Psyllid ID: psy3615


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-
MAAGTEGLKSPSQSPISLSSRGVLFQQDGDSGSLFHWDSNVQNLVLGSFFWLHWSTQIPGGVLARSLGTKVVFGVSNLAMFLISFALPAAAYWDYKAMAGLRIVQGVIGGLAWPSMHHLVAHWIPPTERSQFITSYLGSSFGVALSYPLCGVVIDTLGWEAAFYVTGALGVVWWVVWMIVVYDTPDQHPRVSAEEKEYIQQALGNTVSAKK
ccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHcHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccccc
ccccccccccccEEEEEcccccccccccccccccccccHHHccEEHHHHHHHEEEEcccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccccc
maagteglkspsqspislssrgvlfqqdgdsgslfhwdsnvqnlVLGSFFWlhwstqipggvlarslgtkvVFGVSNLAMFLISFALPAAAYWDYKAMAGLRIVQGVIGGLAWPSMHHLvahwipptersqFITSYLGSSFGVALSYPLCGVVIDTLGWEAAFYVTGALGVVWWVVWMIVVydtpdqhprvsaEEKEYIQQALGNTVSAKK
maagteglkspsqspiSLSSRGVLFQQDGDSGSLFHWDSNVQNLVLGSFFWLHWSTQIPGGVLARSLGTKVVFGVSNLAMFLISFALPAAAYWDYKAMAGLRIVQGVIGGLAWPSMHHLVAHWIPPTERSQFITSYLGSSFGVALSYPLCGVVIDTLGWEAAFYVTGALGVVWWVVWMIVVYDTPDQHPRVSAEEKEYIQQAlgntvsakk
MAAGTEGLKspsqspislssRGVLFQQDGDSGSLFHWDSNVQNLVLGSFFWLHWSTQIPGGVLARSLGTKVVFGVSNLAMFLISFALPAAAYWDYKAMAGLRIVQGVIGGLAWPSMHHLVAHWIPPTERSQFITSYLGSSFGVALSYPLCGVVIDTLGWEAAFYVTGALGvvwwvvwmivvYDTPDQHPRVSAEEKEYIQQALGNTVSAKK
******************************SGSLFHWDSNVQNLVLGSFFWLHWSTQIPGGVLARSLGTKVVFGVSNLAMFLISFALPAAAYWDYKAMAGLRIVQGVIGGLAWPSMHHLVAHWIPPTERSQFITSYLGSSFGVALSYPLCGVVIDTLGWEAAFYVTGALGVVWWVVWMIVVYDT***************************
*************SPISLS************GSLFHWDSNVQNLVLGSFFWLHWSTQIPGGVLARSLGTKVVFGVSNLAMFLISFALPAAAYWDYKAMAGLRIVQGVIGGLAWPSMHHLVAHWIPPTERSQFITSYLGSSFGVALSYPLCGVVIDTLGWEAAFYVTGALGVVWWVVWMIVVYDTPDQHPRVSAEEKE**************
*****************LSSRGVLFQQDGDSGSLFHWDSNVQNLVLGSFFWLHWSTQIPGGVLARSLGTKVVFGVSNLAMFLISFALPAAAYWDYKAMAGLRIVQGVIGGLAWPSMHHLVAHWIPPTERSQFITSYLGSSFGVALSYPLCGVVIDTLGWEAAFYVTGALGVVWWVVWMIVVYDTPDQHPRVSAEEKEYIQQALGNTVSAKK
****TEGLKSPSQSPISLSSRGVLFQQDGDSGSLFHWDSNVQNLVLGSFFWLHWSTQIPGGVLARSLGTKVVFGVSNLAMFLISFALPAAAYWDYKAMAGLRIVQGVIGGLAWPSMHHLVAHWIPPTERSQFITSYLGSSFGVALSYPLCGVVIDTLGWEAAFYVTGALGVVWWVVWMIVVYDTPDQHPRVSAEEKEYIQQALGN******
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAGTEGLKSPSQSPISLSSRGVLFQQDGDSGSLFHWDSNVQNLVLGSFFWLHWSTQIPGGVLARSLGTKVVFGVSNLAMFLISFALPAAAYWDYKAMAGLRIVQGVIGGLAWPSMHHLVAHWIPPTERSQFITSYLGSSFGVALSYPLCGVVIDTLGWEAAFYVTGALGVVWWVVWMIVVYDTPDQHPRVSAEEKEYIQQALGNTVSAKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query211 2.2.26 [Sep-21-2011]
Q9JI12 582 Vesicular glutamate trans yes N/A 0.824 0.298 0.371 4e-35
Q8BLE7 582 Vesicular glutamate trans yes N/A 0.824 0.298 0.371 5e-35
Q9P2U8 582 Vesicular glutamate trans yes N/A 0.824 0.298 0.371 5e-35
A6QLI1 582 Vesicular glutamate trans yes N/A 0.824 0.298 0.365 7e-35
Q5W8I8 584 Vesicular glutamate trans yes N/A 0.900 0.325 0.346 1e-34
Q6INC8 576 Vesicular glutamate trans N/A N/A 0.815 0.298 0.364 1e-34
A4FV52 560 Vesicular glutamate trans no N/A 0.815 0.307 0.375 3e-34
Q3TXX4 560 Vesicular glutamate trans no N/A 0.815 0.307 0.375 4e-34
Q1L8X9 590 Vesicular glutamate trans no N/A 0.810 0.289 0.360 4e-34
Q62634 560 Vesicular glutamate trans no N/A 0.815 0.307 0.375 4e-34
>sp|Q9JI12|VGLU2_RAT Vesicular glutamate transporter 2 OS=Rattus norvegicus GN=Slc17a6 PE=1 SV=1 Back     alignment and function desciption
 Score =  147 bits (371), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 111/175 (63%), Gaps = 1/175 (0%)

Query: 35  FHWDSNVQNLVLGSFFWLHWSTQIPGGVLARSLGTKVVFGVSNLAMFLISFALPAAAYWD 94
           F+WD     ++ GSFFW +  TQIPGG +A  L    VFG + L    ++  +P+AA   
Sbjct: 117 FNWDPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVH 176

Query: 95  YKAMAGLRIVQGVIGGLAWPSMHHLVAHWIPPTERSQF-ITSYLGSSFGVALSYPLCGVV 153
           Y  +  +RI+QG++ G+ +P+ H + + W PP ERS+   TS+ GS  G  ++ PL G++
Sbjct: 177 YGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGIL 236

Query: 154 IDTLGWEAAFYVTGALGVVWWVVWMIVVYDTPDQHPRVSAEEKEYIQQALGNTVS 208
           +   GW + FYV G+ G+VW++ W++V Y++P +HP ++ EE+ YI++++G + +
Sbjct: 237 VQYTGWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESAN 291




Mediates the uptake of glutamate into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells. May also play a role in the endocrine glutamatergic system of other tissues such as pineal gland and pancreas. May also mediate the transport of inorganic phosphate.
Rattus norvegicus (taxid: 10116)
>sp|Q8BLE7|VGLU2_MOUSE Vesicular glutamate transporter 2 OS=Mus musculus GN=Slc17a6 PE=1 SV=1 Back     alignment and function description
>sp|Q9P2U8|VGLU2_HUMAN Vesicular glutamate transporter 2 OS=Homo sapiens GN=SLC17A6 PE=1 SV=1 Back     alignment and function description
>sp|A6QLI1|VGLU2_BOVIN Vesicular glutamate transporter 2 OS=Bos taurus GN=SLC17A6 PE=2 SV=1 Back     alignment and function description
>sp|Q5W8I8|VGL2A_DANRE Vesicular glutamate transporter 2.1 OS=Danio rerio GN=slc17a6b PE=2 SV=2 Back     alignment and function description
>sp|Q6INC8|VGLU1_XENLA Vesicular glutamate transporter 1 OS=Xenopus laevis GN=slc17a7 PE=2 SV=1 Back     alignment and function description
>sp|A4FV52|VGLU1_BOVIN Vesicular glutamate transporter 1 OS=Bos taurus GN=SLC17A7 PE=2 SV=1 Back     alignment and function description
>sp|Q3TXX4|VGLU1_MOUSE Vesicular glutamate transporter 1 OS=Mus musculus GN=Slc17a7 PE=2 SV=2 Back     alignment and function description
>sp|Q1L8X9|VGLU3_DANRE Vesicular glutamate transporter 3 OS=Danio rerio GN=slc17a8 PE=3 SV=2 Back     alignment and function description
>sp|Q62634|VGLU1_RAT Vesicular glutamate transporter 1 OS=Rattus norvegicus GN=Slc17a7 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query211
193697623 474 PREDICTED: sialin-like [Acyrthosiphon pi 0.838 0.373 0.525 7e-54
118789879 490 AGAP011426-PA [Anopheles gambiae str. PE 0.829 0.357 0.531 9e-54
170048007 540 sodium-dependent phosphate transporter [ 0.857 0.335 0.521 2e-53
312378098 571 hypothetical protein AND_10427 [Anophele 0.824 0.304 0.513 3e-53
193788546 533 Na[+]-dependent inorganic phosphate cotr 0.824 0.326 0.505 3e-53
157136240 517 sodium-dependent phosphate transporter [ 0.838 0.342 0.531 1e-52
91094583 486 PREDICTED: similar to Na[+]-dependent in 0.962 0.417 0.473 1e-52
328780736 455 PREDICTED: vesicular glutamate transport 0.829 0.384 0.522 4e-52
350423826 518 PREDICTED: LOW QUALITY PROTEIN: vesicula 0.966 0.393 0.439 8e-52
340727684 522 PREDICTED: vesicular glutamate transport 0.928 0.375 0.452 2e-51
>gi|193697623|ref|XP_001943734.1| PREDICTED: sialin-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  215 bits (548), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 93/177 (52%), Positives = 131/177 (74%)

Query: 35  FHWDSNVQNLVLGSFFWLHWSTQIPGGVLARSLGTKVVFGVSNLAMFLISFALPAAAYWD 94
           F W  + +  VLGSF+WLHW+ Q+PGG+LAR  G K +FG+SNL MF++S  +P  A WD
Sbjct: 67  FEWKDSERASVLGSFYWLHWALQLPGGLLARQFGAKRIFGLSNLFMFVMSLLMPVLARWD 126

Query: 95  YKAMAGLRIVQGVIGGLAWPSMHHLVAHWIPPTERSQFITSYLGSSFGVALSYPLCGVVI 154
            K +   R++QG +GG+AWPS+HHL AHW+PP +RS+FIT+YLGSS GVA+++PLCG ++
Sbjct: 127 IKGLIVARVLQGFVGGMAWPSVHHLTAHWVPPNKRSKFITAYLGSSIGVAITFPLCGFIL 186

Query: 155 DTLGWEAAFYVTGALGVVWWVVWMIVVYDTPDQHPRVSAEEKEYIQQALGNTVSAKK 211
           +  GW   FYVTGA+G++W++ W + VYDTP QHP +S  E  +I  +L + VS+ K
Sbjct: 187 ERWGWPYVFYVTGAIGMMWFLAWWLFVYDTPSQHPYISEVELVHITSSLTDVVSSTK 243




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|118789879|ref|XP_317877.3| AGAP011426-PA [Anopheles gambiae str. PEST] gi|116122784|gb|EAA13079.4| AGAP011426-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|170048007|ref|XP_001851492.1| sodium-dependent phosphate transporter [Culex quinquefasciatus] gi|167870243|gb|EDS33626.1| sodium-dependent phosphate transporter [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|312378098|gb|EFR24761.1| hypothetical protein AND_10427 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|193788546|ref|NP_001123317.1| Na[+]-dependent inorganic phosphate cotransporter [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|157136240|ref|XP_001656790.1| sodium-dependent phosphate transporter [Aedes aegypti] gi|108881058|gb|EAT45283.1| AAEL003426-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|91094583|ref|XP_969878.1| PREDICTED: similar to Na[+]-dependent inorganic phosphate cotransporter CG10207-PA [Tribolium castaneum] gi|270016403|gb|EFA12849.1| hypothetical protein TcasGA2_TC010266 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328780736|ref|XP_001121312.2| PREDICTED: vesicular glutamate transporter 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|350423826|ref|XP_003493604.1| PREDICTED: LOW QUALITY PROTEIN: vesicular glutamate transporter 2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340727684|ref|XP_003402169.1| PREDICTED: vesicular glutamate transporter 2-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query211
FB|FBgn0016684 524 NaPi-T "Na[+]-dependent inorga 0.838 0.337 0.474 6.2e-46
FB|FBgn0031645 493 CG3036 [Drosophila melanogaste 0.838 0.359 0.429 2.6e-38
FB|FBgn0058263 505 MFS17 "Major Facilitator Super 0.758 0.316 0.437 3.1e-35
FB|FBgn0034490 465 CG9864 [Drosophila melanogaste 0.862 0.391 0.379 1.3e-34
FB|FBgn0030452 559 MFS10 "Major Facilitator Super 0.824 0.311 0.406 2.3e-33
ZFIN|ZDB-GENE-030616-554 584 slc17a6b "solute carrier famil 0.824 0.297 0.367 3.3e-30
UNIPROTKB|A6QLI1 582 SLC17A6 "Vesicular glutamate t 0.824 0.298 0.348 4.1e-30
UNIPROTKB|Q9P2U8 582 SLC17A6 "Vesicular glutamate t 0.824 0.298 0.348 4.1e-30
UNIPROTKB|F1SFZ2 582 SLC17A6 "Uncharacterized prote 0.824 0.298 0.348 4.1e-30
MGI|MGI:2156052 582 Slc17a6 "solute carrier family 0.824 0.298 0.348 4.1e-30
FB|FBgn0016684 NaPi-T "Na[+]-dependent inorganic phosphate cotransporter" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 482 (174.7 bits), Expect = 6.2e-46, P = 6.2e-46
 Identities = 84/177 (47%), Positives = 115/177 (64%)

Query:    35 FHWDSNVQNLVLGSFFWLHWSTQIPGGVLARSLGTKVVFGVSNLAMFLISFALPAAAYWD 94
             FHW+   Q  +LGSFFW HW+ QIPGG+LA   GTK+VFG SN       F +P  +YW 
Sbjct:    83 FHWNEKQQGALLGSFFWAHWTLQIPGGILATKYGTKLVFGWSNGIGVFCCFLIPIVSYWS 142

Query:    95 YKAMAGLRIVQGVIGGLAWPSMHHLVAHWIPPTERSQFITSYLGSSFGVALSYPLCGVVI 154
             Y  +  LR+ QG I GLAWPSMH L A WIPP ERS+F+++YLGSS GVAL YP+ G +I
Sbjct:   143 YTGLIILRVFQGWITGLAWPSMHVLTAKWIPPNERSKFVSAYLGSSVGVALFYPIFGYII 202

Query:   155 DTLGWEAAFYVTGALGXXXXXXXXXXXYDTPDQHPRVSAEEKEYIQQALGNTVSAKK 211
             D   WE  +Y+ G +G           +D+P +HPR++  E+++I+++LG ++   K
Sbjct:   203 DWTRWEWVYYICGIVGTLWFIAWQFLVFDSPAEHPRIADSERKFIEKSLGASIQGSK 259




GO:0005316 "high affinity inorganic phosphate:sodium symporter activity" evidence=ISS;NAS
GO:0035435 "phosphate ion transmembrane transport" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
FB|FBgn0031645 CG3036 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0058263 MFS17 "Major Facilitator Superfamily Transporter 17" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0034490 CG9864 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030452 MFS10 "Major Facilitator Superfamily Transporter 10" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030616-554 slc17a6b "solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|A6QLI1 SLC17A6 "Vesicular glutamate transporter 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9P2U8 SLC17A6 "Vesicular glutamate transporter 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SFZ2 SLC17A6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2156052 Slc17a6 "solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
TIGR00894 465 TIGR00894, 2A0114euk, Na(+)-dependent inorganic ph 4e-35
TIGR00893 399 TIGR00893, 2A0114, D-galactonate transporter 6e-18
pfam07690 346 pfam07690, MFS_1, Major Facilitator Superfamily 2e-17
cd06174 352 cd06174, MFS, The Major Facilitator Superfamily (M 5e-15
TIGR00881 379 TIGR00881, 2A0104, phosphoglycerate transporter fa 2e-10
TIGR00880141 TIGR00880, 2_A_01_02, Multidrug resistance protein 5e-07
COG2271 448 COG2271, UhpC, Sugar phosphate permease [Carbohydr 2e-06
TIGR00711 485 TIGR00711, efflux_EmrB, drug resistance transporte 3e-06
COG2814 394 COG2814, AraJ, Arabinose efflux permease [Carbohyd 1e-04
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 5e-04
TIGR00895 398 TIGR00895, 2A0115, benzoate transport 0.003
>gnl|CDD|129972 TIGR00894, 2A0114euk, Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
 Score =  128 bits (324), Expect = 4e-35
 Identities = 43/185 (23%), Positives = 67/185 (36%), Gaps = 6/185 (3%)

Query: 33  SLFHWDSNVQNLVLGSFFWLHWSTQIPGGVLARSLGTKVVFGVSNLAMFLISFALPAAAY 92
           ++ + +      + G     H+  QI   +    L  K VF  S      +S  +     
Sbjct: 65  NIKNPNFKWSGALQGLILSSHFYGQIIIQIPVGYLAGKYVFKWSIGIGMFLSSVISIVIP 124

Query: 93  WDYKAMAGLRIVQGVIGGLAWPSMHHLVAHWIPPTERSQFITSYLGSSF-GVALSYPLCG 151
           W       L +   VI GLA  S+       I      +  +  LG S  G  L   +  
Sbjct: 125 WAAGGGIALVVFCRVIQGLAQGSVSPATHKIIVKWAPPKERSRLLGMSTSGFQLGTFIFL 184

Query: 152 VVID-----TLGWEAAFYVTGALGVVWWVVWMIVVYDTPDQHPRVSAEEKEYIQQALGNT 206
            +         GW   FYV G +G  W ++W +   D P  HP +S  EK+YI  +L   
Sbjct: 185 PISGWLCESWGGWPMIFYVFGIVGCAWSLLWFVFPADDPSIHPCISKFEKKYINSSLQGQ 244

Query: 207 VSAKK 211
             + +
Sbjct: 245 KGSTR 249


[Transport and binding proteins, Anions]. Length = 465

>gnl|CDD|233174 TIGR00893, 2A0114, D-galactonate transporter Back     alignment and domain information
>gnl|CDD|219516 pfam07690, MFS_1, Major Facilitator Superfamily Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|233167 TIGR00881, 2A0104, phosphoglycerate transporter family protein Back     alignment and domain information
>gnl|CDD|233166 TIGR00880, 2_A_01_02, Multidrug resistance protein Back     alignment and domain information
>gnl|CDD|225180 COG2271, UhpC, Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|129794 TIGR00711, efflux_EmrB, drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>gnl|CDD|225371 COG2814, AraJ, Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|233175 TIGR00895, 2A0115, benzoate transport Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 211
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 99.94
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 99.92
TIGR00893 399 2A0114 d-galactonate transporter. 99.92
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.92
KOG2532|consensus 466 99.91
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 99.91
KOG1330|consensus 493 99.91
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 99.91
PRK14995 495 methyl viologen resistance protein SmvA; Provision 99.91
PRK03545 390 putative arabinose transporter; Provisional 99.9
PRK11663 434 regulatory protein UhpC; Provisional 99.9
PRK15403 413 multidrug efflux system protein MdtM; Provisional 99.89
PRK10213 394 nepI ribonucleoside transporter; Reviewed 99.89
PRK10091 382 MFS transport protein AraJ; Provisional 99.89
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 99.89
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 99.89
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.89
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.88
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 99.88
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 99.88
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.88
PRK09705 393 cynX putative cyanate transporter; Provisional 99.87
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 99.87
TIGR00891 405 2A0112 putative sialic acid transporter. 99.87
PRK10473 392 multidrug efflux system protein MdtL; Provisional 99.87
PRK10077 479 xylE D-xylose transporter XylE; Provisional 99.87
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 99.87
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.87
TIGR00900 365 2A0121 H+ Antiporter protein. 99.86
TIGR00895 398 2A0115 benzoate transport. 99.86
PRK11652 394 emrD multidrug resistance protein D; Provisional 99.86
PRK12307 426 putative sialic acid transporter; Provisional 99.85
TIGR00898 505 2A0119 cation transport protein. 99.85
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 99.85
PRK11043 401 putative transporter; Provisional 99.85
KOG2533|consensus 495 99.85
PRK10642 490 proline/glycine betaine transporter; Provisional 99.84
PRK10504 471 putative transporter; Provisional 99.84
PRK10406 432 alpha-ketoglutarate transporter; Provisional 99.84
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.84
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 99.84
PRK03893 496 putative sialic acid transporter; Provisional 99.83
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 99.83
PRK11646 400 multidrug resistance protein MdtH; Provisional 99.83
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 99.83
PRK10054 395 putative transporter; Provisional 99.83
PRK03699 394 putative transporter; Provisional 99.83
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 99.83
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 99.83
PRK12382 392 putative transporter; Provisional 99.82
KOG3764|consensus 464 99.82
PRK05122 399 major facilitator superfamily transporter; Provisi 99.82
PRK09874 408 drug efflux system protein MdtG; Provisional 99.82
TIGR00892 455 2A0113 monocarboxylate transporter 1. 99.82
PLN00028 476 nitrate transmembrane transporter; Provisional 99.81
PRK11195 393 lysophospholipid transporter LplT; Provisional 99.81
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 99.81
PRK09952 438 shikimate transporter; Provisional 99.81
PRK15075 434 citrate-proton symporter; Provisional 99.81
TIGR00897 402 2A0118 polyol permease family. This family of prot 99.8
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 99.8
PRK10207 489 dipeptide/tripeptide permease B; Provisional 99.8
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.8
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.79
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 99.79
KOG0255|consensus 521 99.79
TIGR00896 355 CynX cyanate transporter. This family of proteins 99.78
TIGR00805 633 oat sodium-independent organic anion transporter. 99.78
PRK10133 438 L-fucose transporter; Provisional 99.78
PRK03633 381 putative MFS family transporter protein; Provision 99.78
PRK10489 417 enterobactin exporter EntS; Provisional 99.76
PTZ00207 591 hypothetical protein; Provisional 99.76
TIGR00880141 2_A_01_02 Multidrug resistance protein. 99.74
KOG0254|consensus 513 99.74
TIGR00901 356 2A0125 AmpG-related permease. 99.74
PRK15011 393 sugar efflux transporter B; Provisional 99.74
KOG2615|consensus 451 99.74
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 99.72
PRK09584 500 tppB putative tripeptide transporter permease; Rev 99.71
PRK15462 493 dipeptide/tripeptide permease D; Provisional 99.71
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 99.69
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 99.68
KOG0569|consensus 485 99.68
PRK10642490 proline/glycine betaine transporter; Provisional 99.67
TIGR00889418 2A0110 nucleoside transporter. This family of prot 99.67
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.67
PRK11902 402 ampG muropeptide transporter; Reviewed 99.67
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 99.66
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 99.66
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.65
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.65
PRK05122399 major facilitator superfamily transporter; Provisi 99.64
PRK09528420 lacY galactoside permease; Reviewed 99.63
PRK11010 491 ampG muropeptide transporter; Validated 99.63
PRK10489417 enterobactin exporter EntS; Provisional 99.62
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 99.62
KOG2504|consensus 509 99.61
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.61
PRK09528 420 lacY galactoside permease; Reviewed 99.61
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 99.61
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 99.6
PRK15011393 sugar efflux transporter B; Provisional 99.6
PRK03893496 putative sialic acid transporter; Provisional 99.59
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 99.59
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 99.58
PRK09874408 drug efflux system protein MdtG; Provisional 99.58
PRK12382392 putative transporter; Provisional 99.57
KOG0253|consensus 528 99.57
TIGR00889 418 2A0110 nucleoside transporter. This family of prot 99.56
KOG0252|consensus 538 99.56
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.55
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 99.55
PRK03545390 putative arabinose transporter; Provisional 99.55
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 99.54
PRK03699394 putative transporter; Provisional 99.53
TIGR00892455 2A0113 monocarboxylate transporter 1. 99.52
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 99.51
PRK03633381 putative MFS family transporter protein; Provision 99.51
PRK10077479 xylE D-xylose transporter XylE; Provisional 99.5
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 99.49
PRK11663434 regulatory protein UhpC; Provisional 99.48
TIGR00891405 2A0112 putative sialic acid transporter. 99.48
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 99.47
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.47
PRK09705393 cynX putative cyanate transporter; Provisional 99.47
TIGR00902382 2A0127 phenyl proprionate permease family protein. 99.47
PRK09952438 shikimate transporter; Provisional 99.47
TIGR00893399 2A0114 d-galactonate transporter. 99.45
PRK15075434 citrate-proton symporter; Provisional 99.45
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 99.44
PRK12307426 putative sialic acid transporter; Provisional 99.43
TIGR00897402 2A0118 polyol permease family. This family of prot 99.43
PRK11010491 ampG muropeptide transporter; Validated 99.43
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 99.42
PF05977524 MFS_3: Transmembrane secretion effector; InterPro: 99.42
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 99.4
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 99.39
PRK09669 444 putative symporter YagG; Provisional 99.37
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 99.37
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 99.36
PRK10054395 putative transporter; Provisional 99.35
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 99.35
TIGR00900365 2A0121 H+ Antiporter protein. 99.35
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 99.35
PRK10504471 putative transporter; Provisional 99.35
PRK15402406 multidrug efflux system translocase MdfA; Provisio 99.34
PRK10406432 alpha-ketoglutarate transporter; Provisional 99.34
TIGR00788 468 fbt folate/biopterin transporter. The only functio 99.33
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.33
COG2807 395 CynX Cyanate permease [Inorganic ion transport and 99.33
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 99.31
TIGR00898505 2A0119 cation transport protein. 99.3
PF05631 354 DUF791: Protein of unknown function (DUF791); Inte 99.3
PLN00028476 nitrate transmembrane transporter; Provisional 99.3
PRK10091382 MFS transport protein AraJ; Provisional 99.29
COG2270438 Permeases of the major facilitator superfamily [Ge 99.29
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 99.28
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 99.28
PRK11902402 ampG muropeptide transporter; Reviewed 99.27
PRK10213394 nepI ribonucleoside transporter; Reviewed 99.27
KOG2325|consensus 488 99.26
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 99.26
KOG2504|consensus509 99.25
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.24
TIGR00895398 2A0115 benzoate transport. 99.24
PRK09848448 glucuronide transporter; Provisional 99.23
TIGR01272310 gluP glucose/galactose transporter. Disruption of 99.23
PRK11646400 multidrug resistance protein MdtH; Provisional 99.23
TIGR00881379 2A0104 phosphoglycerate transporter family protein 99.21
PRK11195393 lysophospholipid transporter LplT; Provisional 99.2
PRK10429 473 melibiose:sodium symporter; Provisional 99.19
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 99.19
PRK10133438 L-fucose transporter; Provisional 99.19
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.18
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.17
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.15
PRK10473392 multidrug efflux system protein MdtL; Provisional 99.14
KOG0569|consensus485 99.14
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 99.14
TIGR00896355 CynX cyanate transporter. This family of proteins 99.13
PRK14995495 methyl viologen resistance protein SmvA; Provision 99.13
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.12
PF13347 428 MFS_2: MFS/sugar transport protein 99.11
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.08
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 99.08
KOG3762|consensus618 99.08
KOG4686|consensus459 99.05
PRK11043401 putative transporter; Provisional 99.05
PRK09669444 putative symporter YagG; Provisional 99.04
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 99.04
TIGR00788468 fbt folate/biopterin transporter. The only functio 99.02
PRK10429473 melibiose:sodium symporter; Provisional 99.02
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 98.99
TIGR00901356 2A0125 AmpG-related permease. 98.99
PF03825 400 Nuc_H_symport: Nucleoside H+ symporter 98.98
KOG0253|consensus528 98.97
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 98.96
COG0477 338 ProP Permeases of the major facilitator superfamil 98.93
PF01306 412 LacY_symp: LacY proton/sugar symporter; InterPro: 98.91
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 98.9
PRK11462 460 putative transporter; Provisional 98.89
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 98.84
COG2807395 CynX Cyanate permease [Inorganic ion transport and 98.84
PF13347428 MFS_2: MFS/sugar transport protein 98.82
PRK11462460 putative transporter; Provisional 98.81
COG2211 467 MelB Na+/melibiose symporter and related transport 98.81
KOG2816|consensus 463 98.8
PRK09584500 tppB putative tripeptide transporter permease; Rev 98.8
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 98.79
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 98.78
KOG2563|consensus 480 98.78
PRK09848 448 glucuronide transporter; Provisional 98.77
PRK11652394 emrD multidrug resistance protein D; Provisional 98.74
PRK10207489 dipeptide/tripeptide permease B; Provisional 98.7
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 98.69
PF03209 403 PUCC: PUCC protein; InterPro: IPR004896 This prote 98.67
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 98.67
KOG3764|consensus464 98.67
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 98.64
COG0738422 FucP Fucose permease [Carbohydrate transport and m 98.64
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 98.63
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 98.63
KOG2532|consensus466 98.62
COG2211467 MelB Na+/melibiose symporter and related transport 98.62
PF11700 477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 98.57
KOG4686|consensus 459 98.52
PRK15403413 multidrug efflux system protein MdtM; Provisional 98.51
KOG0254|consensus513 98.5
PF0677985 DUF1228: Protein of unknown function (DUF1228); In 98.5
TIGR01272 310 gluP glucose/galactose transporter. Disruption of 98.49
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 98.44
KOG3626|consensus 735 98.42
KOG0255|consensus521 98.34
PF01770 412 Folate_carrier: Reduced folate carrier; InterPro: 98.32
KOG0252|consensus538 98.3
PF00854 372 PTR2: POT family; InterPro: IPR000109 This entry r 98.24
PF1283277 MFS_1_like: MFS_1 like family 98.17
KOG2533|consensus495 98.15
COG2270 438 Permeases of the major facilitator superfamily [Ge 98.1
KOG2816|consensus463 97.95
PF06609599 TRI12: Fungal trichothecene efflux pump (TRI12); I 97.92
PRK15462493 dipeptide/tripeptide permease D; Provisional 97.86
KOG2615|consensus451 97.81
PTZ00207591 hypothetical protein; Provisional 97.7
TIGR00769 472 AAA ADP/ATP carrier protein family. These proteins 97.66
PF02487 402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 97.6
KOG4332|consensus 454 97.52
KOG3098|consensus 461 97.39
PRK03612 521 spermidine synthase; Provisional 97.35
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 97.31
KOG1237|consensus 571 97.26
COG3104498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 97.14
KOG0637|consensus 498 97.04
KOG3762|consensus 618 96.92
KOG2563|consensus480 96.8
KOG1330|consensus493 96.43
PF02487402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 96.35
KOG3098|consensus461 95.95
PF06963432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 95.63
KOG3574|consensus 510 95.41
PF03137539 OATP: Organic Anion Transporter Polypeptide (OATP) 94.73
PF06963 432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 94.22
PF03219 491 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 93.82
KOG4332|consensus454 93.75
TIGR00806511 rfc RFC reduced folate carrier. Proteins of the RF 93.09
TIGR00805633 oat sodium-independent organic anion transporter. 92.98
KOG0637|consensus498 92.58
KOG2325|consensus488 92.09
TIGR00769472 AAA ADP/ATP carrier protein family. These proteins 91.53
KOG3810|consensus433 91.45
TIGR00939437 2a57 Equilibrative Nucleoside Transporter (ENT). 90.9
KOG3626|consensus735 90.7
COG3202 509 ATP/ADP translocase [Energy production and convers 89.79
PF01770412 Folate_carrier: Reduced folate carrier; InterPro: 88.99
KOG3880|consensus 409 88.43
KOG1479|consensus406 87.4
PF13000 544 Acatn: Acetyl-coenzyme A transporter 1; InterPro: 86.75
KOG3880|consensus409 86.55
COG5336116 Uncharacterized protein conserved in bacteria [Fun 86.32
PF01733309 Nucleoside_tran: Nucleoside transporter; InterPro: 86.23
PF13000544 Acatn: Acetyl-coenzyme A transporter 1; InterPro: 85.27
TIGR00939 437 2a57 Equilibrative Nucleoside Transporter (ENT). 84.86
KOG3097|consensus 390 82.99
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
Probab=99.94  E-value=1.1e-25  Score=183.05  Aligned_cols=171  Identities=19%  Similarity=0.206  Sum_probs=155.3

Q ss_pred             cccccccccccccCCCcccccCCchhhHHHHHHHHHHHHHhhchhhHHHHHhCCcchhHHHHHHHHHHHHHhhhhhcccH
Q psy3615          16 ISLSSRGVLFQQDGDSGSLFHWDSNVQNLVLGSFFWLHWSTQIPGGVLARSLGTKVVFGVSNLAMFLISFALPAAAYWDY   95 (211)
Q Consensus        16 ~~~~~~~~~~~~~~~i~~~~~~s~~~~~~~~~~~~~~~~i~~~~~g~l~dr~G~r~~~~~~~~~~~i~~~~~~~~~~~~~   95 (211)
                      +++.|+..+.+..|.+++++|++..+.+++.+.+.+++.+++++.|++.||+|||+++..+.++.+++.++..++  +++
T Consensus        19 ~~~~d~~~~~~~~~~l~~~~~~s~~~~g~~~s~~~~~~~~~~~~~g~l~dr~G~r~~~~~~~~~~~~~~~~~~~~--~~~   96 (412)
T TIGR02332        19 FSFLDRINIGFAGLTMGKDLGLSATMFGLAATLFYAAYVICGIPSNIMLAIIGARRWIAGIMVLWGIASTATMFA--TGP   96 (412)
T ss_pred             HHHhhhhhHHHHHHhhHhhcCCCHHHHHHHHHHHHHHHHHHHhhHHHHHHHhChHHHHHHHHHHHHHHHHHHHHh--cCH
Confidence            467888889899999999999999999999999999999999999999999999999999999999999999887  889


Q ss_pred             HHHHHHHHHHHhhhhcchHHHHHHhhhccCCCchhhHhh-hhhcchhhhhhhhhhhhhhhc------ccCchHHHHHHHH
Q psy3615          96 KAMAGLRIVQGVIGGLAWPSMHHLVAHWIPPTERSQFIT-SYLGSSFGVALSYPLCGVVID------TLGWEAAFYVTGA  168 (211)
Q Consensus        96 ~~~~~~~~l~G~~~g~~~~~~~~~~~~~~~~~~r~~~~~-~~~~~~~g~~~~~~~~~~l~~------~~gw~~~~~~~~~  168 (211)
                      +.+++.|++.|++.+...+....++.|++|+++|+++++ ......+|..+++.+++++.+      ..|||+.|++.++
T Consensus        97 ~~l~~~r~l~G~~~~~~~~~~~~~~~~~~~~~~rg~~~~~~~~~~~~g~~~~~~~~~~l~~~~~~~~~~gwr~~f~~~~~  176 (412)
T TIGR02332        97 ESLYLLRILVGIAEAGFLPGILLYLTFWFPAYFRARANALFMIAMPVTMALGLILSGYILALDGLMALKGWQWLFLLEGF  176 (412)
T ss_pred             HHHHHHHHHHHHHHhhHHHHHHHHHHHHcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCCCccchhHHHHHHHH
Confidence            999999999999999999999999999999999999999 778999999999999998864      3699999999888


Q ss_pred             HHHHHHHHHHhhhcCCCCCC
Q psy3615         169 LGVVWWVVWMIVVYDTPDQH  188 (211)
Q Consensus       169 ~~~~~~~~~~~~~~~~~~~~  188 (211)
                      ..++..++.+++.||+|++.
T Consensus       177 ~~l~~~~~~~~~~~~~p~~~  196 (412)
T TIGR02332       177 PSVILGVMTWFWLDDSPDKA  196 (412)
T ss_pred             HHHHHHHHHhhccCCCcccC
Confidence            88777666666678877553



This protein is a part of the Major Facilitator Superfamily (Pfam family pfam07690). Member of this family are found in a number of proteobacterial genomes, but only in the context of having genes for 4-hydroxyphenylacetate (4-HPA) degradation. The protein is characterized by Prieto, et al. (PubMed:9315705) as 4-hydroxyphenylacetate permease in E. coli, where 3-HPA and 3,4-dihydroxyphenylacetate are shown to competitively inhibit 4-HPA transport and therefore also interact specificially.

>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>KOG4332|consensus Back     alignment and domain information
>KOG3098|consensus Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>KOG1237|consensus Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0637|consensus Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>KOG3098|consensus Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>KOG3574|consensus Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information
>KOG4332|consensus Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>KOG0637|consensus Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>KOG3810|consensus Back     alignment and domain information
>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>COG3202 ATP/ADP translocase [Energy production and conversion] Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>KOG3880|consensus Back     alignment and domain information
>KOG1479|consensus Back     alignment and domain information
>PF13000 Acatn: Acetyl-coenzyme A transporter 1; InterPro: IPR024371 Acetyl-coenzyme A transporter 1 (also known as acatn) is a multipass transmembrane protein that appears to promote 9-O-acetylation in gangliosides [, ] Back     alignment and domain information
>KOG3880|consensus Back     alignment and domain information
>COG5336 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF01733 Nucleoside_tran: Nucleoside transporter; InterPro: IPR002259 Delayed-early response (DER) gene products include growth progression factors and several unknown products of novel cDNAs Back     alignment and domain information
>PF13000 Acatn: Acetyl-coenzyme A transporter 1; InterPro: IPR024371 Acetyl-coenzyme A transporter 1 (also known as acatn) is a multipass transmembrane protein that appears to promote 9-O-acetylation in gangliosides [, ] Back     alignment and domain information
>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) Back     alignment and domain information
>KOG3097|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 2e-24
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 3e-04
2cfq_A417 Lactose permease; transport, transport mechanism, 6e-04
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Length = 451 Back     alignment and structure
 Score = 98.6 bits (246), Expect = 2e-24
 Identities = 27/181 (14%), Positives = 57/181 (31%), Gaps = 4/181 (2%)

Query: 35  FHWDSNVQNLVLGSFFWLHWSTQIPGGVLARSLGTKVVFGVSNL--AMFLISFALPAAAY 92
             +        L      +  ++   G ++     +V      +  A  ++       A 
Sbjct: 57  QGFSRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWAT 116

Query: 93  WDYKAMAGLRIVQGVIGGLAWPSMHHLVAHWIPPTERSQFITSYL-GSSFGVALSYPLCG 151
                M  L  + G   G+ WP     + HW    ER   ++ +    + G  +   L  
Sbjct: 117 SSIAVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFL 176

Query: 152 VVIDTL-GWEAAFYVTGALGVVWWVVWMIVVYDTPDQHPRVSAEEKEYIQQALGNTVSAK 210
           + +     W AA Y+     ++  +    ++ DTP        EE +       N  + +
Sbjct: 177 LGMAWFNDWHAALYMPAFCAILVALFAFAMMRDTPQSCGLPPIEEYKNDYPDDYNEKAEQ 236

Query: 211 K 211
           +
Sbjct: 237 E 237


>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Length = 491 Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Length = 417 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query211
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 99.9
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 99.89
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 99.88
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 99.86
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 99.85
2xut_A 524 Proton/peptide symporter family protein; transport 99.81
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 99.64
2cfq_A417 Lactose permease; transport, transport mechanism, 99.57
2cfq_A 417 Lactose permease; transport, transport mechanism, 99.53
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 99.49
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 99.46
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 99.45
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 99.08
2xut_A524 Proton/peptide symporter family protein; transport 99.03
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
Probab=99.90  E-value=3.1e-24  Score=174.19  Aligned_cols=165  Identities=14%  Similarity=0.166  Sum_probs=148.9

Q ss_pred             cccccccccCCCcccccCCchhhHHHHHHHHHHHHHhhchhhHHHHHhCCcchhHHHHHHHHHHHHHhhh----hhcccH
Q psy3615          20 SRGVLFQQDGDSGSLFHWDSNVQNLVLGSFFWLHWSTQIPGGVLARSLGTKVVFGVSNLAMFLISFALPA----AAYWDY   95 (211)
Q Consensus        20 ~~~~~~~~~~~i~~~~~~s~~~~~~~~~~~~~~~~i~~~~~g~l~dr~G~r~~~~~~~~~~~i~~~~~~~----~~~~~~   95 (211)
                      +...+.+..+.+.+++ .+..+.+++.+.+.++..++++++|+++||+|||+++.++.++.+++.+++.+    .  +++
T Consensus        43 ~~~~~~~~~~~~~~~~-~s~~~~g~~~~~~~~~~~~~~~~~G~l~dr~g~r~~l~~~~~~~~~~~~~~~~~~~~~--~~~  119 (451)
T 1pw4_A           43 VRKNFALAMPYLVEQG-FSRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWAT--SSI  119 (451)
T ss_dssp             HHTSHHHHHHHTTSST-TCSSCHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHCHHHH--SSS
T ss_pred             HHHHHHHHHHHHHHHh-ccHhHHHHHHHHHHHHHHHHHHhHHHHHHhcCchHHHHHHHHHHHHHHHHHHhhhhcc--ccH
Confidence            3444556667788889 99999999999999999999999999999999999999999999999999988    6  889


Q ss_pred             HHHHHHHHHHHhhhhcchHHHHHHhhhccCCCchhhHhh-hhhcchhhhhhhhhhhhhhhcccC-chHHHHHHHHHHHHH
Q psy3615          96 KAMAGLRIVQGVIGGLAWPSMHHLVAHWIPPTERSQFIT-SYLGSSFGVALSYPLCGVVIDTLG-WEAAFYVTGALGVVW  173 (211)
Q Consensus        96 ~~~~~~~~l~G~~~g~~~~~~~~~~~~~~~~~~r~~~~~-~~~~~~~g~~~~~~~~~~l~~~~g-w~~~~~~~~~~~~~~  173 (211)
                      +.+++.|++.|++.+...+...+++.|++|+++|+++++ ......+|..++|.+++++.+..| ||+.|++.+++.++.
T Consensus       120 ~~l~~~~~l~G~~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~~g~~~~~~l~~~~g~w~~~f~~~~~~~~~~  199 (451)
T 1pw4_A          120 AVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFNDWHAALYMPAFCAILV  199 (451)
T ss_dssp             SHHHHHHHHHHHHHHHTHHHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHHHHHHHHHTCCSTTCTHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhhhccchHHHHHHHHCCchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhccHHHHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999 889999999999999999888888 999999999888877


Q ss_pred             HHHHHhhhcCCCCC
Q psy3615         174 WVVWMIVVYDTPDQ  187 (211)
Q Consensus       174 ~~~~~~~~~~~~~~  187 (211)
                      .++.++..||+++.
T Consensus       200 ~~~~~~~~~~~~~~  213 (451)
T 1pw4_A          200 ALFAFAMMRDTPQS  213 (451)
T ss_dssp             HHHHHHHCCCSSTT
T ss_pred             HHHHHhhccCCHhh
Confidence            77666667776543



>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 211
d1pw4a_ 447 f.38.1.1 (A:) Glycerol-3-phosphate transporter {Es 2e-06
d1pv7a_417 f.38.1.2 (A:) Lactose permease {Escherichia coli [ 3e-04
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Length = 447 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
 Score = 45.1 bits (105), Expect = 2e-06
 Identities = 25/181 (13%), Positives = 54/181 (29%), Gaps = 4/181 (2%)

Query: 35  FHWDSNVQNLVLGSFFWLHWSTQIPGGVLARSLGTKVVFGVSNL--AMFLISFALPAAAY 92
             +        L      +  ++   G ++     +V      +  A  ++       A 
Sbjct: 54  QGFSRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWAT 113

Query: 93  WDYKAMAGLRIVQGVIGGLAWPSMHHLVAHWIPPTERSQFIT-SYLGSSFGVALSYPLCG 151
                M  L  + G   G+ WP     + HW    ER   ++      + G  +   L  
Sbjct: 114 SSIAVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFL 173

Query: 152 VVIDTLGWEA-AFYVTGALGVVWWVVWMIVVYDTPDQHPRVSAEEKEYIQQALGNTVSAK 210
           + +        A Y+     ++  +    ++ DTP        EE +       N  + +
Sbjct: 174 LGMAWFNDWHAALYMPAFCAILVALFAFAMMRDTPQSCGLPPIEEYKNDYPDDYNEKAEQ 233

Query: 211 K 211
           +
Sbjct: 234 E 234


>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Length = 417 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query211
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 99.89
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 99.66
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 99.54
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 99.51
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=99.89  E-value=4.4e-24  Score=170.69  Aligned_cols=168  Identities=14%  Similarity=0.143  Sum_probs=145.3

Q ss_pred             cccccccccccCCCcccccCCchhhHHHHHHHHHHHHHhhchhhHHHHHhCCcchhHHHHHHHHHHHHHhhhhh--cccH
Q psy3615          18 LSSRGVLFQQDGDSGSLFHWDSNVQNLVLGSFFWLHWSTQIPGGVLARSLGTKVVFGVSNLAMFLISFALPAAA--YWDY   95 (211)
Q Consensus        18 ~~~~~~~~~~~~~i~~~~~~s~~~~~~~~~~~~~~~~i~~~~~g~l~dr~G~r~~~~~~~~~~~i~~~~~~~~~--~~~~   95 (211)
                      +.++..++...|.++ |+|+|.++.|++.+.+.+++.++++++|+++||+|||+++.++.++.+++.+++++..  .+++
T Consensus        38 ~~~~~~~~~~~p~~~-~~g~s~~~~g~~~s~~~~~~~~~~~~~G~l~Dr~g~r~~~~~~~~~~~~~~~~~~~~~~~~~~~  116 (447)
T d1pw4a_          38 YLVRKNFALAMPYLV-EQGFSRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWATSSI  116 (447)
T ss_dssp             HHHHTSHHHHHHHTT-SSTTCSSCHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHCHHHHSSS
T ss_pred             HHHHHHHHHHHHHHH-HhCcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCchHHHHHHHHHHHHHHhhccccchhhhhH
Confidence            345556666667665 5899999999999999999999999999999999999999999999999888876642  2467


Q ss_pred             HHHHHHHHHHHhhhhcchHHHHHHhhhccCCCchhhHhh-hhhcchhhhhhhhhhhhhhhcc-cCchHHHHHHHHHHHHH
Q psy3615          96 KAMAGLRIVQGVIGGLAWPSMHHLVAHWIPPTERSQFIT-SYLGSSFGVALSYPLCGVVIDT-LGWEAAFYVTGALGVVW  173 (211)
Q Consensus        96 ~~~~~~~~l~G~~~g~~~~~~~~~~~~~~~~~~r~~~~~-~~~~~~~g~~~~~~~~~~l~~~-~gw~~~~~~~~~~~~~~  173 (211)
                      +.+++.|++.|++.+...+....++.|++|+++|+++++ ......+|..+++.+++.+.+. .+||+.|++.+.+.++.
T Consensus       117 ~~~~~~~~~~g~~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~i~~~~~~~~~~~~~~w~~~~~~~~~~~~~~  196 (447)
T d1pw4a_         117 AVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFNDWHAALYMPAFCAILV  196 (447)
T ss_dssp             SHHHHHHHHHHHHHHHTHHHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHHHHHHHHHTCCSTTCTHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhhhhhhhHHHHHHHHHHHhhcccccccccccccchhhhhhhhhhhhHhhhhhcccccchhhhhhHHHH
Confidence            889999999999999999999999999999999999999 8899999999999998877665 47999999988888887


Q ss_pred             HHHHHhhhcCCCC
Q psy3615         174 WVVWMIVVYDTPD  186 (211)
Q Consensus       174 ~~~~~~~~~~~~~  186 (211)
                      .++.++..+++|+
T Consensus       197 ~~~~~~~~~~~~~  209 (447)
T d1pw4a_         197 ALFAFAMMRDTPQ  209 (447)
T ss_dssp             HHHHHHHCCCSST
T ss_pred             HHHHHHhcccchh
Confidence            7777776666554



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure