Psyllid ID: psy3486

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MDDPFIREHIEDLLRNIRTQVLIKLIKPYTRIHIPFISRQLNIETSDVLIKLIKPYTRIHIPFISRQLNIETSDVLIKLIKPYTRIHIPFISRQLNIETSDVESLLVSLILDNTVRGRIDQSNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMELLQDFYETTLEALKDAKNDRLWFKTNTKLGKLYFDREDFNKLSRILKQLHQSCQMKR
ccccccccccHHHcccHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHEEEccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccc
cccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccEEEHHHHHHHccccHHHHHHHHHHHHHHccEEEEEccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccEEEHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccc
MDDPFIREHIEDLLRNIRTQVLIKLIkpytrihipfisrqlnieTSDVLIKLIkpytrihipfisrqlnieTSDVLIKLIkpytrihipfisrqlnietSDVESLLVSLILDntvrgridqsNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMELLQDFYETTLEALKDAkndrlwfktntklgklyfdredFNKLSRILKQLHQSCQMKR
MDDPFIREHIEDLLRNIRTQVLIKLIKPYTRIHIPfisrqlnietSDVLIKLIKPYTRIHIpfisrqlnietSDVLIKLIKPYTRIHIPFISRQLNIETSDVESLLVSlildntvrgridqsnykEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMELLQDFYETTLEALkdakndrlwfktntklgklyfdreDFNKLSRILKQLhqscqmkr
MDDPFIREHIEDLLRNIRTQVLIKLIKPYTRIHIPFISRQLNIETSDVLIKLIKPYTRIHIPFISRQLNIETSDVLIKLIKPYTRIHIPFISRQLNIETSDVESLLVSLILDNTVRGRIDQSNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMELLQDFYETTLEALKDAKNDRLWFKTNTKLGKLYFDREDFNKLSRILKQLHQSCQMKR
*****IREHIEDLLRNIRTQVLIKLIKPYTRIHIPFISRQLNIETSDVLIKLIKPYTRIHIPFISRQLNIETSDVLIKLIKPYTRIHIPFISRQLNIETSDVESLLVSLILDNTVRGRIDQSNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMELLQDFYETTLEALKDAKNDRLWFKTNTKLGKLYFDREDFNKLSRILK**********
*DDPFIREHIEDLLRNIRTQVLIKLIKPYTRIHIPFISRQLNIETSDVLIKLIKPYTRIHIPFISRQLNIETSDVLIKLIKPYTRIHIPFISRQLNIETSDVESLLVSLILDNTVRGRIDQSNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMELLQDFYETTLEALKDAKNDRLWFKTNTKLGKLYFDREDFNKLSRILKQLHQSC****
MDDPFIREHIEDLLRNIRTQVLIKLIKPYTRIHIPFISRQLNIETSDVLIKLIKPYTRIHIPFISRQLNIETSDVLIKLIKPYTRIHIPFISRQLNIETSDVESLLVSLILDNTVRGRIDQSNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMELLQDFYETTLEALKDAKNDRLWFKTNTKLGKLYFDREDFNKLSRILKQ*********
*DDPFIREHIEDLLRNIRTQVLIKLIKPYTRIHIPFISRQLNIETSDVLIKLIKPYTRIHIPFISRQLNIETSDVLIKLIKPYTRIHIPFISRQLNIETSDVESLLVSLILDNTVRGRIDQSNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMELLQDFYETTLEALKDAKNDRLWFKTNTKLGKLYFDREDFNKLSRILKQLHQSCQM**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDPFIREHIEDLLRNIRTQVLIKLIKPYTRIHIPFISRQLNIETSDVLIKLIKPYTRIHIPFISRQLNIETSDVLIKLIKPYTRIHIPFISRQLNIETSDVESLLVSLILDNTVRGRIDQSNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMELLQDFYETTLEALKDAKNDRLWFKTNTKLGKLYFDREDFNKLSRILKQLHQSCQMKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query222 2.2.26 [Sep-21-2011]
Q94899 444 COP9 signalosome complex yes N/A 0.427 0.213 0.867 5e-44
Q6IQT4 443 COP9 signalosome complex yes N/A 0.414 0.207 0.836 5e-43
Q6IR75 441 COP9 signalosome complex N/A N/A 0.414 0.208 0.826 1e-42
P61203 443 COP9 signalosome complex yes N/A 0.427 0.214 0.826 1e-42
P61202 443 COP9 signalosome complex yes N/A 0.427 0.214 0.826 1e-42
P61201 443 COP9 signalosome complex yes N/A 0.427 0.214 0.826 1e-42
O01422 495 COP9 signalosome complex yes N/A 0.427 0.191 0.693 7e-35
Q8W207 439 COP9 signalosome complex yes N/A 0.441 0.223 0.59 1e-29
Q5B3U7 506 COP9 signalosome complex yes N/A 0.432 0.189 0.45 1e-21
Q7SI58 490 COP9 signalosome complex N/A N/A 0.432 0.195 0.45 2e-20
>sp|Q94899|CSN2_DROME COP9 signalosome complex subunit 2 OS=Drosophila melanogaster GN=alien PE=1 SV=2 Back     alignment and function desciption
 Score =  177 bits (449), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 85/98 (86%), Positives = 90/98 (91%)

Query: 122 SNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMELLQDFYETTLEALKDA 181
            NY EMM RYKQLL YIKSAVTRN+SEKSINSILDYISTSKNM LLQ+FYETTL+AL+DA
Sbjct: 84  CNYDEMMVRYKQLLTYIKSAVTRNHSEKSINSILDYISTSKNMALLQNFYETTLDALRDA 143

Query: 182 KNDRLWFKTNTKLGKLYFDREDFNKLSRILKQLHQSCQ 219
           KNDRLWFKTNTKLGKLYFDR DF KL +ILKQLHQSCQ
Sbjct: 144 KNDRLWFKTNTKLGKLYFDRSDFTKLQKILKQLHQSCQ 181
Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. The CSN complex plays an essential role in oogenesis and embryogenesis and is required for proper photoreceptor R cell differentiation and promote lamina glial cell migration or axon targeting. It also promotes Ubl-dependent degradation of cyclin E (CycE) during early oogenesis.
Drosophila melanogaster (taxid: 7227)
>sp|Q6IQT4|CSN2_DANRE COP9 signalosome complex subunit 2 OS=Danio rerio GN=cops2 PE=2 SV=1 Back     alignment and function description
>sp|Q6IR75|CSN2_XENLA COP9 signalosome complex subunit 2 (Fragment) OS=Xenopus laevis GN=csn2 PE=2 SV=1 Back     alignment and function description
>sp|P61203|CSN2_RAT COP9 signalosome complex subunit 2 OS=Rattus norvegicus GN=Cops2 PE=2 SV=1 Back     alignment and function description
>sp|P61202|CSN2_MOUSE COP9 signalosome complex subunit 2 OS=Mus musculus GN=Cops2 PE=1 SV=1 Back     alignment and function description
>sp|P61201|CSN2_HUMAN COP9 signalosome complex subunit 2 OS=Homo sapiens GN=COPS2 PE=1 SV=1 Back     alignment and function description
>sp|O01422|CSN2_CAEEL COP9 signalosome complex subunit 2 OS=Caenorhabditis elegans GN=csn-2 PE=1 SV=2 Back     alignment and function description
>sp|Q8W207|CSN2_ARATH COP9 signalosome complex subunit 2 OS=Arabidopsis thaliana GN=CSN2 PE=1 SV=1 Back     alignment and function description
>sp|Q5B3U7|CSN2_EMENI COP9 signalosome complex subunit 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=csnB PE=1 SV=2 Back     alignment and function description
>sp|Q7SI58|CSN2_NEUCR COP9 signalosome complex subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csn-2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query222
332016720 444 COP9 signalosome complex subunit 2 [Acro 0.432 0.216 0.919 4e-46
322788770 452 hypothetical protein SINV_00566 [Solenop 0.427 0.210 0.928 5e-46
307200707 444 COP9 signalosome complex subunit 2 [Harp 0.427 0.213 0.918 7e-46
307170813 444 COP9 signalosome complex subunit 2 [Camp 0.427 0.213 0.918 7e-46
345485521 444 PREDICTED: COP9 signalosome complex subu 0.427 0.213 0.918 7e-46
383856485 444 PREDICTED: COP9 signalosome complex subu 0.427 0.213 0.918 2e-45
312376082 445 hypothetical protein AND_13182 [Anophele 0.423 0.211 0.927 2e-45
260814574 500 hypothetical protein BRAFLDRAFT_82574 [B 0.418 0.186 0.897 3e-45
357628102 444 putative cop9 signalosome complex subuni 0.427 0.213 0.897 8e-45
31211457 445 AGAP008598-PA [Anopheles gambiae str. PE 0.423 0.211 0.907 1e-44
>gi|332016720|gb|EGI57563.1| COP9 signalosome complex subunit 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  190 bits (482), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 91/99 (91%), Positives = 97/99 (97%)

Query: 122 SNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMELLQDFYETTLEALKDA 181
           SNYKEMMSRYKQLL YIKSAVTRN+SEKSINSILDYISTSKNMELLQDFYETTL+ALKDA
Sbjct: 84  SNYKEMMSRYKQLLTYIKSAVTRNHSEKSINSILDYISTSKNMELLQDFYETTLDALKDA 143

Query: 182 KNDRLWFKTNTKLGKLYFDREDFNKLSRILKQLHQSCQM 220
           KNDRLWFKTNTKLGKLY+DR DFNKL++ILKQLHQSCQ+
Sbjct: 144 KNDRLWFKTNTKLGKLYYDRSDFNKLAKILKQLHQSCQV 182

Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|322788770|gb|EFZ14338.1| hypothetical protein SINV_00566 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307200707|gb|EFN80804.1| COP9 signalosome complex subunit 2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307170813|gb|EFN62929.1| COP9 signalosome complex subunit 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|345485521|ref|XP_003425288.1| PREDICTED: COP9 signalosome complex subunit 2-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383856485|ref|XP_003703739.1| PREDICTED: COP9 signalosome complex subunit 2-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
>gi|312376082|gb|EFR23276.1| hypothetical protein AND_13182 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|260814574|ref|XP_002601989.1| hypothetical protein BRAFLDRAFT_82574 [Branchiostoma floridae] gi|229287294|gb|EEN58001.1| hypothetical protein BRAFLDRAFT_82574 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|357628102|gb|EHJ77545.1| putative cop9 signalosome complex subunit [Danaus plexippus] Back     alignment and taxonomy information
>gi|31211457|ref|XP_314698.1| AGAP008598-PA [Anopheles gambiae str. PEST] gi|30176315|gb|EAA10217.2| AGAP008598-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query222
FB|FBgn0013746 444 alien "alien" [Drosophila mela 0.436 0.218 0.876 1.4e-41
ZFIN|ZDB-GENE-040625-15 443 cops2 "COP9 constitutive photo 0.441 0.221 0.836 5.9e-41
UNIPROTKB|E2REA8 443 COPS2 "Uncharacterized protein 0.441 0.221 0.826 1.2e-40
UNIPROTKB|P61201 443 COPS2 "COP9 signalosome comple 0.441 0.221 0.826 1.2e-40
MGI|MGI:1330276 443 Cops2 "COP9 (constitutive phot 0.441 0.221 0.826 1.2e-40
RGD|628791 443 Cops2 "COP9 signalosome subuni 0.441 0.221 0.826 1.2e-40
UNIPROTKB|P61203 443 Cops2 "COP9 signalosome comple 0.441 0.221 0.826 1.2e-40
UNIPROTKB|F1SQG5 385 COPS2 "Uncharacterized protein 0.441 0.254 0.826 1.2e-40
UNIPROTKB|G3X736 450 COPS2 "Uncharacterized protein 0.441 0.217 0.771 2.1e-38
WB|WBGene00000814 495 csn-2 [Caenorhabditis elegans 0.490 0.220 0.651 2.2e-34
FB|FBgn0013746 alien "alien" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 441 (160.3 bits), Expect = 1.4e-41, P = 1.4e-41
 Identities = 85/97 (87%), Positives = 90/97 (92%)

Query:   123 NYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMELLQDFYETTLEALKDAK 182
             NY EMM RYKQLL YIKSAVTRN+SEKSINSILDYISTSKNM LLQ+FYETTL+AL+DAK
Sbjct:    85 NYDEMMVRYKQLLTYIKSAVTRNHSEKSINSILDYISTSKNMALLQNFYETTLDALRDAK 144

Query:   183 NDRLWFKTNTKLGKLYFDREDFNKLSRILKQLHQSCQ 219
             NDRLWFKTNTKLGKLYFDR DF KL +ILKQLHQSCQ
Sbjct:   145 NDRLWFKTNTKLGKLYFDRSDFTKLQKILKQLHQSCQ 181
GO:0008231 "repressor ecdysone receptor complex" evidence=IPI
GO:0003714 "transcription corepressor activity" evidence=IDA
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IDA
GO:0035257 "nuclear hormone receptor binding" evidence=IPI
GO:0016922 "ligand-dependent nuclear receptor binding" evidence=IPI
GO:0042803 "protein homodimerization activity" evidence=IPI
GO:0005515 "protein binding" evidence=IPI
GO:0008180 "signalosome" evidence=NAS;IPI
GO:0007165 "signal transduction" evidence=ISS
GO:0004871 "signal transducer activity" evidence=ISS
GO:0006911 "phagocytosis, engulfment" evidence=IMP
GO:0050821 "protein stabilization" evidence=IMP
GO:0007095 "mitotic G2 DNA damage checkpoint" evidence=IGI
GO:0022008 "neurogenesis" evidence=IMP
ZFIN|ZDB-GENE-040625-15 cops2 "COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2REA8 COPS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P61201 COPS2 "COP9 signalosome complex subunit 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1330276 Cops2 "COP9 (constitutive photomorphogenic) homolog, subunit 2 (Arabidopsis thaliana)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|628791 Cops2 "COP9 signalosome subunit 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P61203 Cops2 "COP9 signalosome complex subunit 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SQG5 COPS2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|G3X736 COPS2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
WB|WBGene00000814 csn-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8W207CSN2_ARATHNo assigned EC number0.590.44140.2232yesN/A
P61201CSN2_HUMANNo assigned EC number0.82650.42790.2144yesN/A
P61203CSN2_RATNo assigned EC number0.82650.42790.2144yesN/A
P61202CSN2_MOUSENo assigned EC number0.82650.42790.2144yesN/A
O01422CSN2_CAEELNo assigned EC number0.69300.42790.1919yesN/A
Q94899CSN2_DROMENo assigned EC number0.86730.42790.2139yesN/A
Q6IQT4CSN2_DANRENo assigned EC number0.83670.41440.2076yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
pfam01399100 pfam01399, PCI, PCI domain 6e-09
pfam01399100 pfam01399, PCI, PCI domain 1e-07
smart0075388 smart00753, PAM, PCI/PINT associated module 1e-06
smart0008888 smart00088, PINT, motif in proteasome subunits, In 1e-06
pfam10075144 pfam10075, PCI_Csn8, COP9 signalosome, subunit CSN 4e-05
smart0075388 smart00753, PAM, PCI/PINT associated module 5e-04
smart0008888 smart00088, PINT, motif in proteasome subunits, In 5e-04
COG5159421 COG5159, RPN6, 26S proteasome regulatory complex c 5e-04
COG5159421 COG5159, RPN6, 26S proteasome regulatory complex c 0.001
>gnl|CDD|216479 pfam01399, PCI, PCI domain Back     alignment and domain information 
 Score = 51.4 bits (124), Expect = 6e-09
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 3/72 (4%)

Query: 52  LIKPYTRIHIPFISRQLNIETSDVLIKLIKPYTRIHIPFISRQLNIETSDVESLLVSLIL 111
           L+       +  + R++  E    L +L KPY+ I +  +++ L +   +VE +L  LI 
Sbjct: 27  LLDDGLAELLEDLRRKI-REL--NLRRLAKPYSSISLSDLAKLLGLSVDEVEKILSKLIR 83

Query: 112 DNTVRGRIDQSN 123
           D  +RG+IDQ N
Sbjct: 84  DGRIRGKIDQVN 95

This domain has also been called the PINT motif (Proteasome, Int-6, Nip-1 and TRIP-15). Length = 100
>gnl|CDD|216479 pfam01399, PCI, PCI domain Back     alignment and domain information
>gnl|CDD|214803 smart00753, PAM, PCI/PINT associated module Back     alignment and domain information
>gnl|CDD|214509 smart00088, PINT, motif in proteasome subunits, Int-6, Nip-1 and TRIP-15 Back     alignment and domain information
>gnl|CDD|220553 pfam10075, PCI_Csn8, COP9 signalosome, subunit CSN8 Back     alignment and domain information
>gnl|CDD|214803 smart00753, PAM, PCI/PINT associated module Back     alignment and domain information
>gnl|CDD|214509 smart00088, PINT, motif in proteasome subunits, Int-6, Nip-1 and TRIP-15 Back     alignment and domain information
>gnl|CDD|227488 COG5159, RPN6, 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227488 COG5159, RPN6, 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 222
KOG1464|consensus 440 100.0
KOG1463|consensus411 99.82
KOG1463|consensus411 99.78
COG5159421 RPN6 26S proteasome regulatory complex component [ 99.75
COG5159421 RPN6 26S proteasome regulatory complex component [ 99.72
KOG1464|consensus440 99.6
PF01399105 PCI: PCI domain; InterPro: IPR000717 A homology do 98.65
PF01399105 PCI: PCI domain; InterPro: IPR000717 A homology do 98.53
smart0075388 PAM PCI/PINT associated module. 98.49
smart0008888 PINT motif in proteasome subunits, Int-6, Nip-1 an 98.49
KOG0686|consensus466 98.49
smart0075388 PAM PCI/PINT associated module. 98.15
smart0008888 PINT motif in proteasome subunits, Int-6, Nip-1 an 98.15
KOG0686|consensus466 96.92
KOG0687|consensus393 95.81
COG5187412 RPN7 26S proteasome regulatory complex component, 93.89
PF10075143 PCI_Csn8: COP9 signalosome, subunit CSN8; InterPro 93.55
KOG2581|consensus493 93.01
KOG1498|consensus439 92.43
KOG1497|consensus399 89.39
KOG1498|consensus439 89.09
PF09743272 DUF2042: Uncharacterized conserved protein (DUF204 88.96
cd00189100 TPR Tetratricopeptide repeat domain; typically con 86.53
COG5071439 RPN5 26S proteasome regulatory complex component [ 86.21
PLN03083 803 E3 UFM1-protein ligase 1 homolog; Provisional 86.16
KOG1497|consensus399 86.12
KOG1840|consensus508 85.71
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 81.91
KOG0687|consensus393 81.02
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 80.64
>KOG1464|consensus Back     alignment and domain information 
Probab=100.00  E-value=1e-45  Score=333.08  Aligned_cols=133  Identities=67%  Similarity=0.972  Sum_probs=129.3

Q ss_pred             cHhHHHHHhCCChHHHHHHHHHHhhccceeeEeeccchHHHHHHHHHHHhhhhhccCccccHHHHHHHHHHhhcCCchHH
Q psy3486          87 HIPFISRQLNIETSDVESLLVSLILDNTVRGRIDQSNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMEL  166 (222)
Q Consensus        87 ~i~~ia~~l~l~~~~VE~~L~~~iLdq~ik~~idqg~y~~~l~~y~~LLtyiksaVtrNysEksIn~iLd~vs~s~~~~~  166 (222)
                      -++-+++++.++.+..|  |.|++|+|+|++.|++|+|++|+++|+||||||||||||||||||||+|+||+|+|+++++
T Consensus        46 Al~sF~kVlelEgEKge--WGFKALKQmiKI~f~l~~~~eMm~~Y~qlLTYIkSAVTrNySEKsIN~IlDyiStS~~m~L  123 (440)
T KOG1464|consen   46 ALSSFQKVLELEGEKGE--WGFKALKQMIKINFRLGNYKEMMERYKQLLTYIKSAVTRNYSEKSINSILDYISTSKNMDL  123 (440)
T ss_pred             HHHHHHHHHhcccccch--hHHHHHHHHHHHHhccccHHHHHHHHHHHHHHHHHHHhccccHHHHHHHHHHHhhhhhhHH
Confidence            35678999999999888  7999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhcCCCCceeeecchhhhhhhhchhhHhHHHHHHHHHHHhhhcc
Q psy3486         167 LQDFYETTLEALKDAKNDRLWFKTNTKLGKLYFDREDFNKLSRILKQLHQSCQMK  221 (222)
Q Consensus       167 l~~fYe~TL~~l~~~~NeRLWfKtnlKlakL~ld~~ey~~l~~~l~~L~~~c~~~  221 (222)
                      +|.||++||+||++++|||||||||+|||+||||++||.++++++++||.|||++
T Consensus       124 LQ~FYeTTL~ALkdAKNeRLWFKTNtKLgkl~fd~~e~~kl~KIlkqLh~SCq~e  178 (440)
T KOG1464|consen  124 LQEFYETTLDALKDAKNERLWFKTNTKLGKLYFDRGEYTKLQKILKQLHQSCQTE  178 (440)
T ss_pred             HHHHHHHHHHHHHhhhcceeeeeccchHhhhheeHHHHHHHHHHHHHHHHHhccc
Confidence            9999999999999999999999999999999999999999999999999999986

>KOG1463|consensus Back     alignment and domain information
>KOG1463|consensus Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1464|consensus Back     alignment and domain information
>PF01399 PCI: PCI domain; InterPro: IPR000717 A homology domain of unclear function, occurs in the C-terminal region of several regulatory components of the 26S proteasome as well as in other proteins Back     alignment and domain information
>PF01399 PCI: PCI domain; InterPro: IPR000717 A homology domain of unclear function, occurs in the C-terminal region of several regulatory components of the 26S proteasome as well as in other proteins Back     alignment and domain information
>smart00753 PAM PCI/PINT associated module Back     alignment and domain information
>smart00088 PINT motif in proteasome subunits, Int-6, Nip-1 and TRIP-15 Back     alignment and domain information
>KOG0686|consensus Back     alignment and domain information
>smart00753 PAM PCI/PINT associated module Back     alignment and domain information
>smart00088 PINT motif in proteasome subunits, Int-6, Nip-1 and TRIP-15 Back     alignment and domain information
>KOG0686|consensus Back     alignment and domain information
>KOG0687|consensus Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10075 PCI_Csn8: COP9 signalosome, subunit CSN8; InterPro: IPR019280 The photomorphogenic 9 (COP9) signalosome or CSN complex is composed of eight subunits: Cops1/GPS1, Cops2, Cops3, Cops4, Cops5, Cop6, Cops7 (Cops7A or Cops7B) and Cops8 Back     alignment and domain information
>KOG2581|consensus Back     alignment and domain information
>KOG1498|consensus Back     alignment and domain information
>KOG1497|consensus Back     alignment and domain information
>KOG1498|consensus Back     alignment and domain information
>PF09743 DUF2042: Uncharacterized conserved protein (DUF2042); InterPro: IPR018611 The ubiquitin fold modifier 1 (Ufm1) is the most recently discovered ubiquitin-like modifier whose conjugation (ufmylation) system is conserved in multicellular organisms Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG5071 RPN5 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03083 E3 UFM1-protein ligase 1 homolog; Provisional Back     alignment and domain information
>KOG1497|consensus Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG0687|consensus Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 7e-17
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 4e-09
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
3t5x_A203 PCI domain-containing protein 2; PCI, mRNA nuclear 2e-06
1ufm_A84 COP9 complex subunit 4; helix-turn-helix, structur 4e-06
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Length = 394 Back     alignment and structure
 Score = 77.6 bits (190), Expect = 7e-17
 Identities = 16/100 (16%), Positives = 36/100 (36%), Gaps = 4/100 (4%)

Query: 124 YKEMMSRYKQLLLYIK---SAVTRNYSEKSINSILDYIST-SKNMELLQDFYETTLEALK 179
            +        L+   +   S++++  + K + S++D          +     +  +E  K
Sbjct: 31  QEGKAKELADLIKVTRPFLSSISKAKAAKLVRSLVDMFLDMDAGTGIEVQLCKDCIEWAK 90

Query: 180 DAKNDRLWFKTNTKLGKLYFDREDFNKLSRILKQLHQSCQ 219
             K   L      +L  LYFD   + +   +  QL +  +
Sbjct: 91  QEKRTFLRQSLEARLIALYFDTALYTEALALGAQLLRELK 130
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Length = 394 Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Length = 394 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Length = 203 Back     alignment and structure
>1ufm_A COP9 complex subunit 4; helix-turn-helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.4.5.47 Length = 84 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 99.29
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 99.25
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 99.17
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.98
1ufm_A84 COP9 complex subunit 4; helix-turn-helix, structur 98.94
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 98.9
1ufm_A84 COP9 complex subunit 4; helix-turn-helix, structur 98.9
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 98.87
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.73
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 98.71
3t5x_A203 PCI domain-containing protein 2; PCI, mRNA nuclear 97.88
4b4t_O393 26S proteasome regulatory subunit RPN9; hydrolase, 97.55
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.01
4b4t_O393 26S proteasome regulatory subunit RPN9; hydrolase, 96.97
3t5v_B455 Nuclear mRNA export protein THP1; PCI, mRNA nuclea 96.81
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 96.55
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 96.2
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 95.39
3u3w_A 293 Transcriptional activator PLCR protein; ternary co 95.39
2qfc_A 293 PLCR protein; TPR, HTH, transcription regulation; 94.95
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 94.55
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 94.11
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 93.83
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 93.69
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 93.6
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 93.44
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 93.36
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 93.32
3q15_A378 PSP28, response regulator aspartate phosphatase H; 93.05
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 92.87
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 92.81
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 92.54
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 92.52
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 92.15
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 91.96
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 91.9
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 91.85
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 91.75
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 90.98
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 89.76
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 89.66
3qww_A433 SET and MYND domain-containing protein 2; methyltr 89.37
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 87.38
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 87.3
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 87.04
3t5v_B455 Nuclear mRNA export protein THP1; PCI, mRNA nuclea 86.39
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 86.38
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 85.97
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 83.75
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 83.28
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 82.67
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 82.11
3chm_A169 COP9 signalosome complex subunit 7; heat/ARM repea 82.05
1qqe_A 292 Vesicular transport protein SEC17; helix-turn-heli 81.89
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 81.84
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 81.6
3q49_B137 STIP1 homology and U box-containing protein 1; E3 81.06
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 81.01
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 80.72
4b0z_A229 RPN12, 26S proteasome regulatory subunit RPN12; pr 80.52
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 80.33
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 80.14
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
Probab=99.29  E-value=9.8e-13  Score=122.11  Aligned_cols=112  Identities=15%  Similarity=0.153  Sum_probs=101.3

Q ss_pred             HHHHhhccceeeEeeccchHHHHHHHHHHHhhhhhccCccccHHHHHHHHHHhhcCCchHHHHHHHHHHHHHHhcCCCC-
Q psy3486         106 LVSLILDNTVRGRIDQSNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMELLQDFYETTLEALKDAKND-  184 (222)
Q Consensus       106 L~~~iLdq~ik~~idqg~y~~~l~~y~~LLtyiksaVtrNysEksIn~iLd~vs~s~~~~~l~~fYe~TL~~l~~~~Ne-  184 (222)
                      ....++-+..+...++|++++..+..+++.+|+ +.+++++++|.|.+++|+++..++.  .+..|++++++++.++|+ 
T Consensus        17 ~~e~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~-~~~~kak~~k~v~~l~~~~~~~~~~--~~~~~~~~~~~~~~a~~~~   93 (394)
T 3txn_A           17 IKEQGILQQGELYKQEGKAKELADLIKVTRPFL-SSISKAKAAKLVRSLVDMFLDMDAG--TGIEVQLCKDCIEWAKQEK   93 (394)
T ss_dssp             HHHHHHHHHHHHHHHHTCHHHHHHHHHHTTTGG-GGSCHHHHHHHHHHHHHHHTTSCCC--HHHHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHH-HHhchHHHHHHHHHHHHHHhcCCCc--HHHHHHHHHHHHHHHHHHH
Confidence            456667778888999999999999999999999 8899999999999999999988765  488899999999999888 


Q ss_pred             ceeeecch--hhhhhhhchhhHhHHHHHHHHHHHhhhc
Q psy3486         185 RLWFKTNT--KLGKLYFDREDFNKLSRILKQLHQSCQM  220 (222)
Q Consensus       185 RLWfKtnl--KlakL~ld~~ey~~l~~~l~~L~~~c~~  220 (222)
                      |+|+|+++  |||++|+++|+|+++.++++++++.|+.
T Consensus        94 r~flr~~l~~kL~~l~~~~~~y~~a~~~i~~l~~~~~~  131 (394)
T 3txn_A           94 RTFLRQSLEARLIALYFDTALYTEALALGAQLLRELKK  131 (394)
T ss_dssp             CHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHhc
Confidence            66669766  9999999999999999999999999976
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ufm_A COP9 complex subunit 4; helix-turn-helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.4.5.47 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ufm_A COP9 complex subunit 4; helix-turn-helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.4.5.47 Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3chm_A COP9 signalosome complex subunit 7; heat/ARM repeats, winged helix motif, developmental protein, phosphoprotein; 1.50A {Arabidopsis thaliana} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4b0z_A RPN12, 26S proteasome regulatory subunit RPN12; protein binding, proteasome ubitquitin; HET: SGM GOL; 1.58A {Schizosaccharomyces pombe} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 222
d1ufma_84 a.4.5.47 (A:) COP9 signalosome complex subunit 4, 7e-09
>d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 84 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: PCI domain (PINT motif)
domain: COP9 signalosome complex subunit 4, GSN4
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 49.4 bits (118), Expect = 7e-09
 Identities = 12/48 (25%), Positives = 20/48 (41%)

Query: 76  LIKLIKPYTRIHIPFISRQLNIETSDVESLLVSLILDNTVRGRIDQSN 123
           L+   K Y  I    +   L I  +  E +   +I +  + G IDQ +
Sbjct: 21  LLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQID 68

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
d1ufma_84 COP9 signalosome complex subunit 4, GSN4 {Mouse (M 98.76
d1ufma_84 COP9 signalosome complex subunit 4, GSN4 {Mouse (M 98.75
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 92.75
d1qqea_ 290 Vesicular transport protein sec17 {Baker's yeast ( 90.42
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 88.59
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 88.35
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 87.57
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 86.32
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 85.64
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 85.02
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 84.4
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 84.1
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 83.01
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 82.52
>d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: PCI domain (PINT motif)
domain: COP9 signalosome complex subunit 4, GSN4
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=98.76  E-value=1.2e-09  Score=79.70  Aligned_cols=57  Identities=18%  Similarity=0.118  Sum_probs=54.5

Q ss_pred             HHHHHHHHHHHHhhcccccccHhHHHHHhccchhHHHHhhhhhhHhhhhhhhhhhhh
Q psy3486          13 LLRNIRTQVLIKLIKPYTRIHIPFISRQLNIETSDVLIKLIKPYTRIHIPFISRQLN   69 (222)
Q Consensus        13 L~~~lr~q~Ll~li~PYsri~i~~ia~~l~l~~~~ve~klsd~il~~hl~~l~d~~~   69 (222)
                      |++++++.||..+.+||++|++++||+.|++|.++||..+++||.++.|.+-+||.+
T Consensus        12 L~~~i~Ehni~~is~~Y~~Isl~~la~~l~l~~~evE~~l~~mI~~~~i~akIDq~~   68 (84)
T d1ufma_          12 LDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQID   68 (84)
T ss_dssp             CCHHHHHHHHHHHHHSCSEEEHHHHHHHTTSCHHHHHHHHHHHHHTTSSCEEEETTT
T ss_pred             HHHHHHHHHHHHHHHhhceeeHHHHHHHHCCCHHHHHHHHHHHHhcCeEEEEEeCCC
Confidence            578999999999999999999999999999999999999999999999999999754
>d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure