Psyllid ID: psy3498


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-
MGRRKSKRKPPPKRKNIEPLDIQFNCPFCNHEKSCEVKMDKGRNSARIACRVCLEDFQTTINFLSEAIDVYNDWVDASVPS
ccccccccccccccccccccccccccccccccccEEEEEEccccEEEEEcccccccEEEcccccccHHHHHHHHHHHcccc
ccccccccccccccccccccccEEcccccccccEEEEEEEccccEEEEEEEEcccEEEEcccccccccEEHHHHHHHHccc
mgrrkskrkpppkrkniepldiqfncpfcnhekscEVKMDKGRNSARIACRVCLEDFQTTINFLSEAIDVYndwvdasvps
mgrrkskrkpppkrkniepldiqfncpFCNHEKSCEVKMDKGRNSARIACRVCLEDFQTTINFLSEAIDVYNDWVDASVPS
MGrrkskrkpppkrkNIEPLDIQFNCPFCNHEKSCEVKMDKGRNSARIACRVCLEDFQTTINFLSEAIDVYNDWVDASVPS
*******************LDIQFNCPFCNHEKSCEVKMDKGRNSARIACRVCLEDFQTTINFLSEAIDVYNDWVD*****
**********************QFNCPFCNHEKSCEVKMDKGRNSARIACRVCLEDFQTTINFLSEAIDVYNDWVDASVP*
*************RKNIEPLDIQFNCPFCNHEKSCEVKMDKGRNSARIACRVCLEDFQTTINFLSEAIDVYNDWVDASVPS
****************IEPLDIQFNCPFCNHEKSCEVKMDKGRNSARIACRVCLEDFQTTINFLSEAIDVYNDWVDASVP*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRRKSKRKPPPKRKNIEPLDIQFNCPFCNHEKSCEVKMDKGRNSARIACRVCLEDFQTTINFLSEAIDVYNDWVDASVPS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query81 2.2.26 [Sep-21-2011]
Q8MQI682 Transcription elongation yes N/A 0.950 0.939 0.909 5e-36
Q9U50182 Transcription elongation N/A N/A 0.950 0.939 0.831 1e-32
Q9XVZ884 Transcription elongation yes N/A 0.950 0.916 0.714 9e-28
P6000383 Transcription elongation yes N/A 0.716 0.698 0.672 1e-19
P6000283 Transcription elongation yes N/A 0.716 0.698 0.672 1e-19
A4IFR383 Transcription elongation yes N/A 0.716 0.698 0.672 1e-19
Q8LHP089 Transcription elongation yes N/A 0.925 0.842 0.486 7e-17
Q8LEF3120 Transcription elongation yes N/A 0.925 0.625 0.5 2e-16
P36053145 Transcription elongation yes N/A 0.938 0.524 0.480 2e-16
O13868107 Transcription elongation yes N/A 0.938 0.710 0.480 9e-15
>sp|Q8MQI6|ELOF1_DROME Transcription elongation factor 1 homolog OS=Drosophila melanogaster GN=CG40228 PE=1 SV=1 Back     alignment and function desciption
 Score =  149 bits (376), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 70/77 (90%), Positives = 72/77 (93%)

Query: 1  MGRRKSKRKPPPKRKNIEPLDIQFNCPFCNHEKSCEVKMDKGRNSARIACRVCLEDFQTT 60
          MGRRKSKRKPPPKRKNIEPLD QFNCPFCNHEKSCEVKMDK RN+A+I CRVCLEDFQT 
Sbjct: 1  MGRRKSKRKPPPKRKNIEPLDQQFNCPFCNHEKSCEVKMDKSRNTAKITCRVCLEDFQTG 60

Query: 61 INFLSEAIDVYNDWVDA 77
          INFLSE IDVYNDWVDA
Sbjct: 61 INFLSEPIDVYNDWVDA 77




Transcription elongation factor implicated in the maintenance of proper chromatin structure in actively transcribed regions.
Drosophila melanogaster (taxid: 7227)
>sp|Q9U501|ELOF1_MANSE Transcription elongation factor 1 homolog OS=Manduca sexta PE=3 SV=1 Back     alignment and function description
>sp|Q9XVZ8|ELOF1_CAEEL Transcription elongation factor 1 homolog OS=Caenorhabditis elegans GN=Y54G11A.11 PE=3 SV=1 Back     alignment and function description
>sp|P60003|ELOF1_MOUSE Transcription elongation factor 1 homolog OS=Mus musculus GN=Elof1 PE=1 SV=1 Back     alignment and function description
>sp|P60002|ELOF1_HUMAN Transcription elongation factor 1 homolog OS=Homo sapiens GN=ELOF1 PE=2 SV=1 Back     alignment and function description
>sp|A4IFR3|ELOF1_BOVIN Transcription elongation factor 1 homolog OS=Bos taurus GN=ELOF1 PE=2 SV=1 Back     alignment and function description
>sp|Q8LHP0|ELOF1_ORYSJ Transcription elongation factor 1 homolog OS=Oryza sativa subsp. japonica GN=Os07g0631100 PE=3 SV=1 Back     alignment and function description
>sp|Q8LEF3|ELOF1_ARATH Transcription elongation factor 1 homolog OS=Arabidopsis thaliana GN=At5g46030 PE=2 SV=1 Back     alignment and function description
>sp|P36053|ELF1_YEAST Transcription elongation factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELF1 PE=1 SV=1 Back     alignment and function description
>sp|O13868|ELOF1_SCHPO Transcription elongation factor 1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.02c PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query81
19548308782 GE19761 [Drosophila yakuba] gi|194185993 0.950 0.939 0.935 2e-35
17003883782 conserved hypothetical protein [Culex qu 0.950 0.939 0.909 4e-35
19476445282 GF19993 [Drosophila ananassae] gi|194876 0.950 0.939 0.922 4e-35
28973951982 transcription elongation factor 1-like p 0.950 0.939 0.896 9e-35
15713806482 hypothetical protein AaeL_AAEL003749 [Ae 0.950 0.939 0.896 9e-35
16107612282 CG40228, isoform C [Drosophila melanogas 0.950 0.939 0.909 2e-34
19544642982 GK19168 [Drosophila willistoni] gi|19416 0.950 0.939 0.909 5e-34
9109055682 PREDICTED: similar to CG40228 CG40228-PC 0.950 0.939 0.870 8e-34
24201186682 conserved hypothetical protein [Pediculu 0.950 0.939 0.857 9e-34
3120906782 AGAP003707-PA [Anopheles gambiae str. PE 0.950 0.939 0.870 2e-33
>gi|195483087|ref|XP_002086852.1| GE19761 [Drosophila yakuba] gi|194185993|gb|EDW99604.1| GE19761 [Drosophila yakuba] Back     alignment and taxonomy information
 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 72/77 (93%), Positives = 73/77 (94%)

Query: 1  MGRRKSKRKPPPKRKNIEPLDIQFNCPFCNHEKSCEVKMDKGRNSARIACRVCLEDFQTT 60
          MGRRKSKRKPPPKRKNIEPLD QFNCPFCNHEKSCEVKMDKGRN+ARI CRVCLEDFQT 
Sbjct: 1  MGRRKSKRKPPPKRKNIEPLDQQFNCPFCNHEKSCEVKMDKGRNTARITCRVCLEDFQTG 60

Query: 61 INFLSEAIDVYNDWVDA 77
          INFLSE IDVYNDWVDA
Sbjct: 61 INFLSEPIDVYNDWVDA 77




Source: Drosophila yakuba

Species: Drosophila yakuba

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|170038837|ref|XP_001847254.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167862445|gb|EDS25828.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|194764452|ref|XP_001964343.1| GF19993 [Drosophila ananassae] gi|194876816|ref|XP_001973846.1| GG16332 [Drosophila erecta] gi|195038885|ref|XP_001990829.1| GH18042 [Drosophila grimshawi] gi|195107686|ref|XP_001998439.1| GI23965 [Drosophila mojavensis] gi|195151761|ref|XP_002016807.1| GL21968 [Drosophila persimilis] gi|195403266|ref|XP_002060214.1| GJ22512 [Drosophila virilis] gi|198461808|ref|XP_002135770.1| GA17880 [Drosophila pseudoobscura pseudoobscura] gi|190614615|gb|EDV30139.1| GF19993 [Drosophila ananassae] gi|190655629|gb|EDV52872.1| GG16332 [Drosophila erecta] gi|193895025|gb|EDV93891.1| GH18042 [Drosophila grimshawi] gi|193915033|gb|EDW13900.1| GI23965 [Drosophila mojavensis] gi|194111864|gb|EDW33907.1| GL21968 [Drosophila persimilis] gi|194141797|gb|EDW58211.1| GJ22512 [Drosophila virilis] gi|198142734|gb|EDY71453.1| GA17880 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|289739519|gb|ADD18507.1| transcription elongation factor 1-like protein [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|157138064|ref|XP_001657220.1| hypothetical protein AaeL_AAEL003749 [Aedes aegypti] gi|108880704|gb|EAT44929.1| AAEL003749-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|161076122|ref|NP_001104426.1| CG40228, isoform C [Drosophila melanogaster] gi|442634478|ref|NP_001263166.1| CG40228, isoform D [Drosophila melanogaster] gi|195359298|ref|XP_002045341.1| GM19294 [Drosophila sechellia] gi|195556994|ref|XP_002077227.1| GD25376 [Drosophila simulans] gi|25453309|sp|Q8MQI6.1|ELOF1_DROME RecName: Full=Transcription elongation factor 1 homolog gi|21744283|gb|AAM76200.1| RE67573p [Drosophila melanogaster] gi|158529745|gb|EDP28091.1| CG40228, isoform C [Drosophila melanogaster] gi|194129331|gb|EDW51374.1| GM19294 [Drosophila sechellia] gi|194202320|gb|EDX15896.1| GD25376 [Drosophila simulans] gi|220959684|gb|ACL92385.1| CG40228-PC [synthetic construct] gi|440216244|gb|ELP57411.1| CG40228, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195446429|ref|XP_002070776.1| GK19168 [Drosophila willistoni] gi|194166861|gb|EDW81762.1| GK19168 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|91090556|ref|XP_971424.1| PREDICTED: similar to CG40228 CG40228-PC [Tribolium castaneum] gi|270014357|gb|EFA10805.1| hypothetical protein TcasGA2_TC030554 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242011866|ref|XP_002426665.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212510829|gb|EEB13927.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|31209067|ref|XP_313500.1| AGAP003707-PA [Anopheles gambiae str. PEST] gi|30177009|gb|EAA44682.1| AGAP003707-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query81
FB|FBgn006367082 CG40228 [Drosophila melanogast 0.765 0.756 0.887 1.7e-27
WB|WBGene0001321984 Y54G11A.11.2 [Caenorhabditis e 0.753 0.726 0.721 4.3e-22
UNIPROTKB|Q9XVZ884 Y54G11A.11 "Transcription elon 0.753 0.726 0.721 4.3e-22
UNIPROTKB|A4IFR383 ELOF1 "Transcription elongatio 0.716 0.698 0.672 3.5e-20
UNIPROTKB|P6000283 ELOF1 "Transcription elongatio 0.716 0.698 0.672 3.5e-20
MGI|MGI:191337683 Elof1 "elongation factor 1 hom 0.716 0.698 0.672 3.5e-20
ZFIN|ZDB-GENE-040426-138583 elof1 "elongation factor 1 hom 0.716 0.698 0.672 3.5e-20
FB|FBgn003653182 CG6244 [Drosophila melanogaste 0.765 0.756 0.645 4.4e-20
UNIPROTKB|G4MN17123 MGG_06916 "Transcription elong 0.753 0.495 0.524 6.9e-15
ASPGD|ASPL0000078186122 AN11131 [Emericella nidulans ( 0.740 0.491 0.566 1.4e-14
FB|FBgn0063670 CG40228 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 308 (113.5 bits), Expect = 1.7e-27, P = 1.7e-27
 Identities = 55/62 (88%), Positives = 57/62 (91%)

Query:    16 NIEPLDIQFNCPFCNHEKSCEVKMDKGRNSARIACRVCLEDFQTTINFLSEAIDVYNDWV 75
             NIEPLD QFNCPFCNHEKSCEVKMDK RN+A+I CRVCLEDFQT INFLSE IDVYNDWV
Sbjct:    16 NIEPLDQQFNCPFCNHEKSCEVKMDKSRNTAKITCRVCLEDFQTGINFLSEPIDVYNDWV 75

Query:    76 DA 77
             DA
Sbjct:    76 DA 77




GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0005575 "cellular_component" evidence=ND
WB|WBGene00013219 Y54G11A.11.2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q9XVZ8 Y54G11A.11 "Transcription elongation factor 1 homolog" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|A4IFR3 ELOF1 "Transcription elongation factor 1 homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P60002 ELOF1 "Transcription elongation factor 1 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1913376 Elof1 "elongation factor 1 homolog (ELF1, S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1385 elof1 "elongation factor 1 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0036531 CG6244 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|G4MN17 MGG_06916 "Transcription elongation factor" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ASPGD|ASPL0000078186 AN11131 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8LHP0ELOF1_ORYSJNo assigned EC number0.48680.92590.8426yesN/A
P60002ELOF1_HUMANNo assigned EC number0.67240.71600.6987yesN/A
P60003ELOF1_MOUSENo assigned EC number0.67240.71600.6987yesN/A
A4IFR3ELOF1_BOVINNo assigned EC number0.67240.71600.6987yesN/A
O13868ELOF1_SCHPONo assigned EC number0.48050.93820.7102yesN/A
Q8MQI6ELOF1_DROMENo assigned EC number0.90900.95060.9390yesN/A
Q9U501ELOF1_MANSENo assigned EC number0.83110.95060.9390N/AN/A
Q8LEF3ELOF1_ARATHNo assigned EC number0.50.92590.625yesN/A
Q54KR5ELOF1_DICDINo assigned EC number0.46750.92590.9375yesN/A
Q9XVZ8ELOF1_CAEELNo assigned EC number0.71420.95060.9166yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query81
pfam0512974 pfam05129, Elf1, Transcription elongation factor E 3e-32
COG4888104 COG4888, COG4888, Uncharacterized Zn ribbon-contai 1e-20
PRK1489299 PRK14892, PRK14892, putative transcription elongat 2e-06
>gnl|CDD|218451 pfam05129, Elf1, Transcription elongation factor Elf1 like Back     alignment and domain information
 Score =  106 bits (266), Expect = 3e-32
 Identities = 40/71 (56%), Positives = 50/71 (70%)

Query: 7  KRKPPPKRKNIEPLDIQFNCPFCNHEKSCEVKMDKGRNSARIACRVCLEDFQTTINFLSE 66
          K++ PPK+K    L   F+CPFCNH+KS  VK+DK    A++ CRVC   FQT IN LSE
Sbjct: 1  KKRKPPKKKKKYKLPTVFDCPFCNHKKSVSVKIDKKTGIAKLHCRVCGLSFQTEINALSE 60

Query: 67 AIDVYNDWVDA 77
           IDVY+DW+DA
Sbjct: 61 PIDVYSDWIDA 71


This family of short proteins contains a putative zinc binding domain with four conserved cysteines. ELF1 has been identified as a transcription elongation factor in Saccharomyces cerevisiae. Length = 74

>gnl|CDD|227225 COG4888, COG4888, Uncharacterized Zn ribbon-containing protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|184886 PRK14892, PRK14892, putative transcription elongation factor Elf1; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 81
PF0512981 Elf1: Transcription elongation factor Elf1 like; I 100.0
KOG3214|consensus109 100.0
COG4888104 Uncharacterized Zn ribbon-containing protein [Gene 100.0
PRK1489299 putative transcription elongation factor Elf1; Pro 100.0
TIGR0365553 anti_R_Lar restriction alleviation protein, Lar fa 97.35
PF1435461 Lar_restr_allev: Restriction alleviation protein L 97.02
TIGR0120654 lysW lysine biosynthesis protein LysW. This very s 96.95
PRK0971064 lar restriction alleviation and modification prote 96.51
PF0827143 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 96.41
PF0109639 TFIIS_C: Transcription factor S-II (TFIIS); InterP 96.36
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 96.35
TIGR00244147 transcriptional regulator NrdR. Members of this al 96.13
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 96.05
COG1327156 Predicted transcriptional regulator, consists of a 96.04
PF1371937 zinc_ribbon_5: zinc-ribbon domain 95.94
smart0044040 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding mo 95.42
PF1371736 zinc_ribbon_4: zinc-ribbon domain 95.19
TIGR0028091 L37a ribosomal protein L37a. This model finds euka 95.13
PRK0397690 rpl37ae 50S ribosomal protein L37Ae; Reviewed 95.11
PF1425552 Cys_rich_CPXG: Cysteine-rich CPXCG 95.1
PTZ0025590 60S ribosomal protein L37a; Provisional 94.98
PRK00464154 nrdR transcriptional regulator NrdR; Validated 94.7
PF0178090 Ribosomal_L37ae: Ribosomal L37ae protein family; I 94.68
PF14353128 CpXC: CpXC protein 94.35
PF0985564 DUF2082: Nucleic-acid-binding protein containing Z 94.3
PF0879233 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: I 93.77
PHA0062659 hypothetical protein 93.69
smart0077837 Prim_Zn_Ribbon Zinc-binding domain of primase-heli 93.59
PF1276046 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; Int 93.28
PRK0967872 DNA-binding transcriptional regulator; Provisional 93.26
PF0215035 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; I 92.75
COG199789 RPL43A Ribosomal protein L37AE/L43A [Translation, 92.6
PF1324023 zinc_ribbon_2: zinc-ribbon domain 92.15
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 91.78
PRK1228657 rpmF 50S ribosomal protein L32; Reviewed 91.74
PRK0043250 30S ribosomal protein S27ae; Validated 91.47
PF0460647 Ogr_Delta: Ogr/Delta-like zinc finger; InterPro: I 91.45
PF1345341 zf-TFIIB: Transcription factor zinc-finger 91.17
PF06044 254 DRP: Dam-replacing family; InterPro: IPR010324 Dam 90.75
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 90.64
PF04216290 FdhE: Protein involved in formate dehydrogenase fo 90.61
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 90.3
TIGR0382989 YokU_near_AblA uncharacterized protein, YokU famil 90.07
COG3677129 Transposase and inactivated derivatives [DNA repli 89.62
PF04216290 FdhE: Protein involved in formate dehydrogenase fo 89.53
PRK03988138 translation initiation factor IF-2 subunit beta; V 89.32
TIGR00311133 aIF-2beta translation initiation factor aIF-2, bet 89.29
COG347868 Predicted nucleic-acid-binding protein containing 89.23
TIGR01384104 TFS_arch transcription factor S, archaeal. There h 89.11
PRK1313056 H/ACA RNA-protein complex component Nop10p; Review 88.77
PF1420555 Cys_rich_KTR: Cysteine-rich KTR 88.76
COG205167 RPS27A Ribosomal protein S27E [Translation, riboso 88.69
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 88.53
PF1480334 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C. 88.19
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 87.86
smart00531147 TFIIE Transcription initiation factor IIE. 87.84
smart0066152 RPOL9 RNA polymerase subunit 9. 87.53
PF0775424 DUF1610: Domain of unknown function (DUF1610); Int 87.4
PF01873125 eIF-5_eIF-2B: Domain found in IF2B/IF5; InterPro: 87.35
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 87.05
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 86.95
PF0827340 Prim_Zn_Ribbon: Zinc-binding domain of primase-hel 86.66
PF0728269 OrfB_Zn_ribbon: Putative transposase DNA-binding d 86.6
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 86.48
TIGR0383146 YgiT_finger YgiT-type zinc finger domain. This dom 86.46
smart00653110 eIF2B_5 domain present in translation initiation f 86.33
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 86.13
PF0518066 zf-DNL: DNL zinc finger; InterPro: IPR007853 Zinc 86.13
TIGR01385299 TFSII transcription elongation factor S-II. This m 85.98
COG1326 201 Uncharacterized archaeal Zn-finger protein [Genera 85.72
PF1324826 zf-ribbon_3: zinc-ribbon domain 85.62
PF0952671 DUF2387: Probable metal-binding protein (DUF2387); 85.54
TIGR0244359 conserved hypothetical metal-binding protein. Memb 85.38
PF09862113 DUF2089: Protein of unknown function (DUF2089); In 85.24
COG1594113 RPB9 DNA-directed RNA polymerase, subunit M/Transc 84.83
PRK12336201 translation initiation factor IF-2 subunit beta; P 84.8
PRK00423 310 tfb transcription initiation factor IIB; Reviewed 84.54
TIGR0103155 rpmF_bact ribosomal protein L32. This protein desc 83.42
KOG0478|consensus 804 83.37
COG1405 285 SUA7 Transcription initiation factor TFIIIB, Brf1 82.79
PRK03564309 formate dehydrogenase accessory protein FdhE; Prov 82.69
PHA02540 337 61 DNA primase; Provisional 82.62
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 82.58
PF03367161 zf-ZPR1: ZPR1 zinc-finger domain; InterPro: IPR004 82.56
PRK05978148 hypothetical protein; Provisional 82.34
PF05876 557 Terminase_GpA: Phage terminase large subunit (GpA) 82.32
COG1645131 Uncharacterized Zn-finger containing protein [Gene 81.77
PF0381136 Zn_Tnp_IS1: InsA N-terminal domain; InterPro: IPR0 81.76
COG0675364 Transposase and inactivated derivatives [DNA repli 81.68
TIGR01562305 FdhE formate dehydrogenase accessory protein FdhE. 81.14
KOG0402|consensus92 80.39
PRK0041559 rps27e 30S ribosomal protein S27e; Reviewed 80.36
>PF05129 Elf1: Transcription elongation factor Elf1 like; InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines Back     alignment and domain information
Probab=100.00  E-value=1.2e-43  Score=225.86  Aligned_cols=79  Identities=56%  Similarity=0.978  Sum_probs=45.8

Q ss_pred             CCCCcCCC-CCCCCCCCCCCCceecCCCCCCCCceEEEeecCCceEEEEcccccceeEeccCCCCchhhhhhhhhhhcCC
Q psy3498           2 GRRKSKRK-PPPKRKNIEPLDIQFNCPFCNHEKSCEVKMDKGRNSARIACRVCLEDFQTTINFLSEAIDVYNDWVDASVP   80 (81)
Q Consensus         2 GkRK~~~k-~~~kkk~~~~l~~~F~CPfC~~~~sV~v~i~k~~~~g~l~C~~C~~~~~~~i~~L~epIDVYs~WiD~c~~   80 (81)
                      ||||++++ +++++ ++++|||.|+||||||++||+|+||++.++|+|+|++||++|+++|++|+||||||++|||+|+|
T Consensus         1 GkRK~~~k~~~~kk-~~~~l~~~F~CPfC~~~~sV~v~idkk~~~~~~~C~~Cg~~~~~~i~~L~epiDVY~~wiD~~~~   79 (81)
T PF05129_consen    1 GKRKKKRKKPPKKK-KKPKLPKVFDCPFCNHEKSVSVKIDKKEGIGILSCRVCGESFQTKINPLSEPIDVYSEWIDACEE   79 (81)
T ss_dssp             --------------------SS----TTT--SS-EEEEEETTTTEEEEEESSS--EEEEE--SS--TTHHHHHHHHHHH-
T ss_pred             CCCcccCCCCCccC-cCCCCCceEcCCcCCCCCeEEEEEEccCCEEEEEecCCCCeEEEccCccCcccchhHHHHHHHHh
Confidence            89998888 44444 48999999999999999999999999999999999999999999999999999999999999987


Q ss_pred             C
Q psy3498          81 S   81 (81)
Q Consensus        81 ~   81 (81)
                      .
T Consensus        80 ~   80 (81)
T PF05129_consen   80 G   80 (81)
T ss_dssp             -
T ss_pred             c
Confidence            3



; PDB: 1WII_A.

>KOG3214|consensus Back     alignment and domain information
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only] Back     alignment and domain information
>PRK14892 putative transcription elongation factor Elf1; Provisional Back     alignment and domain information
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family Back     alignment and domain information
>PF14354 Lar_restr_allev: Restriction alleviation protein Lar Back     alignment and domain information
>TIGR01206 lysW lysine biosynthesis protein LysW Back     alignment and domain information
>PRK09710 lar restriction alleviation and modification protein; Reviewed Back     alignment and domain information
>PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF01096 TFIIS_C: Transcription factor S-II (TFIIS); InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>TIGR00244 transcriptional regulator NrdR Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription] Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>smart00440 ZnF_C2C2 C2C2 Zinc finger Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>TIGR00280 L37a ribosomal protein L37a Back     alignment and domain information
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed Back     alignment and domain information
>PF14255 Cys_rich_CPXG: Cysteine-rich CPXCG Back     alignment and domain information
>PTZ00255 60S ribosomal protein L37a; Provisional Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>PF01780 Ribosomal_L37ae: Ribosomal L37ae protein family; InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF14353 CpXC: CpXC protein Back     alignment and domain information
>PF09855 DUF2082: Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082); InterPro: IPR018652 This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins Back     alignment and domain information
>PF08792 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors [] Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase Back     alignment and domain information
>PF12760 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc Back     alignment and domain information
>PRK09678 DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PF02150 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; InterPro: IPR001529 DNA-directed RNA polymerases 2 Back     alignment and domain information
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed Back     alignment and domain information
>PRK00432 30S ribosomal protein S27ae; Validated Back     alignment and domain information
>PF04606 Ogr_Delta: Ogr/Delta-like zinc finger; InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr Back     alignment and domain information
>PF13453 zf-TFIIB: Transcription factor zinc-finger Back     alignment and domain information
>PF06044 DRP: Dam-replacing family; InterPro: IPR010324 Dam-replacing protein (DRP) is a restriction endonuclease that is flanked by pseudo-transposable small repeat elements Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex [] Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family Back     alignment and domain information
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex [] Back     alignment and domain information
>PRK03988 translation initiation factor IF-2 subunit beta; Validated Back     alignment and domain information
>TIGR00311 aIF-2beta translation initiation factor aIF-2, beta subunit, putative Back     alignment and domain information
>COG3478 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only] Back     alignment and domain information
>TIGR01384 TFS_arch transcription factor S, archaeal Back     alignment and domain information
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed Back     alignment and domain information
>PF14205 Cys_rich_KTR: Cysteine-rich KTR Back     alignment and domain information
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF14803 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>smart00661 RPOL9 RNA polymerase subunit 9 Back     alignment and domain information
>PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species Back     alignment and domain information
>PF01873 eIF-5_eIF-2B: Domain found in IF2B/IF5; InterPro: IPR002735 The beta subunit of archaeal and eukaryotic translation initiation factor 2 (IF2beta) and the N-terminal domain of translation initiation factor 5 (IF5) show significant sequence homology [] Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PF08273 Prim_Zn_Ribbon: Zinc-binding domain of primase-helicase; InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4 Back     alignment and domain information
>PF07282 OrfB_Zn_ribbon: Putative transposase DNA-binding domain; InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>TIGR03831 YgiT_finger YgiT-type zinc finger domain Back     alignment and domain information
>smart00653 eIF2B_5 domain present in translation initiation factor eIF2B and eIF5 Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05180 zf-DNL: DNL zinc finger; InterPro: IPR007853 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>TIGR01385 TFSII transcription elongation factor S-II Back     alignment and domain information
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>PF09526 DUF2387: Probable metal-binding protein (DUF2387); InterPro: IPR012658 Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N terminus and a probable metal-binding motif CPXCX(18)CXXC Back     alignment and domain information
>TIGR02443 conserved hypothetical metal-binding protein Back     alignment and domain information
>PF09862 DUF2089: Protein of unknown function (DUF2089); InterPro: IPR018658 This family consists of various hypothetical prokaryotic proteins Back     alignment and domain information
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription] Back     alignment and domain information
>PRK12336 translation initiation factor IF-2 subunit beta; Provisional Back     alignment and domain information
>PRK00423 tfb transcription initiation factor IIB; Reviewed Back     alignment and domain information
>TIGR01031 rpmF_bact ribosomal protein L32 Back     alignment and domain information
>KOG0478|consensus Back     alignment and domain information
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription] Back     alignment and domain information
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional Back     alignment and domain information
>PHA02540 61 DNA primase; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF03367 zf-ZPR1: ZPR1 zinc-finger domain; InterPro: IPR004457 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK05978 hypothetical protein; Provisional Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] Back     alignment and domain information
>PF03811 Zn_Tnp_IS1: InsA N-terminal domain; InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases Back     alignment and domain information
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE Back     alignment and domain information
>KOG0402|consensus Back     alignment and domain information
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query81
1wii_A85 Solution Structure Of Rsgi Ruh-025, A Duf701 Domain 3e-21
>pdb|1WII|A Chain A, Solution Structure Of Rsgi Ruh-025, A Duf701 Domain From Mouse Cdna Length = 85 Back     alignment and structure

Iteration: 1

Score = 96.7 bits (239), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 39/58 (67%), Positives = 49/58 (84%) Query: 20 LDIQFNCPFCNHEKSCEVKMDKGRNSARIACRVCLEDFQTTINFLSEAIDVYNDWVDA 77 L+ QF CPFCNHEKSC+VKMD+ RN+ I+C VCLE+FQT I +LSE +DVY+DW+DA Sbjct: 20 LETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDA 77

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query81
1wii_A85 Hypothetical UPF0222 protein MGC4549; domain of un 3e-32
>1wii_A Hypothetical UPF0222 protein MGC4549; domain of unknown function, zinc finger, metal-binding protein, structural genomics; NMR {Mus musculus} SCOP: g.41.3.4 Length = 85 Back     alignment and structure
 Score =  106 bits (265), Expect = 3e-32
 Identities = 47/75 (62%), Positives = 58/75 (77%)

Query: 3  RRKSKRKPPPKRKNIEPLDIQFNCPFCNHEKSCEVKMDKGRNSARIACRVCLEDFQTTIN 62
             S RKPPPK+K    L+ QF CPFCNHEKSC+VKMD+ RN+  I+C VCLE+FQT I 
Sbjct: 3  SGSSGRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPIT 62

Query: 63 FLSEAIDVYNDWVDA 77
          +LSE +DVY+DW+DA
Sbjct: 63 YLSEPVDVYSDWIDA 77


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query81
1wii_A85 Hypothetical UPF0222 protein MGC4549; domain of un 100.0
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 96.14
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 96.08
3j21_i83 50S ribosomal protein L37AE; archaea, archaeal, KI 95.55
3iz5_m92 60S ribosomal protein L43 (L37AE); eukaryotic ribo 95.37
4a17_Y103 RPL37A, 60S ribosomal protein L32; eukaryotic ribo 95.19
3izc_m92 60S ribosomal protein RPL43 (L37AE); eukaryotic ri 95.19
3jyw_972 60S ribosomal protein L43; eukaryotic ribosome, RA 95.15
1dl6_A58 Transcription factor II B (TFIIB); zinc ribbon, ge 95.14
1ffk_W73 Ribosomal protein L37AE; ribosome assembly, RNA-RN 94.82
1k81_A36 EIF-2-beta, probable translation initiation factor 94.1
1qyp_A57 RNA polymerase II; transcription, RPB9, Zn ribbon, 93.86
3cc2_Z116 50S ribosomal protein L37AE, 50S ribosomal protein 93.82
1tfi_A50 Transcriptional elongation factor SII; transcripti 93.09
3ga8_A78 HTH-type transcriptional regulator MQSA (YGIT/B30; 92.7
2js4_A70 UPF0434 protein BB2007; NESG, northeast structural 92.03
1twf_I122 B12.6, DNA-directed RNA polymerase II 14.2 kDa pol 91.9
2jr6_A68 UPF0434 protein NMA0874; solution, structural geno 90.68
2hf1_A68 Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A 90.18
2pk7_A69 Uncharacterized protein; NESG, PLR1, putative tetr 89.8
3j20_Y50 30S ribosomal protein S27AE; archaea, archaeal, KI 89.71
2e9h_A157 EIF-5, eukaryotic translation initiation factor 5; 89.34
3o9x_A133 Uncharacterized HTH-type transcriptional regulato; 88.88
2fiy_A309 Protein FDHE homolog; FDHE protein, structural gen 88.65
1twf_I122 B12.6, DNA-directed RNA polymerase II 14.2 kDa pol 88.45
2fiy_A309 Protein FDHE homolog; FDHE protein, structural gen 88.44
2k4x_A55 30S ribosomal protein S27AE; metal-binding, ribonu 88.01
1pqv_S309 STP-alpha, transcription elongation factor S-II, D 87.77
4esj_A 257 Type-2 restriction enzyme DPNI; restriction endonu 87.56
2apo_B60 Ribosome biogenesis protein NOP10; protein-protein 87.04
3h0g_I113 DNA-directed RNA polymerases I, II, and III subuni 86.84
2kpi_A56 Uncharacterized protein SCO3027; zinc finger, PSI- 86.8
2jny_A67 Uncharacterized BCR; structure, CGR1, NESG, struct 85.56
1nui_A 255 DNA primase/helicase; zinc-biding domain, toprim f 85.07
2aus_D60 NOP10, ribosome biogenesis protein NOP10; isomeras 84.75
3h0g_I113 DNA-directed RNA polymerases I, II, and III subuni 83.93
2g2k_A170 EIF-5, eukaryotic translation initiation factor 5; 83.45
3po3_S178 Transcription elongation factor S-II; RNA polymera 82.07
4bbr_M 345 Transcription initiation factor IIB; RNA polymeras 82.07
3k7a_M 345 Transcription initiation factor IIB; RNA polymeras 81.94
2xzm_681 RPS27E; ribosome, translation; 3.93A {Tetrahymena 80.4
3k1f_M 197 Transcription initiation factor IIB; RNA polymeras 80.14
>1wii_A Hypothetical UPF0222 protein MGC4549; domain of unknown function, zinc finger, metal-binding protein, structural genomics; NMR {Mus musculus} SCOP: g.41.3.4 Back     alignment and structure
Probab=100.00  E-value=2.5e-45  Score=235.21  Aligned_cols=80  Identities=59%  Similarity=1.134  Sum_probs=72.0

Q ss_pred             CCCCcCCCCCCCCCCCCCCCceecCCCCCCCCceEEEeecCCceEEEEcccccceeEeccCCCCchhhhhhhhhhhcCCC
Q psy3498           2 GRRKSKRKPPPKRKNIEPLDIQFNCPFCNHEKSCEVKMDKGRNSARIACRVCLEDFQTTINFLSEAIDVYNDWVDASVPS   81 (81)
Q Consensus         2 GkRK~~~k~~~kkk~~~~l~~~F~CPfC~~~~sV~v~i~k~~~~g~l~C~~C~~~~~~~i~~L~epIDVYs~WiD~c~~~   81 (81)
                      ||||+++++++|++.+++|||.|+||||||++||+|+||++.++|.|+|++||++||++||+|+|||||||+|||+|+|.
T Consensus         2 ~rRKs~~k~~~k~k~~~~L~t~F~CPfCnh~~sV~vkidk~~~~g~l~C~~Cg~~~~~~i~~L~epiDVYs~WiDac~~~   81 (85)
T 1wii_A            2 SSGSSGRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACESG   81 (85)
T ss_dssp             CCCCCCCCCCCCCCCCCCCSSCCCCTTTCCSSCEEEEEETTTTEEEEEESSSCCEEEEECCSSCCTTHHHHHHHHHHHHC
T ss_pred             CCccccCCCCCCcccCCCCCCeEcCCCCCCCCeEEEEEEccCCEEEEEcccCCCeEEeccCccCcchhhHHHHHHHHHHH
Confidence            44556667766665358999999999999999999999999999999999999999999999999999999999999873



>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Back     alignment and structure
>3j21_i 50S ribosomal protein L37AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>4a17_Y RPL37A, 60S ribosomal protein L32; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_Y 4a1c_Y 4a1e_Y Back     alignment and structure
>3jyw_9 60S ribosomal protein L43; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Back     alignment and structure
>1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A Back     alignment and structure
>1ffk_W Ribosomal protein L37AE; ribosome assembly, RNA-RNA, protein-RNA, protein-protein; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1jj2_Y 1k73_1* 1k8a_1* 1k9m_1* 1kc8_1* 1kd1_1* 1kqs_Y* 1m1k_1* 1m90_1* 1n8r_1* 1nji_1* 1q7y_1* 1q81_1* 1q82_1* 1q86_1* 1qvf_Y 1qvg_Y 1w2b_Y 3cxc_Y* Back     alignment and structure
>1k81_A EIF-2-beta, probable translation initiation factor 2 beta subunit; zinc ribbon; NMR {Methanocaldococcus jannaschii} SCOP: g.59.1.1 Back     alignment and structure
>1qyp_A RNA polymerase II; transcription, RPB9, Zn ribbon, hyperthermophilic, extremophIle; NMR {Thermococcus celer} SCOP: g.41.3.1 Back     alignment and structure
>3cc2_Z 50S ribosomal protein L37AE, 50S ribosomal protein L32E; genomic sequnece for R-proteins, ribonucleoprotein, ribosoma protein, RNA-binding; HET: 1MA OMU OMG UR3 PSU; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 3cc4_Z* 3cc7_Z* 3cce_Z* 3ccj_Z* 3ccl_Z* 3ccm_Z* 3ccq_Z* 3ccr_Z* 3ccs_Z* 3ccu_Z* 3ccv_Z* 3cd6_Z* 3cma_Z* 3cme_Z* 3i55_Z* 3i56_Z* 3cpw_Y* 4adx_Z Back     alignment and structure
>1tfi_A Transcriptional elongation factor SII; transcription regulation; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>3ga8_A HTH-type transcriptional regulator MQSA (YGIT/B30; helix-turn-helix, Zn-binding protein, DNA-binding, transcrip transcription regulation; HET: PE4; 1.70A {Escherichia coli k-12} PDB: 3hi2_A Back     alignment and structure
>2js4_A UPF0434 protein BB2007; NESG, northeast structural genomics consortium, beta, PSI-2, protein structure initiative; NMR {Bordetella bronchiseptica RB50} Back     alignment and structure
>1twf_I B12.6, DNA-directed RNA polymerase II 14.2 kDa polypepti; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.3.1 g.41.3.1 PDB: 1i3q_I 1i6h_I 1k83_I* 1nik_I 1nt9_I 1pqv_I 1r5u_I 1r9s_I* 1r9t_I* 1sfo_I* 1twa_I* 1twc_I* 1i50_I* 1twg_I* 1twh_I* 1wcm_I 1y1v_I 1y1w_I 1y1y_I 1y77_I* ... Back     alignment and structure
>2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis} Back     alignment and structure
>2hf1_A Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthes structural genomics, PSI-2, protein structure initiative; 1.90A {Chromobacterium violaceum} SCOP: b.171.1.1 Back     alignment and structure
>2pk7_A Uncharacterized protein; NESG, PLR1, putative tetraacyldisaccharide-1-P 4-kinase, Q4K structural genomics, PSI-2; 2.20A {Pseudomonas fluorescens} SCOP: b.171.1.1 Back     alignment and structure
>3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>2e9h_A EIF-5, eukaryotic translation initiation factor 5; zinc binding, C4 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* 2kz8_A Back     alignment and structure
>2fiy_A Protein FDHE homolog; FDHE protein, structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: e.59.1.1 Back     alignment and structure
>1twf_I B12.6, DNA-directed RNA polymerase II 14.2 kDa polypepti; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.3.1 g.41.3.1 PDB: 1i3q_I 1i6h_I 1k83_I* 1nik_I 1nt9_I 1pqv_I 1r5u_I 1r9s_I* 1r9t_I* 1sfo_I* 1twa_I* 1twc_I* 1i50_I* 1twg_I* 1twh_I* 1wcm_I 1y1v_I 1y1w_I 1y1y_I 1y77_I* ... Back     alignment and structure
>2fiy_A Protein FDHE homolog; FDHE protein, structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: e.59.1.1 Back     alignment and structure
>2k4x_A 30S ribosomal protein S27AE; metal-binding, ribonucleoprotein, zinc, zinc-finger, structural genomics, PSI-2; NMR {Thermoplasma acidophilum} SCOP: g.41.8.8 Back     alignment and structure
>1pqv_S STP-alpha, transcription elongation factor S-II, DNA; mRNA cleavage, proofreading, BACKTRACKING, gene expression, multiprotein complex; 3.80A {Saccharomyces cerevisiae} SCOP: i.8.1.1 PDB: 1eo0_A Back     alignment and structure
>4esj_A Type-2 restriction enzyme DPNI; restriction endonuclease-DNA complex, type IIM, type IIE, RE enzyme, DPNI; HET: DNA 6MA; 2.05A {Streptococcus pneumoniae} Back     alignment and structure
>2apo_B Ribosome biogenesis protein NOP10; protein-protein complex, box H/ACA, snoRNP, pseudouridine synthase, RNA modification; 1.95A {Methanocaldococcus jannaschii} SCOP: g.41.16.1 PDB: 2aqc_A Back     alignment and structure
>3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>2kpi_A Uncharacterized protein SCO3027; zinc finger, PSI-2, NESG, all beta, structural genomics, protein structure initiative; NMR {Streptomyces coelicolor} Back     alignment and structure
>2jny_A Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: b.171.1.1 Back     alignment and structure
>1nui_A DNA primase/helicase; zinc-biding domain, toprim fold, DNA replication, DNA-direct polymerase, primosome, late protein, ATP-binding; HET: DNA; 2.90A {Enterobacteria phage T7} SCOP: e.13.1.2 g.41.3.2 Back     alignment and structure
>2aus_D NOP10, ribosome biogenesis protein NOP10; isomerase, structural protein, isomerase-structural protein; 2.10A {Pyrococcus abyssi} PDB: 3lwr_B 3lwo_B* 3lwq_B* 3lwp_B 3lwv_B 3hax_C* 2hvy_C* 3hay_C* 2ey4_E 3hjw_B* 2rfk_B* 3hjy_B 3mqk_B Back     alignment and structure
>3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>2g2k_A EIF-5, eukaryotic translation initiation factor 5; EIF125 fold; NMR {Homo sapiens} Back     alignment and structure
>3po3_S Transcription elongation factor S-II; RNA polymerase II, mRNA, transcription, arrest, BACKTRACKING cleavage, transferase-DNA-RNA complex; HET: DNA BRU EPE PGE; 3.30A {Saccharomyces cerevisiae} PDB: 1y1v_S 1y1y_S 3gtm_S* 1enw_A Back     alignment and structure
>4bbr_M Transcription initiation factor IIB; RNA polymerase, TFIIB; 3.40A {Saccharomyces cerevisiae} PDB: 3k7a_M 4bbs_M Back     alignment and structure
>3k7a_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, DNA-binding, DNA- directed RNA polymerase, isopeptide bond, magnesium; 3.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_6 RPS27E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_6 Back     alignment and structure
>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 81
d1wiia_85 g.41.3.4 (A:) Hypothetical UPF0222 protein MGC4549 1e-37
>d1wiia_ g.41.3.4 (A:) Hypothetical UPF0222 protein MGC4549 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure

class: Small proteins
fold: Rubredoxin-like
superfamily: Zinc beta-ribbon
family: Putative zinc binding domain
domain: Hypothetical UPF0222 protein MGC4549
species: Mouse (Mus musculus) [TaxId: 10090]
 Score =  118 bits (298), Expect = 1e-37
 Identities = 47/75 (62%), Positives = 58/75 (77%)

Query: 3  RRKSKRKPPPKRKNIEPLDIQFNCPFCNHEKSCEVKMDKGRNSARIACRVCLEDFQTTIN 62
             S RKPPPK+K    L+ QF CPFCNHEKSC+VKMD+ RN+  I+C VCLE+FQT I 
Sbjct: 3  SGSSGRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPIT 62

Query: 63 FLSEAIDVYNDWVDA 77
          +LSE +DVY+DW+DA
Sbjct: 63 YLSEPVDVYSDWIDA 77


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query81
d1wiia_85 Hypothetical UPF0222 protein MGC4549 {Mouse (Mus m 100.0
d1vqoz173 Ribosomal protein L37ae {Archaeon Haloarcula maris 95.53
d1jj2y_73 Ribosomal protein L37ae {Archaeon Haloarcula maris 95.43
d1pfta_50 Transcription initiation factor TFIIB, N-terminal 95.07
d1twfi272 RBP9 subunit of RNA polymerase II {Baker's yeast ( 94.32
d1qypa_57 RBP9 subunit of RNA polymerase II {Archaeon Thermo 94.04
d1tfia_50 Transcriptional factor SII, C-terminal domain {Hum 93.52
d1dl6a_58 Transcription initiation factor TFIIB, N-terminal 92.54
d1k81a_36 Zinc-binding domain of translation initiation fact 90.46
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 87.63
d1neea237 Zinc-binding domain of translation initiation fact 87.56
d2fiya1290 FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId 86.1
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 85.12
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 83.5
d6rxna_45 Rubredoxin {Desulfovibrio desulfuricans, strain 27 82.73
d2pk7a159 Uncharacterized protein PFL1779 {Pseudomonas fluor 80.89
d2hf1a159 Hypothetical protein CV3345 {Chromobacterium viola 80.75
d2jnya159 Uncharacterized protein Cgl1405/cg1592 {Corynebact 80.41
>d1wiia_ g.41.3.4 (A:) Hypothetical UPF0222 protein MGC4549 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: Rubredoxin-like
superfamily: Zinc beta-ribbon
family: Putative zinc binding domain
domain: Hypothetical UPF0222 protein MGC4549
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=3.3e-45  Score=233.40  Aligned_cols=80  Identities=60%  Similarity=1.158  Sum_probs=73.5

Q ss_pred             CCCCc-CCCCCCCCCCCCCCCceecCCCCCCCCceEEEeecCCceEEEEcccccceeEeccCCCCchhhhhhhhhhhcCC
Q psy3498           2 GRRKS-KRKPPPKRKNIEPLDIQFNCPFCNHEKSCEVKMDKGRNSARIACRVCLEDFQTTINFLSEAIDVYNDWVDASVP   80 (81)
Q Consensus         2 GkRK~-~~k~~~kkk~~~~l~~~F~CPfC~~~~sV~v~i~k~~~~g~l~C~~C~~~~~~~i~~L~epIDVYs~WiD~c~~   80 (81)
                      |+||+ +|+++++++.+++|||.|+||||||++||+|+||++.++|.|+|++||++||++||+|+|||||||+|||+|||
T Consensus         1 g~~~~s~rk~~pkkk~~~kL~t~F~CPfCnh~~sV~vk~dkk~~~g~l~C~vCg~~~~~~i~~L~epiDVYs~WiDace~   80 (85)
T d1wiia_           1 GSSGSSGRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACES   80 (85)
T ss_dssp             CCCCCCCCCCCCCCCCCCCCSSCCCCTTTCCSSCEEEEEETTTTEEEEEESSSCCEEEEECCSSCCTTHHHHHHHHHHHH
T ss_pred             CCCcccCCCCCCCccccCCCCceEcCCCCCCCCeEEEEEEecCCEEEEEEecCCCeEEecccccCccHhHHHHHHHHHHH
Confidence            77764 46666677667999999999999999999999999999999999999999999999999999999999999997


Q ss_pred             C
Q psy3498          81 S   81 (81)
Q Consensus        81 ~   81 (81)
                      .
T Consensus        81 ~   81 (85)
T d1wiia_          81 G   81 (85)
T ss_dssp             C
T ss_pred             h
Confidence            4



>d1vqoz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1jj2y_ g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1twfi2 g.41.3.1 (I:50-121) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qypa_ g.41.3.1 (A:) RBP9 subunit of RNA polymerase II {Archaeon Thermococcus celer [TaxId: 2264]} Back     information, alignment and structure
>d1tfia_ g.41.3.1 (A:) Transcriptional factor SII, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k81a_ g.59.1.1 (A:) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1neea2 g.59.1.1 (A:99-135) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2fiya1 e.59.1.1 (A:19-308) FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} Back     information, alignment and structure
>d2pk7a1 b.171.1.1 (A:3-61) Uncharacterized protein PFL1779 {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2hf1a1 b.171.1.1 (A:2-60) Hypothetical protein CV3345 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d2jnya1 b.171.1.1 (A:1-59) Uncharacterized protein Cgl1405/cg1592 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure