11010491 ampG muropeptide transporter; Validated 98.44
PRK10642490 proline/glycine betaine transporter; Provisional 98.43
TIGR00901 356 2A0125 AmpG-related permease. 98.43
PRK03893496 putative sialic acid transporter; Provisional 98.43
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 98.42
TIGR00889418 2A0110 nucleoside transporter. This family of prot 98.41
PRK15011393 sugar efflux transporter B; Provisional 98.41
PRK09874 408 drug efflux system protein MdtG; Provisional 98.41
PRK09705 393 cynX putative cyanate transporter; Provisional 98.41
PRK11652 394 emrD multidrug resistance protein D; Provisional 98.38
PRK11663434 regulatory protein UhpC; Provisional 98.37
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 98.37
KOG4686|consensus459 98.36
TIGR00893399 2A0114 d-galactonate transporter. 98.36
TIGR00898505 2A0119 cation transport protein. 98.36
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 98.35
PF05977524 MFS_3: Transmembrane secretion effector; InterPro: 98.35
PRK09528420 lacY galactoside permease; Reviewed 98.35
KOG1330|consensus 493 98.34
PRK11043 401 putative transporter; Provisional 98.33
PRK12307 426 putative sialic acid transporter; Provisional 98.33
PRK11902 402 ampG muropeptide transporter; Reviewed 98.31
PRK10207 489 dipeptide/tripeptide permease B; Provisional 98.31
PRK15011 393 sugar efflux transporter B; Provisional 98.3
PRK09584 500 tppB putative tripeptide transporter permease; Rev 98.29
PTZ00207 591 hypothetical protein; Provisional 98.29
PRK09952438 shikimate transporter; Provisional 98.29
PRK10054395 putative transporter; Provisional 98.29
PRK03545390 putative arabinose transporter; Provisional 98.28
PRK11010 491 ampG muropeptide transporter; Validated 98.28
PRK03893 496 putative sialic acid transporter; Provisional 98.28
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 98.27
TIGR00898 505 2A0119 cation transport protein. 98.26
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 98.25
TIGR00897402 2A0118 polyol permease family. This family of prot 98.25
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 98.25
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 98.24
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 98.24
PRK11646400 multidrug resistance protein MdtH; Provisional 98.24
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 98.23
PRK10489 417 enterobactin exporter EntS; Provisional 98.23
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 98.23
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 98.2
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 98.19
KOG2533|consensus 495 98.19
KOG3764|consensus 464 98.19
PLN00028 476 nitrate transmembrane transporter; Provisional 98.18
TIGR00896 355 CynX cyanate transporter. This family of proteins 98.18
PRK09705393 cynX putative cyanate transporter; Provisional 98.17
PRK10642 490 proline/glycine betaine transporter; Provisional 98.16
PRK03699394 putative transporter; Provisional 98.14
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 98.14
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 98.11
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 98.1
PRK10406 432 alpha-ketoglutarate transporter; Provisional 98.07
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 98.07
KOG0255|consensus 521 98.06
PRK10077479 xylE D-xylose transporter XylE; Provisional 98.05
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 98.04
PRK10077 479 xylE D-xylose transporter XylE; Provisional 98.03
PRK11195 393 lysophospholipid transporter LplT; Provisional 98.02
TIGR01272 310 gluP glucose/galactose transporter. Disruption of 98.0
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 97.96
TIGR00897 402 2A0118 polyol permease family. This family of prot 97.96
TIGR00805 633 oat sodium-independent organic anion transporter. 97.94
PRK09952 438 shikimate transporter; Provisional 97.94
PRK10091382 MFS transport protein AraJ; Provisional 97.94
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 97.92
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 97.89
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 97.89
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 97.88
PRK03633381 putative MFS family transporter protein; Provision 97.88
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 97.88
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 97.88
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 97.87
PRK15075 434 citrate-proton symporter; Provisional 97.86
KOG2504|consensus 509 97.85
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 97.85
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 97.82
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 97.82
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 97.8
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 97.78
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 97.78
PRK12307426 putative sialic acid transporter; Provisional 97.76
TIGR00902382 2A0127 phenyl proprionate permease family protein. 97.75
PF13347 428 MFS_2: MFS/sugar transport protein 97.73
PRK03633 381 putative MFS family transporter protein; Provision 97.73
PRK10406432 alpha-ketoglutarate transporter; Provisional 97.73
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 97.71
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 97.71
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 97.66
TIGR00891405 2A0112 putative sialic acid transporter. 97.62
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 97.6
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 97.59
PRK10504471 putative transporter; Provisional 97.59
KOG2615|consensus 451 97.59
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 97.57
PRK11902402 ampG muropeptide transporter; Reviewed 97.57
PRK11043401 putative transporter; Provisional 97.57
PRK10213394 nepI ribonucleoside transporter; Reviewed 97.56
KOG0253|consensus528 97.55
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 97.55
PRK15402406 multidrug efflux system translocase MdfA; Provisio 97.54
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 97.54
PRK12382 392 putative transporter; Provisional 97.53
TIGR01272310 gluP glucose/galactose transporter. Disruption of 97.52
PRK10133 438 L-fucose transporter; Provisional 97.52
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 97.51
TIGR00900365 2A0121 H+ Antiporter protein. 97.51
PRK09669 444 putative symporter YagG; Provisional 97.51
PRK05122 399 major facilitator superfamily transporter; Provisi 97.5
PRK09528 420 lacY galactoside permease; Reviewed 97.5
PRK11652394 emrD multidrug resistance protein D; Provisional 97.48
PRK11195393 lysophospholipid transporter LplT; Provisional 97.48
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 97.45
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 97.43
TIGR00895398 2A0115 benzoate transport. 97.42
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 97.4
PRK11462 460 putative transporter; Provisional 97.38
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 97.38
KOG0252|consensus538 97.34
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 97.33
TIGR00881379 2A0104 phosphoglycerate transporter family protein 97.28
PF00854 372 PTR2: POT family; InterPro: IPR000109 This entry r 97.25
PRK09848448 glucuronide transporter; Provisional 97.2
PRK15075434 citrate-proton symporter; Provisional 97.16
PRK10429473 melibiose:sodium symporter; Provisional 97.14
TIGR00788468 fbt folate/biopterin transporter. The only functio 97.11
KOG3762|consensus618 97.09
COG2807395 CynX Cyanate permease [Inorganic ion transport and 97.09
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 97.09
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 97.02
PRK10429 473 melibiose:sodium symporter; Provisional 97.0
PF03209 403 PUCC: PUCC protein; InterPro: IPR004896 This prote 96.99
PF06609599 TRI12: Fungal trichothecene efflux pump (TRI12); I 96.98
KOG0254|consensus 513 96.96
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 96.93
PRK10207489 dipeptide/tripeptide permease B; Provisional 96.93
PRK09584500 tppB putative tripeptide transporter permease; Rev 96.92
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 96.85
PRK10133438 L-fucose transporter; Provisional 96.81
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 96.8
KOG0569|consensus 485 96.77
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 96.74
COG2270438 Permeases of the major facilitator superfamily [Ge 96.68
COG2211 467 MelB Na+/melibiose symporter and related transport 96.63
PF11700 477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 96.6
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 96.55
PRK14995495 methyl viologen resistance protein SmvA; Provision 96.54
TIGR00788 468 fbt folate/biopterin transporter. The only functio 96.46
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 96.44
TIGR00896355 CynX cyanate transporter. This family of proteins 96.43
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 96.39
KOG0255|consensus521 96.37
KOG2816|consensus 463 96.36
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 96.36
KOG1330|consensus493 96.21
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 96.21
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 96.12
PRK09669444 putative symporter YagG; Provisional 96.08
PRK10473392 multidrug efflux system protein MdtL; Provisional 96.05
COG2807 395 CynX Cyanate permease [Inorganic ion transport and 96.02
COG2211467 MelB Na+/melibiose symporter and related transport 95.98
PTZ00207591 hypothetical protein; Provisional 95.96
TIGR00769 472 AAA ADP/ATP carrier protein family. These proteins 95.92
KOG2325|consensus 488 95.91
PF13347428 MFS_2: MFS/sugar transport protein 95.88
PRK15403413 multidrug efflux system protein MdtM; Provisional 95.86
KOG2615|consensus451 95.82
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 95.79
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 95.63
COG0738422 FucP Fucose permease [Carbohydrate transport and m 95.46
PF01770 412 Folate_carrier: Reduced folate carrier; InterPro: 95.12
TIGR00889 418 2A0110 nucleoside transporter. This family of prot 94.87
KOG3626|consensus 735 94.77
PF03219 491 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 94.65
PRK11462460 putative transporter; Provisional 94.64
KOG1479|consensus 406 94.04
KOG3764|consensus464 93.71
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 93.44
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 93.37
PRK15462493 dipeptide/tripeptide permease D; Provisional 93.29
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 92.71
PRK03612 521 spermidine synthase; Provisional 92.42
TIGR00806511 rfc RFC reduced folate carrier. Proteins of the RF 92.37
PF01306 412 LacY_symp: LacY proton/sugar symporter; InterPro: 92.24
PF03825 400 Nuc_H_symport: Nucleoside H+ symporter 91.87
TIGR00939 437 2a57 Equilibrative Nucleoside Transporter (ENT). 91.8
KOG3626|consensus735 91.76
KOG4112|consensus101 91.43
KOG0569|consensus485 91.09
PF02487 402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 91.04
COG0477 338 ProP Permeases of the major facilitator superfamil 90.38
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 90.36
PRK09848 448 glucuronide transporter; Provisional 90.28
TIGR00901356 2A0125 AmpG-related permease. 90.18
KOG2816|consensus463 89.36
PF0664576 SPC12: Microsomal signal peptidase 12 kDa subunit 89.17
KOG2533|consensus495 88.34
COG5336116 Uncharacterized protein conserved in bacteria [Fun 88.23
KOG0254|consensus513 87.75
PF06963 432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 86.08
KOG0252|consensus 538 84.69
COG3202 509 ATP/ADP translocase [Energy production and convers 82.68
PF01733 309 Nucleoside_tran: Nucleoside transporter; InterPro: 81.62
>KOG2532|consensus Back     alignment and domain information
Probab=99.66  E-value=1.4e-16  Score=132.96  Aligned_cols=124  Identities=35%  Similarity=0.688  Sum_probs=113.9

Q ss_pred             CcccchhHHHHHHHHhhcCC-ChhHHHHHHHHHHHHHHhhhhhhhhhhcccCcchHHHHHHHHHHHHHHHHhHhhhhhhh
Q psy3469           1 MILGQYGPAVCLVAASYTGC-DPYLTVGILTIGLGFNGAVYSGFKVNHLDISPRFAGILMSFTNCLANLAGLLAPIIAGY   79 (154)
Q Consensus         1 ~~ig~~~~ai~~~~~~~~~~-~~~~~~~~l~~~~~~~g~~~~~~~~~~~d~~p~~~g~~~g~~~~~~~lg~~i~P~i~G~   79 (154)
                      |++++.+.+++++.+++.++ +.+.++++++++.++.|+..++++.+.+|.+|++.+.+.|+.+++++++++++|.++|.
T Consensus       336 n~i~~~~~ai~l~~l~~~~~~~~~~a~~~l~~~~~~~g~~~~Gf~~~~~~~apq~a~~l~g~~~~~~~~~~~~~P~~vg~  415 (466)
T KOG2532|consen  336 NTIAFGGPAVFLLVLAFTSDEHRLLAVILLTIAIGLSGFNISGFYKNHQDIAPQHAGFVMGIINFVGALAGFIAPLLVGI  415 (466)
T ss_pred             HhHHHHHHHHHHHeeeecCCCcchHHHHHHHHHHHHcccchhhhHhhhhhccchHHHHHHHHHHHHHHHHHHHHHHheee
Confidence            57889999999999999986 34578999999999999999999999999999999999999999999999999999999


Q ss_pred             cccCcccccchHHHHHHHHHHHHHHHHHHHHhccCCccCCCCCCCC
Q psy3469          80 VIQGKPTQAAWRVVFVAAAVVYLFSSTFYIFAASGDRQPWDNPNND  125 (154)
Q Consensus        80 i~~~~~~~~~~~~~F~~~~~~~~i~~~~~~~~~~~~~q~w~~~~~~  125 (154)
                      ++. +++..+|+.+|++.+++.+++.++|.++++.++|+|++++++
T Consensus       416 ~~~-~~t~~eW~~VF~i~a~i~~~~~i~f~~f~s~e~~~w~~~~~~  460 (466)
T KOG2532|consen  416 IVT-DNTREEWRIVFLIAAGILIVGNIIFLFFGSGEPAPWTKSEEK  460 (466)
T ss_pred             EeC-CCCHHHHHHHHHHHHHHHHHhchheeEeecCcccCccCCccc
Confidence            996 335688999999999999999999999999999999997664



>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>KOG1479|consensus Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>KOG4112|consensus Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>PF06645 SPC12: Microsomal signal peptidase 12 kDa subunit (SPC12); InterPro: IPR009542 This family consists of several microsomal signal peptidase 12 kDa subunit proteins Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>COG5336 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>COG3202 ATP/ADP translocase [Energy production and conversion] Back     alignment and domain information
>PF01733 Nucleoside_tran: Nucleoside transporter; InterPro: IPR002259 Delayed-early response (DER) gene products include growth progression factors and several unknown products of novel cDNAs Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 5e-05
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Length = 451 Back     alignment and structure
 Score = 41.2 bits (97), Expect = 5e-05
 Identities = 18/104 (17%), Positives = 31/104 (29%), Gaps = 1/104 (0%)

Query: 7   GPAVCLVAASYTGCDPYLTVGILTIGLGFNGAVYSGFKVNHLDISPRFAGILMSFTNCLA 66
             A  +   +  G      + ++ IG    G V             + AG    FT    
Sbjct: 332 TIATIVYWMNPAGNPTVDMICMIVIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTGLFG 391

Query: 67  NLAG-LLAPIIAGYVIQGKPTQAAWRVVFVAAAVVYLFSSTFYI 109
            L G + A  I GY +        + V+   + +  +      I
Sbjct: 392 YLGGSVAASAIVGYTVDFFGWDGGFMVMIGGSILAVILLIVVMI 435


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 99.02
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 98.98
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 98.93
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 98.71
2cfq_A417 Lactose permease; transport, transport mechanism, 98.62
2xut_A 524 Proton/peptide symporter family protein; transport 98.58
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 98.58
2xut_A524 Proton/peptide symporter family protein; transport 98.42
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 98.38
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 98.22
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 98.05
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 97.31
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 97.27
2cfq_A 417 Lactose permease; transport, transport mechanism, 95.21
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
Probab=99.02  E-value=1.6e-09  Score=86.47  Aligned_cols=109  Identities=16%  Similarity=0.184  Sum_probs=83.3

Q ss_pred             cchhHHHHHHHHhh----cCCChhHHHHHHHHHHHHHHhhhhhhhhhhcccCc-chHHHHHHHHHHHHHHHHhHhhhhhh
Q psy3469           4 GQYGPAVCLVAASY----TGCDPYLTVGILTIGLGFNGAVYSGFKVNHLDISP-RFAGILMSFTNCLANLAGLLAPIIAG   78 (154)
Q Consensus         4 g~~~~ai~~~~~~~----~~~~~~~~~~~l~~~~~~~g~~~~~~~~~~~d~~p-~~~g~~~g~~~~~~~lg~~i~P~i~G   78 (154)
                      +.++.+++.++..+    .+ +.+..++...+...+.+...+...+.+.|..| ++|+.+.|+.+....+|.+++|.+.|
T Consensus        98 ~~~~~~~~~~~~~~~~~~~~-~~~~l~~~~~l~G~~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~~g~~~~~  176 (451)
T 1pw4_A           98 GLILAAAVMLFMGFVPWATS-SIAVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFL  176 (451)
T ss_dssp             HHHHHHHHHHHHHHCHHHHS-SSSHHHHHHHHHHHHHHHTHHHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHHHH
T ss_pred             HHHHHHHHHHHHHhhhhccc-cHHHHHHHHHHHHHHhhhccchHHHHHHHHCCchhhhHHHHHHHHHHHHHHHHHHHHHH
Confidence            45555666666666    54 55555555555555566667778889999887 77999999999999999999999999


Q ss_pred             hcccCcccccc-hHHHHHHHHHHHHHHHHHHHHhccCCcc
Q psy3469          79 YVIQGKPTQAA-WRVVFVAAAVVYLFSSTFYIFAASGDRQ  117 (154)
Q Consensus        79 ~i~~~~~~~~~-~~~~F~~~~~~~~i~~~~~~~~~~~~~q  117 (154)
                      ++.+.    .+ |++.|++.+.+.++..++..++.+++++
T Consensus       177 ~l~~~----~g~w~~~f~~~~~~~~~~~~~~~~~~~~~~~  212 (451)
T 1pw4_A          177 LGMAW----FNDWHAALYMPAFCAILVALFAFAMMRDTPQ  212 (451)
T ss_dssp             HHHHH----TCCSTTCTHHHHHHHHHHHHHHHHHCCCSST
T ss_pred             HHHHH----hccHHHHHHHHHHHHHHHHHHHHhhccCCHh
Confidence            98873    56 9999999998888877776666665544



>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 154
d1pw4a_447 f.38.1.1 (A:) Glycerol-3-phosphate transporter {Es 8e-05
d1pv7a_417 f.38.1.2 (A:) Lactose permease {Escherichia coli [ 0.003
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Length = 447 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
 Score = 39.3 bits (90), Expect = 8e-05
 Identities = 20/118 (16%), Positives = 35/118 (29%), Gaps = 5/118 (4%)

Query: 1   MILGQYGPAVCLVAASYTGCDPYLTVGILTIGLGFNGAVYSGFKVNHLDISPRFAGILMS 60
             +     A  +   +  G      + ++ IG    G V             + AG    
Sbjct: 323 FFMTLVTIATIVYWMNPAGNPTVDMICMIVIGFLIYGPVMLIGLHALELAPKKAAGTAAG 382

Query: 61  FTNCLANLAG-LLAPIIAGYVIQGKPTQAAWRVVFVAAAVVYLFSSTFYIFAASGDRQ 117
           FT     L G + A  I GY +        W   F+      + +    I    G+++
Sbjct: 383 FTGLFGYLGGSVAASAIVGYTVDF----FGWDGGFMVMIGGSILAVILLIVVMIGEKR 436


>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Length = 417 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 98.94
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 98.83
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 98.58
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 96.05
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=98.94  E-value=2.2e-09  Score=83.16  Aligned_cols=120  Identities=14%  Similarity=0.162  Sum_probs=86.0

Q ss_pred             cchhHHHHHHHHhhcC---CChhHHHHHHHHHHHHHHhhhhhhhhhhcccCc-chHHHHHHHHHHHHHHHHhHhhhhhhh
Q psy3469           4 GQYGPAVCLVAASYTG---CDPYLTVGILTIGLGFNGAVYSGFKVNHLDISP-RFAGILMSFTNCLANLAGLLAPIIAGY   79 (154)
Q Consensus         4 g~~~~ai~~~~~~~~~---~~~~~~~~~l~~~~~~~g~~~~~~~~~~~d~~p-~~~g~~~g~~~~~~~lg~~i~P~i~G~   79 (154)
                      ++++.+++.++.++..   .+.+..++...+...+.+...+.....+.|..| ++|+.+.|+.+....+|..++|.+.+.
T Consensus        95 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~i~~~~~~~  174 (447)
T d1pw4a_          95 GLILAAAVMLFMGFVPWATSSIAVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLL  174 (447)
T ss_dssp             HHHHHHHHHHHHHHCHHHHSSSSHHHHHHHHHHHHHHHTHHHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHHHHH
T ss_pred             HHHHHHHHHhhccccchhhhhHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHhhcccccccccccccchhhhhhhhhhhh
Confidence            4445555555554432   133334444444444556666777788999876 779999999999999999999999998


Q ss_pred             cccCcccccchHHHHHHHHHHHHHHHHHHHHhccCCccCCCCCCCCC
Q psy3469          80 VIQGKPTQAAWRVVFVAAAVVYLFSSTFYIFAASGDRQPWDNPNNDA  126 (154)
Q Consensus        80 i~~~~~~~~~~~~~F~~~~~~~~i~~~~~~~~~~~~~q~w~~~~~~~  126 (154)
                      +.+.   ..+|++.|++.+.+.++..++.+++.++.+++...++.++
T Consensus       175 ~~~~---~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  218 (447)
T d1pw4a_         175 GMAW---FNDWHAALYMPAFCAILVALFAFAMMRDTPQSCGLPPIEE  218 (447)
T ss_dssp             HHHH---TCCSTTCTHHHHHHHHHHHHHHHHHCCCSSTTTCCCSCTT
T ss_pred             Hhhh---hhcccccchhhhhhHHHHHHHHHHhcccchhhcccchhhh
Confidence            8763   3679999999998888888888888777776666555544



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure