Psyllid ID: psy3650


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-----
MDEGNYPYEIIVIDDGSPDGTLDAAKQLQSIYGSEKIVLKPRKKKLGLGTAYMHGLKYATGNFIIIMDADLSHHPKFIPEMIKLQQQENLDVVTGTRYVGTGGVYGWDFKRKLVSRGANYLTQLLLRPGVSDLTGSFRLYKKQVLENLVSSCVSKGYVFQMEMVIRARQYNYTIGEVPISFVDRVVFTTQAIMSGDSVKNKYTVLLPTYNEKENLPIIVYLITKYMDEGNYPYEIIVIDDGSPDGTLDAAKQLQSIYGSEKIVLKPRKKKLGLGTAYMHGLKYATGNFIIIMDADLSHHPKFIPEMIKLQQQENLDVVTGTRYVGTGGVYGWDFKRKLVSRGANYLTQLLLRPGVSDLTGSFRLYKKQVLENLVSSCVSKGYVFQMEMVIRARQYNYTIGEVPISFVDRVYGESKLGGTEIFQFAKALLYLFATT
cccccccEEEEEEEccccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHcccccEEEEcccccccccccccccHHHHHHHHHHHHHHHcccccccccccEEEEEHHHHHHHHcccccccccHHHHHHHHHHHcccEEEEEcEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHcccccEEEEcccccccccccccccHHHHHHHHHHHHHHHcccccccccccEEEEEHHHHHHHHcccccccccHHHHHHHHHHHcccEEEEEcEEEEccccccccccHHHHHHHHHHHHHHHccc
cccccccEEEEEEEccccccHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccccccEEHEEHEEEEHHcccEEEEEEEEEEEccccccccccccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccEEEEEEEEEEccccccccccHHHHHHHHHHHHHHHHcc
mdegnypyeiividdgspdgtLDAAKQLQSIYgsekivlkprkkklglgtAYMHGLKYATGNFIIIMdadlshhpkfiPEMIKLQqqenldvvtgtryvgtggvygwDFKRKLVSRGANYLTQLLlrpgvsdltgsFRLYKKQVLENLVSSCVSKGYVFQMEMVIRARQYnytigevpisFVDRVVFTTqaimsgdsvknkytvllptynekenlPIIVYLITKymdegnypyeiividdgspdgtLDAAKQLQSIYgsekivlkprkkklglgtAYMHGLKYATGNFIIIMdadlshhpkfiPEMIKLQqqenldvvtgtryvgtggvygwDFKRKLVSRGANYLTQLLlrpgvsdltgsFRLYKKQVLENLVSSCVSKGYVFQMEMVIRARQYnytigevpisfvdrvygesklggTEIFQFAKALLYLFATT
MDEGNYPYEIIVIDDGSPDGTLDAAKQLQSiygsekivlkprkkKLGLGTAYMHGLKYATGNFIIIMDADLSHHPKFIPEMIKLQQQENLDVVTGTRYVGTGGVYGWDFKRKLVSRGANYLTQLLLRPGVSDLTGSFRLYKKQVLENLVSSCVSKGYVFQMEMVIRARQYNYTIGEVPISFVDRVVFTTQaimsgdsvknkYTVLLptynekenlpIIVYLITKYMDEGNYPYEIIVIDDGSPDGTLDAAKQLQSiygsekivlkprkkKLGLGTAYMHGLKYATGNFIIIMDADLSHHPKFIPEMIKLQQQENLDVVTGTRYVGTGGVYGWDFKRKLVSRGANYLTQLLLRPGVSDLTGSFRLYKKQVLENLVSSCVSKGYVFQMEMVIRARQYNYTIGEVPISFVDRVYGESKLGGTEIFQFAKALLYLFATT
MDEGNYPYEIIVIDDGSPDGTLDAAKQLQSIYGSEKIVLKPRKKKLGLGTAYMHGLKYATGNFIIIMDADLSHHPKFIPEMIKLQQQENLDvvtgtryvgtggvygWDFKRKLVSRGANYLTQLLLRPGVSDLTGSFRLYKKQVLENLVSSCVSKGYVFQMEMVIRARQYNYTIGEVPISFVDRVVFTTQAIMSGDSVKNKYTVLLPTYNEKENLPIIVYLITKYMDEGNYPYEIIVIDDGSPDGTLDAAKQLQSIYGSEKIVLKPRKKKLGLGTAYMHGLKYATGNFIIIMDADLSHHPKFIPEMIKLQQQENLDvvtgtryvgtggvygWDFKRKLVSRGANYLTQLLLRPGVSDLTGSFRLYKKQVLENLVSSCVSKGYVFQMEMVIRARQYNYTIGEVPISFVDRVYGESKLGGTEIFQFAKALLYLFATT
*****YPYEIIVIDDG****TLDAAKQLQSIYGSEKIVLKPRKKKLGLGTAYMHGLKYATGNFIIIMDADLSHHPKFIPEMIKLQQQENLDVVTGTRYVGTGGVYGWDFKRKLVSRGANYLTQLLLRPGVSDLTGSFRLYKKQVLENLVSSCVSKGYVFQMEMVIRARQYNYTIGEVPISFVDRVVFTTQAIMSGDSVKNKYTVLLPTYNEKENLPIIVYLITKYMDEGNYPYEIIVIDDGSPDGTLDAAKQLQSIYGSEKIVLKPRKKKLGLGTAYMHGLKYATGNFIIIMDADLSHHPKFIPEMIKLQQQENLDVVTGTRYVGTGGVYGWDFKRKLVSRGANYLTQLLLRPGVSDLTGSFRLYKKQVLENLVSSCVSKGYVFQMEMVIRARQYNYTIGEVPISFVDRVYGESKLGGTEIFQFAKALLYLFA**
***GNYPYEIIVIDDGSPDGTLDAAKQLQSIYGSEKIVLKPRKKKLGLGTAYMHGLKYATGNFIIIMDADLSHHPKFIPEMIKLQQQENLDVVTGTRYVGTGGVYGWDFKRKLVSRGANYLTQLLLRPGVSDLTGSFRLYKKQVLENLVSSCVSKGYVFQMEMVIRARQYNYTIGEVPISFVDRVVFTTQAIMSGDSVKNKYTVLLPTYNEKENLPIIVYLITKYMDEGNYPYEIIVIDDGSPDGTLDAAKQLQSIYGSEKIVLKPRKKKLGLGTAYMHGLKYATGNFIIIMDADLSHHPKFIPEMIKLQQQENLDVVTGTRYVGTGGVYGWDFKRKLVSRGANYLTQLLLRPGVSDLTGSFRLYKKQVLENLVSSCVSKGYVFQMEMVIRARQYNYTIGEVPISFVDRVYGESKLGGTEIFQFAKALLYLFATT
MDEGNYPYEIIVIDDGSPDGTLDAAKQLQSIYGSEKIVLKPRKKKLGLGTAYMHGLKYATGNFIIIMDADLSHHPKFIPEMIKLQQQENLDVVTGTRYVGTGGVYGWDFKRKLVSRGANYLTQLLLRPGVSDLTGSFRLYKKQVLENLVSSCVSKGYVFQMEMVIRARQYNYTIGEVPISFVDRVVFTTQAIMSGDSVKNKYTVLLPTYNEKENLPIIVYLITKYMDEGNYPYEIIVIDDGSPDGTLDAAKQLQSIYGSEKIVLKPRKKKLGLGTAYMHGLKYATGNFIIIMDADLSHHPKFIPEMIKLQQQENLDVVTGTRYVGTGGVYGWDFKRKLVSRGANYLTQLLLRPGVSDLTGSFRLYKKQVLENLVSSCVSKGYVFQMEMVIRARQYNYTIGEVPISFVDRVYGESKLGGTEIFQFAKALLYLFATT
***GNYPYEIIVIDDGSPDGTLDAAKQLQSIYGSEKIVLKPRKKKLGLGTAYMHGLKYATGNFIIIMDADLSHHPKFIPEMIKLQQQENLDVVTGTRYVGTGGVYGWDFKRKLVSRGANYLTQLLLRPGVSDLTGSFRLYKKQVLENLVSSCVSKGYVFQMEMVIRARQYNYTIGEVPISFVDRVVFTTQAIMSGDSVKNKYTVLLPTYNEKENLPIIVYLITKYMDEGNYPYEIIVIDDGSPDGTLDAAKQLQSIYGSEKIVLKPRKKKLGLGTAYMHGLKYATGNFIIIMDADLSHHPKFIPEMIKLQQQENLDVVTGTRYVGTGGVYGWDFKRKLVSRGANYLTQLLLRPGVSDLTGSFRLYKKQVLENLVSSCVSKGYVFQMEMVIRARQYNYTIGEVPISFVDRVYGESKLGGTEIFQFAKALLYLFATT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDEGNYPYEIIVIDDGSPDGTLDAAKQLQSIYGSEKIVLKPRKKKLGLGTAYMHGLKYATGNFIIIMDADLSHHPKFIPEMIKLQQQENLDVVTGTRYVGTGGVYGWDFKRKLVSRGANYLTQLLLRPGVSDLTGSFRLYKKQVLENLVSSCVSKGYVFQMEMVIRARQYNYTIGEVPISFVDRVVFTTQAIMSGDSVKNKYTVLLPTYNEKENLPIIVYLITKYMDEGNYPYEIIVIDDGSPDGTLDAAKQLQSIYGSEKIVLKPRKKKLGLGTAYMHGLKYATGNFIIIMDADLSHHPKFIPEMIKLQQQENLDVVTGTRYVGTGGVYGWDFKRKLVSRGANYLTQLLLRPGVSDLTGSFRLYKKQVLENLVSSCVSKGYVFQMEMVIRARQYNYTIGEVPISFVDRVYGESKLGGTEIFQFAKALLYLFATT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query435 2.2.26 [Sep-21-2011]
Q9VIU7241 Probable dolichol-phospha yes N/A 0.542 0.979 0.75 1e-106
O60762260 Dolichol-phosphate mannos yes N/A 0.544 0.911 0.742 1e-106
A5GFZ5259 Dolichol-phosphate mannos yes N/A 0.544 0.915 0.734 1e-104
Q1JQ93260 Dolichol-phosphate mannos yes N/A 0.549 0.919 0.719 1e-104
Q9WU83266 Dolichol-phosphate mannos yes N/A 0.549 0.898 0.715 1e-104
O70152260 Dolichol-phosphate mannos yes N/A 0.549 0.919 0.715 1e-103
O14466236 Dolichol-phosphate mannos yes N/A 0.535 0.987 0.652 1e-88
Q54LP3254 Dolichol-phosphate mannos yes N/A 0.535 0.917 0.585 5e-80
P54856294 Dolichol-phosphate mannos N/A N/A 0.510 0.755 0.306 2e-21
P14020267 Dolichol-phosphate mannos yes N/A 0.514 0.838 0.314 1e-20
>sp|Q9VIU7|DPM1_DROME Probable dolichol-phosphate mannosyltransferase OS=Drosophila melanogaster GN=CG10166 PE=3 SV=1 Back     alignment and function desciption
 Score =  386 bits (992), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 177/236 (75%), Positives = 208/236 (88%)

Query: 200 NKYTVLLPTYNEKENLPIIVYLITKYMDEGNYPYEIIVIDDGSPDGTLDAAKQLQSIYGS 259
           +KY++L+PTYNEK+NLPII++LI KYM      YE+IVIDDGSPDGTLD AK LQ IYG 
Sbjct: 6   HKYSILMPTYNEKDNLPIIIWLIVKYMKASGLEYEVIVIDDGSPDGTLDVAKDLQKIYGE 65

Query: 260 EKIVLKPRKKKLGLGTAYMHGLKYATGNFIIIMDADLSHHPKFIPEMIKLQQQENLDVVT 319
           +KIVL+PR  KLGLGTAY+HG+K+ATG+FI+I+DADLSHHPKFIPE IKLQQ+ N D+V+
Sbjct: 66  DKIVLRPRGSKLGLGTAYIHGIKHATGDFIVIIDADLSHHPKFIPEFIKLQQEGNYDIVS 125

Query: 320 GTRYVGTGGVYGWDFKRKLVSRGANYLTQLLLRPGVSDLTGSFRLYKKQVLENLVSSCVS 379
           GTRY G GGV+GWDFKRKL+SRGAN+L+Q+LLRP  SDLTGSFRLYKK VLE  ++SCVS
Sbjct: 126 GTRYAGNGGVFGWDFKRKLISRGANFLSQVLLRPNASDLTGSFRLYKKDVLEKCIASCVS 185

Query: 380 KGYVFQMEMVIRARQYNYTIGEVPISFVDRVYGESKLGGTEIFQFAKALLYLFATT 435
           KGYVFQMEM++RARQ+ YTI EVPI+FVDR+YG SKLGGTEI QFAK LLYLFATT
Sbjct: 186 KGYVFQMEMLVRARQHGYTIAEVPITFVDRIYGTSKLGGTEIIQFAKNLLYLFATT 241




Transfers mannose from GDP-mannose to dolichol monophosphate to form dolichol phosphate mannose (Dol-P-Man) which is the mannosyl donor in pathways leading to N-glycosylation, glycosyl phosphatidylinositol membrane anchoring, and O-mannosylation of proteins.
Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 8EC: 3
>sp|O60762|DPM1_HUMAN Dolichol-phosphate mannosyltransferase OS=Homo sapiens GN=DPM1 PE=1 SV=1 Back     alignment and function description
>sp|A5GFZ5|DPM1_PIG Dolichol-phosphate mannosyltransferase OS=Sus scrofa GN=DPM1 PE=3 SV=1 Back     alignment and function description
>sp|Q1JQ93|DPM1_BOVIN Dolichol-phosphate mannosyltransferase OS=Bos taurus GN=DPM1 PE=2 SV=1 Back     alignment and function description
>sp|Q9WU83|DPM1_CRIGR Dolichol-phosphate mannosyltransferase OS=Cricetulus griseus GN=DPM1 PE=2 SV=1 Back     alignment and function description
>sp|O70152|DPM1_MOUSE Dolichol-phosphate mannosyltransferase OS=Mus musculus GN=Dpm1 PE=2 SV=1 Back     alignment and function description
>sp|O14466|DPM1_SCHPO Dolichol-phosphate mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpm1 PE=2 SV=1 Back     alignment and function description
>sp|Q54LP3|DPM1_DICDI Dolichol-phosphate mannosyltransferase OS=Dictyostelium discoideum GN=dpm1 PE=3 SV=1 Back     alignment and function description
>sp|P54856|DPM1_USTMA Dolichol-phosphate mannosyltransferase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DPM1 PE=3 SV=2 Back     alignment and function description
>sp|P14020|DPM1_YEAST Dolichol-phosphate mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPM1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query435
91086609245 PREDICTED: similar to dolichyl-phosphate 0.549 0.975 0.786 1e-112
332021240253 Putative dolichol-phosphate mannosyltran 0.542 0.932 0.809 1e-111
350419558253 PREDICTED: dolichol-phosphate mannosyltr 0.542 0.932 0.805 1e-111
383847557253 PREDICTED: dolichol-phosphate mannosyltr 0.549 0.944 0.794 1e-110
322784295237 hypothetical protein SINV_10884 [Solenop 0.542 0.995 0.796 1e-110
380011871253 PREDICTED: probable dolichol-phosphate m 0.542 0.932 0.796 1e-110
156552762251 PREDICTED: dolichol-phosphate mannosyltr 0.556 0.964 0.776 1e-110
242018889253 Dolichol-phosphate mannosyltransferase, 0.544 0.936 0.793 1e-110
340712884253 PREDICTED: LOW QUALITY PROTEIN: probable 0.542 0.932 0.792 1e-110
48101013253 PREDICTED: probable dolichol-phosphate m 0.542 0.932 0.792 1e-110
>gi|91086609|ref|XP_973998.1| PREDICTED: similar to dolichyl-phosphate mannosyltransferase [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 188/239 (78%), Positives = 221/239 (92%)

Query: 197 SVKNKYTVLLPTYNEKENLPIIVYLITKYMDEGNYPYEIIVIDDGSPDGTLDAAKQLQSI 256
           S ++KY++LLPTYNE ENLPIIV+LI KYM++  Y YE+I+IDDGSPDGT DAAKQLQ I
Sbjct: 7   SSEDKYSILLPTYNEVENLPIIVWLIVKYMEKSGYNYEVIIIDDGSPDGTQDAAKQLQKI 66

Query: 257 YGSEKIVLKPRKKKLGLGTAYMHGLKYATGNFIIIMDADLSHHPKFIPEMIKLQQQENLD 316
           YG  KI+LKPR+KKLGLGTAY+HG+K+A+GNFI+IMDADLSHHPKFIP+ I+ Q+ ++ D
Sbjct: 67  YGENKILLKPREKKLGLGTAYIHGMKHASGNFILIMDADLSHHPKFIPQFIEKQKSKDYD 126

Query: 317 VVTGTRYVGTGGVYGWDFKRKLVSRGANYLTQLLLRPGVSDLTGSFRLYKKQVLENLVSS 376
           VV+GTRYVG+GGVYGWDF+RKL+SRGAN+LTQLLLRPG SDLTGSFRLYKK VLE L+ S
Sbjct: 127 VVSGTRYVGSGGVYGWDFRRKLISRGANFLTQLLLRPGASDLTGSFRLYKKDVLEKLIKS 186

Query: 377 CVSKGYVFQMEMVIRARQYNYTIGEVPISFVDRVYGESKLGGTEIFQFAKALLYLFATT 435
           CVSKGYVFQMEM++RARQ+NYT+GEVPI+FVDRVYGESKLGG+EIFQFAKALLYLFATT
Sbjct: 187 CVSKGYVFQMEMIVRARQFNYTVGEVPITFVDRVYGESKLGGSEIFQFAKALLYLFATT 245




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332021240|gb|EGI61625.1| Putative dolichol-phosphate mannosyltransferase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|350419558|ref|XP_003492225.1| PREDICTED: dolichol-phosphate mannosyltransferase-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383847557|ref|XP_003699419.1| PREDICTED: dolichol-phosphate mannosyltransferase-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|322784295|gb|EFZ11300.1| hypothetical protein SINV_10884 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|380011871|ref|XP_003690017.1| PREDICTED: probable dolichol-phosphate mannosyltransferase-like [Apis florea] Back     alignment and taxonomy information
>gi|156552762|ref|XP_001599325.1| PREDICTED: dolichol-phosphate mannosyltransferase-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|242018889|ref|XP_002429901.1| Dolichol-phosphate mannosyltransferase, putative [Pediculus humanus corporis] gi|212514947|gb|EEB17163.1| Dolichol-phosphate mannosyltransferase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|340712884|ref|XP_003394983.1| PREDICTED: LOW QUALITY PROTEIN: probable dolichol-phosphate mannosyltransferase-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|48101013|ref|XP_392640.1| PREDICTED: probable dolichol-phosphate mannosyltransferase-like [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query435
FB|FBgn0032799241 CG10166 [Drosophila melanogast 0.542 0.979 0.707 4e-90
UNIPROTKB|H0Y368295 DPM1 "Dolichol-phosphate manno 0.331 0.488 0.618 3e-89
UNIPROTKB|O60762260 DPM1 "Dolichol-phosphate manno 0.544 0.911 0.696 4.6e-89
UNIPROTKB|J9NZX5260 DPM1 "Uncharacterized protein" 0.544 0.911 0.691 1.6e-88
UNIPROTKB|Q4QR31247 dpm1 "MGC114892 protein" [Xeno 0.556 0.979 0.692 2.5e-88
ZFIN|ZDB-GENE-040801-115250 dpm1 "dolichyl-phosphate manno 0.542 0.944 0.699 4.1e-88
UNIPROTKB|A5GFZ5259 DPM1 "Dolichol-phosphate manno 0.544 0.915 0.687 8.6e-88
UNIPROTKB|Q1JQ93260 DPM1 "Dolichol-phosphate manno 0.549 0.919 0.673 2.9e-87
UNIPROTKB|C7FFR6260 DPM1 "Mannosylphosphodolichol 0.549 0.919 0.673 3.7e-87
MGI|MGI:1330239260 Dpm1 "dolichol-phosphate (beta 0.549 0.919 0.669 1.6e-86
FB|FBgn0032799 CG10166 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 899 (321.5 bits), Expect = 4.0e-90, P = 4.0e-90
 Identities = 167/236 (70%), Positives = 195/236 (82%)

Query:   200 NKYTVLLPTYNEKENLPIIVYLITKYMDEGNYPYEIIVIDDGSPDGTLDAAKQLQSIYGS 259
             +KY++L+PTYNEK+NLPII++LI KYM      YE+IVIDDGSPDGTLD AK LQ IYG 
Sbjct:     6 HKYSILMPTYNEKDNLPIIIWLIVKYMKASGLEYEVIVIDDGSPDGTLDVAKDLQKIYGE 65

Query:   260 EKIVLKPRKKKLGLGTAYMHGLKYATGNFIIIMDADLSHHPKFIPEMIKLQQQENLDXXX 319
             +KIVL+PR  KLGLGTAY+HG+K+ATG+FI+I+DADLSHHPKFIPE IKLQQ+ N D   
Sbjct:    66 DKIVLRPRGSKLGLGTAYIHGIKHATGDFIVIIDADLSHHPKFIPEFIKLQQEGNYDIVS 125

Query:   320 XXXXXXXXXXXXWDFKRKLVSRGANYLTQLLLRPGVSDLTGSFRLYKKQVLENLVSSCVS 379
                         WDFKRKL+SRGAN+L+Q+LLRP  SDLTGSFRLYKK VLE  ++SCVS
Sbjct:   126 GTRYAGNGGVFGWDFKRKLISRGANFLSQVLLRPNASDLTGSFRLYKKDVLEKCIASCVS 185

Query:   380 KGYVFQMEMVIRARQYNYTIGEVPISFVDRVYGESKLGGTEIFQFAKALLYLFATT 435
             KGYVFQMEM++RARQ+ YTI EVPI+FVDR+YG SKLGGTEI QFAK LLYLFATT
Sbjct:   186 KGYVFQMEMLVRARQHGYTIAEVPITFVDRIYGTSKLGGTEIIQFAKNLLYLFATT 241


GO:0004582 "dolichyl-phosphate beta-D-mannosyltransferase activity" evidence=ISS
GO:0006486 "protein glycosylation" evidence=ISS
UNIPROTKB|H0Y368 DPM1 "Dolichol-phosphate mannosyltransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O60762 DPM1 "Dolichol-phosphate mannosyltransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZX5 DPM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q4QR31 dpm1 "MGC114892 protein" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-115 dpm1 "dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|A5GFZ5 DPM1 "Dolichol-phosphate mannosyltransferase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q1JQ93 DPM1 "Dolichol-phosphate mannosyltransferase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|C7FFR6 DPM1 "Mannosylphosphodolichol synthase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1330239 Dpm1 "dolichol-phosphate (beta-D) mannosyltransferase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q1JQ93DPM1_BOVIN2, ., 4, ., 1, ., 8, 30.71960.54940.9192yesN/A
O70152DPM1_MOUSE2, ., 4, ., 1, ., 8, 30.71540.54940.9192yesN/A
Q54LP3DPM1_DICDI2, ., 4, ., 1, ., 8, 30.58540.53560.9173yesN/A
Q9VIU7DPM1_DROME2, ., 4, ., 1, ., 8, 30.750.54250.9792yesN/A
O60762DPM1_HUMAN2, ., 4, ., 1, ., 8, 30.74260.54480.9115yesN/A
O14466DPM1_SCHPO2, ., 4, ., 1, ., 8, 30.65230.53560.9872yesN/A
Q9WU83DPM1_CRIGR2, ., 4, ., 1, ., 8, 30.71540.54940.8984yesN/A
A5GFZ5DPM1_PIG2, ., 4, ., 1, ., 8, 30.73410.54480.9150yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.4.1.830.914
3rd Layer2.4.10.921
4th Layer2.4.1.80LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query435
PLN02726243 PLN02726, PLN02726, dolichyl-phosphate beta-D-mann 1e-138
cd06442224 cd06442, DPM1_like, DPM1_like represents putative 1e-125
PLN02726243 PLN02726, PLN02726, dolichyl-phosphate beta-D-mann 1e-107
cd06442224 cd06442, DPM1_like, DPM1_like represents putative 1e-100
cd04179185 cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_l 8e-69
cd04179185 cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_l 5e-59
cd04188211 cd04188, DPG_synthase, DPG_synthase is involved in 2e-39
cd04187181 cd04187, DPM1_like_bac, Bacterial DPM1_like enzyme 2e-34
cd04188211 cd04188, DPG_synthase, DPG_synthase is involved in 8e-34
pfam00535168 pfam00535, Glycos_transf_2, Glycosyl transferase f 6e-33
pfam00535168 pfam00535, Glycos_transf_2, Glycosyl transferase f 1e-29
cd04187181 cd04187, DPM1_like_bac, Bacterial DPM1_like enzyme 2e-27
COG0463291 COG0463, WcaA, Glycosyltransferases involved in ce 1e-21
cd00761156 cd00761, Glyco_tranf_GTA_type, Glycosyltransferase 2e-20
PTZ00260333 PTZ00260, PTZ00260, dolichyl-phosphate beta-glucos 4e-18
PRK10714325 PRK10714, PRK10714, undecaprenyl phosphate 4-deoxy 4e-17
cd00761156 cd00761, Glyco_tranf_GTA_type, Glycosyltransferase 1e-16
COG0463291 COG0463, WcaA, Glycosyltransferases involved in ce 2e-15
cd06423180 cd06423, CESA_like, CESA_like is the cellulose syn 2e-14
PTZ00260333 PTZ00260, PTZ00260, dolichyl-phosphate beta-glucos 3e-14
COG1215 439 COG1215, COG1215, Glycosyltransferases, probably i 1e-12
cd02525249 cd02525, Succinoglycan_BP_ExoA, ExoA is involved i 6e-12
cd06423180 cd06423, CESA_like, CESA_like is the cellulose syn 1e-11
cd02525249 cd02525, Succinoglycan_BP_ExoA, ExoA is involved i 1e-10
pfam13641229 pfam13641, Glyco_tranf_2_3, Glycosyltransferase li 2e-10
PRK10714325 PRK10714, PRK10714, undecaprenyl phosphate 4-deoxy 1e-09
COG1215439 COG1215, COG1215, Glycosyltransferases, probably i 2e-09
pfam13641229 pfam13641, Glyco_tranf_2_3, Glycosyltransferase li 5e-09
cd04192229 cd04192, GT_2_like_e, Subfamily of Glycosyltransfe 8e-09
PRK10073328 PRK10073, PRK10073, putative glycosyl transferase; 5e-08
cd06439251 cd06439, CESA_like_1, CESA_like_1 is a member of t 6e-08
pfam10111278 pfam10111, Glyco_tranf_2_2, Glycosyltransferase li 7e-08
TIGR04182293 TIGR04182, glyco_TIGR04182, glycosyltransferase, T 8e-08
PRK11204 420 PRK11204, PRK11204, N-glycosyltransferase; Provisi 2e-07
COG1216305 COG1216, COG1216, Predicted glycosyltransferases [ 4e-07
TIGR03937 407 TIGR03937, PgaC_IcaA, poly-beta-1,6 N-acetyl-D-glu 8e-07
PRK13915306 PRK13915, PRK13915, putative glucosyl-3-phosphogly 8e-07
PRK10073328 PRK10073, PRK10073, putative glycosyl transferase; 1e-06
pfam10111278 pfam10111, Glyco_tranf_2_2, Glycosyltransferase li 1e-06
cd06421234 cd06421, CESA_CelA_like, CESA_CelA_like are involv 1e-06
cd06420182 cd06420, GT2_Chondriotin_Pol_N, N-terminal domain 1e-06
cd04192229 cd04192, GT_2_like_e, Subfamily of Glycosyltransfe 3e-06
cd02511229 cd02511, Beta4Glucosyltransferase, UDP-glucose LOS 6e-06
TIGR03469384 TIGR03469, HpnB, hopene-associated glycosyltransfe 8e-06
TIGR03469 384 TIGR03469, HpnB, hopene-associated glycosyltransfe 8e-06
cd06439251 cd06439, CESA_like_1, CESA_like_1 is a member of t 9e-06
TIGR04283220 TIGR04283, glyco_like_mftF, transferase 2, rSAM/se 1e-05
cd06437232 cd06437, CESA_CaSu_A2, Cellulose synthase catalyti 2e-05
cd02522221 cd02522, GT_2_like_a, GT_2_like_a represents a gly 2e-05
cd06427241 cd06427, CESA_like_2, CESA_like_2 is a member of t 4e-05
COG1216305 COG1216, COG1216, Predicted glycosyltransferases [ 5e-05
cd02511229 cd02511, Beta4Glucosyltransferase, UDP-glucose LOS 5e-05
cd04186166 cd04186, GT_2_like_c, Subfamily of Glycosyltransfe 8e-05
cd04186166 cd04186, GT_2_like_c, Subfamily of Glycosyltransfe 8e-05
cd02526237 cd02526, GT2_RfbF_like, RfbF is a putative dTDP-rh 8e-05
cd02526237 cd02526, GT2_RfbF_like, RfbF is a putative dTDP-rh 8e-05
PRK11204420 PRK11204, PRK11204, N-glycosyltransferase; Provisi 1e-04
cd06433202 cd06433, GT_2_WfgS_like, WfgS and WfeV are involve 2e-04
cd04196214 cd04196, GT_2_like_d, Subfamily of Glycosyltransfe 2e-04
TIGR03030 713 TIGR03030, CelA, cellulose synthase catalytic subu 3e-04
cd06421234 cd06421, CESA_CelA_like, CESA_CelA_like are involv 4e-04
cd06434235 cd06434, GT2_HAS, Hyaluronan synthases catalyze po 4e-04
cd06433202 cd06433, GT_2_WfgS_like, WfgS and WfeV are involve 5e-04
PRK13915306 PRK13915, PRK13915, putative glucosyl-3-phosphogly 6e-04
cd06420182 cd06420, GT2_Chondriotin_Pol_N, N-terminal domain 6e-04
cd04196214 cd04196, GT_2_like_d, Subfamily of Glycosyltransfe 7e-04
TIGR03937407 TIGR03937, PgaC_IcaA, poly-beta-1,6 N-acetyl-D-glu 8e-04
TIGR04182293 TIGR04182, glyco_TIGR04182, glycosyltransferase, T 0.002
cd04185202 cd04185, GT_2_like_b, Subfamily of Glycosyltransfe 0.002
cd04185202 cd04185, GT_2_like_b, Subfamily of Glycosyltransfe 0.002
TIGR03965467 TIGR03965, mycofact_glyco, mycofactocin system gly 0.002
TIGR03965 467 TIGR03965, mycofact_glyco, mycofactocin system gly 0.002
cd02510299 cd02510, pp-GalNAc-T, pp-GalNAc-T initiates the fo 0.003
cd02510299 cd02510, pp-GalNAc-T, pp-GalNAc-T initiates the fo 0.003
>gnl|CDD|215385 PLN02726, PLN02726, dolichyl-phosphate beta-D-mannosyltransferase Back     alignment and domain information
 Score =  394 bits (1014), Expect = e-138
 Identities = 154/238 (64%), Positives = 192/238 (80%), Gaps = 1/238 (0%)

Query: 198 VKNKYTVLLPTYNEKENLPIIVYLITKYMDEGNYPYEIIVIDDGSPDGTLDAAKQLQSIY 257
              KY++++PTYNE+ N+ +IVYLI K + +    +EIIV+DDGSPDGT D  KQLQ +Y
Sbjct: 7   GAMKYSIIVPTYNERLNIALIVYLIFKALQDVK-DFEIIVVDDGSPDGTQDVVKQLQKVY 65

Query: 258 GSEKIVLKPRKKKLGLGTAYMHGLKYATGNFIIIMDADLSHHPKFIPEMIKLQQQENLDV 317
           G ++I+L+PR  KLGLGTAY+HGLK+A+G+F++IMDADLSHHPK++P  IK Q++   D+
Sbjct: 66  GEDRILLRPRPGKLGLGTAYIHGLKHASGDFVVIMDADLSHHPKYLPSFIKKQRETGADI 125

Query: 318 VTGTRYVGTGGVYGWDFKRKLVSRGANYLTQLLLRPGVSDLTGSFRLYKKQVLENLVSSC 377
           VTGTRYV  GGV+GWD +RKL SRGAN L Q LL PGVSDLTGSFRLYK+  LE+LVSS 
Sbjct: 126 VTGTRYVKGGGVHGWDLRRKLTSRGANVLAQTLLWPGVSDLTGSFRLYKRSALEDLVSSV 185

Query: 378 VSKGYVFQMEMVIRARQYNYTIGEVPISFVDRVYGESKLGGTEIFQFAKALLYLFATT 435
           VSKGYVFQME+++RA +  Y I EVPI+FVDRVYGESKLGG+EI Q+ K LLYL  TT
Sbjct: 186 VSKGYVFQMEIIVRASRKGYRIEEVPITFVDRVYGESKLGGSEIVQYLKGLLYLLLTT 243


Length = 243

>gnl|CDD|133062 cd06442, DPM1_like, DPM1_like represents putative enzymes similar to eukaryotic DPM1 Back     alignment and domain information
>gnl|CDD|215385 PLN02726, PLN02726, dolichyl-phosphate beta-D-mannosyltransferase Back     alignment and domain information
>gnl|CDD|133062 cd06442, DPM1_like, DPM1_like represents putative enzymes similar to eukaryotic DPM1 Back     alignment and domain information
>gnl|CDD|133022 cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily Back     alignment and domain information
>gnl|CDD|133022 cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily Back     alignment and domain information
>gnl|CDD|133031 cd04188, DPG_synthase, DPG_synthase is involved in protein N-linked glycosylation Back     alignment and domain information
>gnl|CDD|133030 cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1 Back     alignment and domain information
>gnl|CDD|133031 cd04188, DPG_synthase, DPG_synthase is involved in protein N-linked glycosylation Back     alignment and domain information
>gnl|CDD|215980 pfam00535, Glycos_transf_2, Glycosyl transferase family 2 Back     alignment and domain information
>gnl|CDD|215980 pfam00535, Glycos_transf_2, Glycosyl transferase family 2 Back     alignment and domain information
>gnl|CDD|133030 cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1 Back     alignment and domain information
>gnl|CDD|223539 COG0463, WcaA, Glycosyltransferases involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|132997 cd00761, Glyco_tranf_GTA_type, Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold Back     alignment and domain information
>gnl|CDD|240336 PTZ00260, PTZ00260, dolichyl-phosphate beta-glucosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|182669 PRK10714, PRK10714, undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose transferase; Provisional Back     alignment and domain information
>gnl|CDD|132997 cd00761, Glyco_tranf_GTA_type, Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold Back     alignment and domain information
>gnl|CDD|223539 COG0463, WcaA, Glycosyltransferases involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|133045 cd06423, CESA_like, CESA_like is the cellulose synthase superfamily Back     alignment and domain information
>gnl|CDD|240336 PTZ00260, PTZ00260, dolichyl-phosphate beta-glucosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|133016 cd02525, Succinoglycan_BP_ExoA, ExoA is involved in the biosynthesis of succinoglycan Back     alignment and domain information
>gnl|CDD|133045 cd06423, CESA_like, CESA_like is the cellulose synthase superfamily Back     alignment and domain information
>gnl|CDD|133016 cd02525, Succinoglycan_BP_ExoA, ExoA is involved in the biosynthesis of succinoglycan Back     alignment and domain information
>gnl|CDD|222281 pfam13641, Glyco_tranf_2_3, Glycosyltransferase like family 2 Back     alignment and domain information
>gnl|CDD|182669 PRK10714, PRK10714, undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose transferase; Provisional Back     alignment and domain information
>gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|222281 pfam13641, Glyco_tranf_2_3, Glycosyltransferase like family 2 Back     alignment and domain information
>gnl|CDD|133035 cd04192, GT_2_like_e, Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>gnl|CDD|182223 PRK10073, PRK10073, putative glycosyl transferase; Provisional Back     alignment and domain information
>gnl|CDD|133061 cd06439, CESA_like_1, CESA_like_1 is a member of the cellulose synthase (CESA) superfamily Back     alignment and domain information
>gnl|CDD|220577 pfam10111, Glyco_tranf_2_2, Glycosyltransferase like family 2 Back     alignment and domain information
>gnl|CDD|200433 TIGR04182, glyco_TIGR04182, glycosyltransferase, TIGR04182 family Back     alignment and domain information
>gnl|CDD|236882 PRK11204, PRK11204, N-glycosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|224137 COG1216, COG1216, Predicted glycosyltransferases [General function prediction only] Back     alignment and domain information
>gnl|CDD|188452 TIGR03937, PgaC_IcaA, poly-beta-1,6 N-acetyl-D-glucosamine synthase Back     alignment and domain information
>gnl|CDD|237556 PRK13915, PRK13915, putative glucosyl-3-phosphoglycerate synthase; Provisional Back     alignment and domain information
>gnl|CDD|182223 PRK10073, PRK10073, putative glycosyl transferase; Provisional Back     alignment and domain information
>gnl|CDD|220577 pfam10111, Glyco_tranf_2_2, Glycosyltransferase like family 2 Back     alignment and domain information
>gnl|CDD|133043 cd06421, CESA_CelA_like, CESA_CelA_like are involved in the elongation of the glucan chain of cellulose Back     alignment and domain information
>gnl|CDD|133042 cd06420, GT2_Chondriotin_Pol_N, N-terminal domain of Chondroitin polymerase functions as a GalNAc transferase Back     alignment and domain information
>gnl|CDD|133035 cd04192, GT_2_like_e, Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>gnl|CDD|133005 cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide Back     alignment and domain information
>gnl|CDD|213815 TIGR03469, HpnB, hopene-associated glycosyltransferase HpnB Back     alignment and domain information
>gnl|CDD|213815 TIGR03469, HpnB, hopene-associated glycosyltransferase HpnB Back     alignment and domain information
>gnl|CDD|133061 cd06439, CESA_like_1, CESA_like_1 is a member of the cellulose synthase (CESA) superfamily Back     alignment and domain information
>gnl|CDD|234532 TIGR04283, glyco_like_mftF, transferase 2, rSAM/selenodomain-associated Back     alignment and domain information
>gnl|CDD|133059 cd06437, CESA_CaSu_A2, Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex Back     alignment and domain information
>gnl|CDD|133013 cd02522, GT_2_like_a, GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function Back     alignment and domain information
>gnl|CDD|133049 cd06427, CESA_like_2, CESA_like_2 is a member of the cellulose synthase superfamily Back     alignment and domain information
>gnl|CDD|224137 COG1216, COG1216, Predicted glycosyltransferases [General function prediction only] Back     alignment and domain information
>gnl|CDD|133005 cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide Back     alignment and domain information
>gnl|CDD|133029 cd04186, GT_2_like_c, Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>gnl|CDD|133029 cd04186, GT_2_like_c, Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>gnl|CDD|133017 cd02526, GT2_RfbF_like, RfbF is a putative dTDP-rhamnosyl transferase Back     alignment and domain information
>gnl|CDD|133017 cd02526, GT2_RfbF_like, RfbF is a putative dTDP-rhamnosyl transferase Back     alignment and domain information
>gnl|CDD|236882 PRK11204, PRK11204, N-glycosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|133055 cd06433, GT_2_WfgS_like, WfgS and WfeV are involved in O-antigen biosynthesis Back     alignment and domain information
>gnl|CDD|133039 cd04196, GT_2_like_d, Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>gnl|CDD|234095 TIGR03030, CelA, cellulose synthase catalytic subunit (UDP-forming) Back     alignment and domain information
>gnl|CDD|133043 cd06421, CESA_CelA_like, CESA_CelA_like are involved in the elongation of the glucan chain of cellulose Back     alignment and domain information
>gnl|CDD|133056 cd06434, GT2_HAS, Hyaluronan synthases catalyze polymerization of hyaluronan Back     alignment and domain information
>gnl|CDD|133055 cd06433, GT_2_WfgS_like, WfgS and WfeV are involved in O-antigen biosynthesis Back     alignment and domain information
>gnl|CDD|237556 PRK13915, PRK13915, putative glucosyl-3-phosphoglycerate synthase; Provisional Back     alignment and domain information
>gnl|CDD|133042 cd06420, GT2_Chondriotin_Pol_N, N-terminal domain of Chondroitin polymerase functions as a GalNAc transferase Back     alignment and domain information
>gnl|CDD|133039 cd04196, GT_2_like_d, Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>gnl|CDD|188452 TIGR03937, PgaC_IcaA, poly-beta-1,6 N-acetyl-D-glucosamine synthase Back     alignment and domain information
>gnl|CDD|200433 TIGR04182, glyco_TIGR04182, glycosyltransferase, TIGR04182 family Back     alignment and domain information
>gnl|CDD|133028 cd04185, GT_2_like_b, Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>gnl|CDD|133028 cd04185, GT_2_like_b, Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>gnl|CDD|234419 TIGR03965, mycofact_glyco, mycofactocin system glycosyltransferase Back     alignment and domain information
>gnl|CDD|234419 TIGR03965, mycofact_glyco, mycofactocin system glycosyltransferase Back     alignment and domain information
>gnl|CDD|133004 cd02510, pp-GalNAc-T, pp-GalNAc-T initiates the formation of mucin-type O-linked glycans Back     alignment and domain information
>gnl|CDD|133004 cd02510, pp-GalNAc-T, pp-GalNAc-T initiates the formation of mucin-type O-linked glycans Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 435
KOG2978|consensus238 100.0
PLN02726243 dolichyl-phosphate beta-D-mannosyltransferase 100.0
PTZ00260333 dolichyl-phosphate beta-glucosyltransferase; Provi 100.0
cd06442224 DPM1_like DPM1_like represents putative enzymes si 100.0
PRK10714325 undecaprenyl phosphate 4-deoxy-4-formamido-L-arabi 99.98
cd04188211 DPG_synthase DPG_synthase is involved in protein N 99.97
KOG2978|consensus238 99.97
cd02520196 Glucosylceramide_synthase Glucosylceramide synthas 99.97
cd06427241 CESA_like_2 CESA_like_2 is a member of the cellulo 99.96
cd02510299 pp-GalNAc-T pp-GalNAc-T initiates the formation of 99.95
PRK11204 420 N-glycosyltransferase; Provisional 99.95
cd06437232 CESA_CaSu_A2 Cellulose synthase catalytic subunit 99.95
TIGR03472373 HpnI hopanoid biosynthesis associated glycosyl tra 99.95
PRK14583 444 hmsR N-glycosyltransferase; Provisional 99.95
cd06421234 CESA_CelA_like CESA_CelA_like are involved in the 99.95
PLN02726243 dolichyl-phosphate beta-D-mannosyltransferase 99.95
TIGR03111 439 glyc2_xrt_Gpos1 putative glycosyltransferase TIGR0 99.94
PF13641228 Glyco_tranf_2_3: Glycosyltransferase like family 2 99.94
cd06439251 CESA_like_1 CESA_like_1 is a member of the cellulo 99.94
cd06435236 CESA_NdvC_like NdvC_like proteins in this family a 99.94
PRK13915306 putative glucosyl-3-phosphoglycerate synthase; Pro 99.94
TIGR03469384 HonB hopene-associated glycosyltransferase HpnB. T 99.93
cd04184202 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like prot 99.93
cd04188211 DPG_synthase DPG_synthase is involved in protein N 99.93
cd04179185 DPM_DPG-synthase_like DPM_DPG-synthase_like is a m 99.93
cd02525249 Succinoglycan_BP_ExoA ExoA is involved in the bios 99.93
PRK10063248 putative glycosyl transferase; Provisional 99.93
cd06913219 beta3GnTL1_like Beta 1, 3-N-acetylglucosaminyltran 99.93
PTZ00260333 dolichyl-phosphate beta-glucosyltransferase; Provi 99.93
cd04187181 DPM1_like_bac Bacterial DPM1_like enzymes are rela 99.93
cd04192229 GT_2_like_e Subfamily of Glycosyltransferase Famil 99.93
PRK10073328 putative glycosyl transferase; Provisional 99.92
PRK11498 852 bcsA cellulose synthase catalytic subunit; Provisi 99.92
cd06433202 GT_2_WfgS_like WfgS and WfeV are involved in O-ant 99.92
cd06442224 DPM1_like DPM1_like represents putative enzymes si 99.92
cd06434235 GT2_HAS Hyaluronan synthases catalyze polymerizati 99.92
cd04195201 GT2_AmsE_like GT2_AmsE_like is involved in exopoly 99.92
KOG2977|consensus323 99.91
TIGR03030 713 CelA cellulose synthase catalytic subunit (UDP-for 99.91
cd04185202 GT_2_like_b Subfamily of Glycosyltransferase Famil 99.91
cd04196214 GT_2_like_d Subfamily of Glycosyltransferase Famil 99.91
COG1216305 Predicted glycosyltransferases [General function p 99.91
PRK10018279 putative glycosyl transferase; Provisional 99.91
cd02522221 GT_2_like_a GT_2_like_a represents a glycosyltrans 99.9
PRK14716 504 bacteriophage N4 adsorption protein B; Provisional 99.9
COG1215 439 Glycosyltransferases, probably involved in cell wa 99.9
cd06420182 GT2_Chondriotin_Pol_N N-terminal domain of Chondro 99.9
cd02526237 GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl tr 99.9
cd04186166 GT_2_like_c Subfamily of Glycosyltransferase Famil 99.89
cd04191254 Glucan_BSP_ModH Glucan_BSP_ModH catalyzes the elon 99.89
PF00535169 Glycos_transf_2: Glycosyl transferase family 2; In 99.88
cd04190244 Chitin_synth_C C-terminal domain of Chitin Synthas 99.87
PRK10714325 undecaprenyl phosphate 4-deoxy-4-formamido-L-arabi 99.87
TIGR01556281 rhamnosyltran L-rhamnosyltransferase. Rhamnolipids 99.86
cd06438183 EpsO_like EpsO protein participates in the methano 99.86
PRK11234 727 nfrB bacteriophage N4 adsorption protein B; Provis 99.85
PF10111281 Glyco_tranf_2_2: Glycosyltransferase like family 2 99.85
cd06913219 beta3GnTL1_like Beta 1, 3-N-acetylglucosaminyltran 99.85
cd04179185 DPM_DPG-synthase_like DPM_DPG-synthase_like is a m 99.84
cd02520196 Glucosylceramide_synthase Glucosylceramide synthas 99.84
cd02510299 pp-GalNAc-T pp-GalNAc-T initiates the formation of 99.84
cd06436191 GlcNAc-1-P_transferase N-acetyl-glucosamine transf 99.83
cd04195201 GT2_AmsE_like GT2_AmsE_like is involved in exopoly 99.82
cd04187181 DPM1_like_bac Bacterial DPM1_like enzymes are rela 99.82
cd06427241 CESA_like_2 CESA_like_2 is a member of the cellulo 99.82
PRK10073328 putative glycosyl transferase; Provisional 99.8
cd06423180 CESA_like CESA_like is the cellulose synthase supe 99.8
cd04192229 GT_2_like_e Subfamily of Glycosyltransferase Famil 99.8
cd06433202 GT_2_WfgS_like WfgS and WfeV are involved in O-ant 99.79
cd04184202 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like prot 99.79
TIGR03472373 HpnI hopanoid biosynthesis associated glycosyl tra 99.79
cd06437232 CESA_CaSu_A2 Cellulose synthase catalytic subunit 99.79
PRK05454 691 glucosyltransferase MdoH; Provisional 99.79
TIGR03469384 HonB hopene-associated glycosyltransferase HpnB. T 99.79
cd06421234 CESA_CelA_like CESA_CelA_like are involved in the 99.78
PRK15489 703 nfrB bacteriophage N4 adsorption protein B; Provis 99.78
cd04196214 GT_2_like_d Subfamily of Glycosyltransferase Famil 99.78
cd02525249 Succinoglycan_BP_ExoA ExoA is involved in the bios 99.77
PRK11204420 N-glycosyltransferase; Provisional 99.77
PRK13915306 putative glucosyl-3-phosphoglycerate synthase; Pro 99.76
cd04185202 GT_2_like_b Subfamily of Glycosyltransferase Famil 99.76
cd06439251 CESA_like_1 CESA_like_1 is a member of the cellulo 99.76
PRK10063248 putative glycosyl transferase; Provisional 99.76
PRK14583444 hmsR N-glycosyltransferase; Provisional 99.76
cd06435236 CESA_NdvC_like NdvC_like proteins in this family a 99.76
cd06420182 GT2_Chondriotin_Pol_N N-terminal domain of Chondro 99.75
PRK10018279 putative glycosyl transferase; Provisional 99.75
PF13641228 Glyco_tranf_2_3: Glycosyltransferase like family 2 99.74
PF00535169 Glycos_transf_2: Glycosyl transferase family 2; In 99.74
KOG2977|consensus323 99.74
TIGR03111439 glyc2_xrt_Gpos1 putative glycosyltransferase TIGR0 99.74
cd02526237 GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl tr 99.73
cd04186166 GT_2_like_c Subfamily of Glycosyltransferase Famil 99.72
cd06434235 GT2_HAS Hyaluronan synthases catalyze polymerizati 99.71
TIGR01556281 rhamnosyltran L-rhamnosyltransferase. Rhamnolipids 99.7
cd02522221 GT_2_like_a GT_2_like_a represents a glycosyltrans 99.67
cd06438183 EpsO_like EpsO protein participates in the methano 99.67
cd02511229 Beta4Glucosyltransferase UDP-glucose LOS-beta-1,4 99.67
PRK11498 852 bcsA cellulose synthase catalytic subunit; Provisi 99.65
cd00761156 Glyco_tranf_GTA_type Glycosyltransferase family A 99.65
TIGR03030 713 CelA cellulose synthase catalytic subunit (UDP-for 99.65
PRK14716504 bacteriophage N4 adsorption protein B; Provisional 99.64
COG1216305 Predicted glycosyltransferases [General function p 99.64
PF10111281 Glyco_tranf_2_2: Glycosyltransferase like family 2 99.62
COG1215439 Glycosyltransferases, probably involved in cell wa 99.62
cd06423180 CESA_like CESA_like is the cellulose synthase supe 99.6
cd06436191 GlcNAc-1-P_transferase N-acetyl-glucosamine transf 99.6
COG0463291 WcaA Glycosyltransferases involved in cell wall bi 99.57
cd04191254 Glucan_BSP_ModH Glucan_BSP_ModH catalyzes the elon 99.53
PF13506175 Glyco_transf_21: Glycosyl transferase family 21 99.51
PRK11234 727 nfrB bacteriophage N4 adsorption protein B; Provis 99.45
cd04190244 Chitin_synth_C C-terminal domain of Chitin Synthas 99.44
KOG3737|consensus 603 99.41
KOG3738|consensus 559 99.38
KOG3736|consensus 578 99.37
cd02511229 Beta4Glucosyltransferase UDP-glucose LOS-beta-1,4 99.35
cd00761156 Glyco_tranf_GTA_type Glycosyltransferase family A 99.31
PRK15489 703 nfrB bacteriophage N4 adsorption protein B; Provis 99.28
PRK05454691 glucosyltransferase MdoH; Provisional 99.19
PF13632193 Glyco_trans_2_3: Glycosyl transferase family group 99.17
KOG2547|consensus 431 99.15
PF13712217 Glyco_tranf_2_5: Glycosyltransferase like family; 99.12
COG0463291 WcaA Glycosyltransferases involved in cell wall bi 99.09
KOG3738|consensus559 99.08
PF13506175 Glyco_transf_21: Glycosyl transferase family 21 99.07
KOG3736|consensus578 98.99
KOG3737|consensus603 98.92
cd02514334 GT13_GLCNAC-TI GT13_GLCNAC-TI is involved in an es 98.91
cd00899219 b4GalT Beta-4-Galactosyltransferase is involved in 98.67
PF03142 527 Chitin_synth_2: Chitin synthase; InterPro: IPR0048 98.64
PF13632193 Glyco_trans_2_3: Glycosyl transferase family group 98.5
PLN02893 734 Cellulose synthase-like protein 98.43
COG4092346 Predicted glycosyltransferase involved in capsule 98.4
PF13712217 Glyco_tranf_2_5: Glycosyltransferase like family; 98.21
KOG2571|consensus 862 97.96
PF05679499 CHGN: Chondroitin N-acetylgalactosaminyltransferas 97.96
KOG2547|consensus431 97.95
PF1370497 Glyco_tranf_2_4: Glycosyl transferase family 2 97.88
cd02514334 GT13_GLCNAC-TI GT13_GLCNAC-TI is involved in an es 97.84
PF1370497 Glyco_tranf_2_4: Glycosyl transferase family 2 97.81
COG2943 736 MdoH Membrane glycosyltransferase [Cell envelope b 97.79
PF03071 434 GNT-I: GNT-I family; InterPro: IPR004139 The biosy 97.75
PRK14503393 mannosyl-3-phosphoglycerate synthase; Provisional 97.73
TIGR02460381 osmo_MPGsynth mannosyl-3-phosphoglycerate synthase 97.72
PF03452269 Anp1: Anp1; InterPro: IPR005109 The members of thi 97.55
KOG3916|consensus372 97.53
PF09488381 Osmo_MPGsynth: Mannosyl-3-phosphoglycerate synthas 97.34
PF11735241 CAP59_mtransfer: Cryptococcal mannosyltransferase 97.32
PF06306347 CgtA: Beta-1,4-N-acetylgalactosaminyltransferase ( 97.04
KOG3588|consensus494 96.93
COG4092346 Predicted glycosyltransferase involved in capsule 96.91
PLN02893734 Cellulose synthase-like protein 96.83
PF0270978 Glyco_transf_7C: N-terminal domain of galactosyltr 96.82
PLN02189 1040 cellulose synthase 96.76
PRK14502 694 bifunctional mannosyl-3-phosphoglycerate synthase/ 96.6
PF01762195 Galactosyl_T: Galactosyltransferase; InterPro: IPR 96.54
cd06915223 NTP_transferase_WcbM_like WcbM_like is a subfamily 96.53
cd04181217 NTP_transferase NTP_transferases catalyze the tran 96.3
cd02508200 ADP_Glucose_PP ADP-glucose pyrophosphorylase is in 96.13
cd06428257 M1P_guanylylT_A_like_N N-terminal domain of M1P_gu 96.06
PF11316234 Rhamno_transf: Putative rhamnosyl transferase ; In 96.03
PLN02917293 CMP-KDO synthetase 96.02
cd00899219 b4GalT Beta-4-Galactosyltransferase is involved in 95.99
PRK05450245 3-deoxy-manno-octulosonate cytidylyltransferase; P 95.98
PLN02458346 transferase, transferring glycosyl groups 95.94
PLN02638 1079 cellulose synthase A (UDP-forming), catalytic subu 95.82
cd00218223 GlcAT-I Beta1,3-glucuronyltransferase I (GlcAT-I) 95.73
PF12804160 NTP_transf_3: MobA-like NTP transferase domain; PD 95.69
KOG1413|consensus 411 95.64
PLN02195 977 cellulose synthase A 95.58
PF11397343 GlcNAc: Glycosyltransferase (GlcNAc); InterPro: IP 95.49
PF03452269 Anp1: Anp1; InterPro: IPR005109 The members of thi 95.47
PLN02248 1135 cellulose synthase-like protein 95.34
cd02517239 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes th 95.34
KOG2571|consensus862 95.28
PF03214 348 RGP: Reversibly glycosylated polypeptide; InterPro 95.27
cd02516218 CDP-ME_synthetase CDP-ME synthetase is involved in 95.22
cd04182186 GT_2_like_f GT_2_like_f is a subfamily of the glyc 94.83
PF11735241 CAP59_mtransfer: Cryptococcal mannosyltransferase 94.8
PF05679499 CHGN: Chondroitin N-acetylgalactosaminyltransferas 94.74
PF13733136 Glyco_transf_7N: N-terminal region of glycosyl tra 94.73
PRK00317193 mobA molybdopterin-guanine dinucleotide biosynthes 94.39
cd06915223 NTP_transferase_WcbM_like WcbM_like is a subfamily 94.28
TIGR02460381 osmo_MPGsynth mannosyl-3-phosphoglycerate synthase 94.13
PF09258247 Glyco_transf_64: Glycosyl transferase family 64 do 94.1
cd06425233 M1P_guanylylT_B_like_N N-terminal domain of the M1 94.01
cd04189236 G1P_TT_long G1P_TT_long represents the long form o 93.95
cd02513223 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N- 93.91
PRK14503393 mannosyl-3-phosphoglycerate synthase; Provisional 93.88
PF11316234 Rhamno_transf: Putative rhamnosyl transferase ; In 93.86
COG1209286 RfbA dTDP-glucose pyrophosphorylase [Cell envelope 93.83
cd04181217 NTP_transferase NTP_transferases catalyze the tran 93.82
cd06422221 NTP_transferase_like_1 NTP_transferase_like_1 is a 93.81
TIGR00466238 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransfe 93.8
PLN02190 756 cellulose synthase-like protein 93.76
cd06426220 NTP_transferase_like_2 NTP_trnasferase_like_2 is a 93.7
cd02503181 MobA MobA catalyzes the formation of molybdopterin 93.62
KOG1476|consensus330 93.52
KOG2287|consensus349 93.5
PF03142527 Chitin_synth_2: Chitin synthase; InterPro: IPR0048 93.47
PRK14352 482 glmU bifunctional N-acetylglucosamine-1-phosphate 93.38
cd02540229 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU 93.27
PF12804160 NTP_transf_3: MobA-like NTP transferase domain; PD 93.16
PF06306347 CgtA: Beta-1,4-N-acetylgalactosaminyltransferase ( 93.07
TIGR03202190 pucB xanthine dehydrogenase accessory protein pucB 93.05
PLN02189 1040 cellulose synthase 92.99
TIGR02665186 molyb_mobA molybdopterin-guanine dinucleotide bios 92.79
TIGR03202190 pucB xanthine dehydrogenase accessory protein pucB 92.73
KOG3917|consensus310 92.56
PRK00155227 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl 92.55
PRK05293 380 glgC glucose-1-phosphate adenylyltransferase; Prov 92.49
COG1213239 Predicted sugar nucleotidyltransferases [Cell enve 92.29
TIGR01208 353 rmlA_long glucose-1-phosphate thymidylylransferase 92.19
PF05060356 MGAT2: N-acetylglucosaminyltransferase II (MGAT2); 92.18
COG1208 358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas 92.07
PF05045498 RgpF: Rhamnan synthesis protein F; InterPro: IPR00 92.06
PRK13368238 3-deoxy-manno-octulosonate cytidylyltransferase; P 91.98
PLN02458346 transferase, transferring glycosyl groups 91.82
PF00483248 NTP_transferase: Nucleotidyl transferase This Pros 91.8
PRK13385230 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 91.68
PF04666297 Glyco_transf_54: N-Acetylglucosaminyltransferase-I 91.68
cd02509274 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransf 91.45
PRK14489 366 putative bifunctional molybdopterin-guanine dinucl 91.44
cd04182186 GT_2_like_f GT_2_like_f is a subfamily of the glyc 91.31
TIGR01207286 rmlA glucose-1-phosphate thymidylyltransferase, sh 91.14
TIGR01105297 galF UTP-glucose-1-phosphate uridylyltransferase, 90.97
PRK02726200 molybdopterin-guanine dinucleotide biosynthesis pr 90.89
TIGR03310188 matur_ygfJ molybdenum hydroxylase accessory protei 90.77
PF01697285 Glyco_transf_92: Glycosyltransferase family 92; In 90.69
PF09488381 Osmo_MPGsynth: Mannosyl-3-phosphoglycerate synthas 90.61
PF02434252 Fringe: Fringe-like; InterPro: IPR003378 The Notch 90.61
PLN02195 977 cellulose synthase A 90.42
PF0270978 Glyco_transf_7C: N-terminal domain of galactosyltr 90.33
TIGR02665186 molyb_mobA molybdopterin-guanine dinucleotide bios 90.32
PRK15480292 glucose-1-phosphate thymidylyltransferase RfbA; Pr 90.29
PLN02915 1044 cellulose synthase A [UDP-forming], catalytic subu 90.27
PLN03180346 reversibly glycosylated polypeptide; Provisional 90.18
PLN02638 1079 cellulose synthase A (UDP-forming), catalytic subu 89.79
cd02518233 GT2_SpsF SpsF is a glycosyltrnasferase implicated 89.77
cd02524253 G1P_cytidylyltransferase G1P_cytidylyltransferase 89.46
cd00218223 GlcAT-I Beta1,3-glucuronyltransferase I (GlcAT-I) 89.35
TIGR03310188 matur_ygfJ molybdenum hydroxylase accessory protei 89.22
COG1213239 Predicted sugar nucleotidyltransferases [Cell enve 89.2
cd02523229 PC_cytidylyltransferase Phosphocholine cytidylyltr 89.15
cd02540229 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU 89.13
cd02503181 MobA MobA catalyzes the formation of molybdopterin 89.03
cd02538240 G1P_TT_short G1P_TT_short is the short form of glu 88.76
KOG3588|consensus494 88.7
PLN03153537 hypothetical protein; Provisional 88.7
PLN02400 1085 cellulose synthase 88.54
PF01762195 Galactosyl_T: Galactosyltransferase; InterPro: IPR 88.44
cd04198214 eIF-2B_gamma_N The N-terminal domain of gamma subu 88.41
cd04183231 GT2_BcE_like GT2_BcbE_like is likely involved in t 88.35
TIGR03584222 PseF pseudaminic acid CMP-transferase. The sequenc 88.33
PF11397343 GlcNAc: Glycosyltransferase (GlcNAc); InterPro: IP 88.19
PRK00317193 mobA molybdopterin-guanine dinucleotide biosynthes 88.17
TIGR01099260 galU UTP-glucose-1-phosphate uridylyltransferase. 88.13
PRK10122297 GalU regulator GalF; Provisional 88.1
TIGR00453217 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl 87.97
COG1209286 RfbA dTDP-glucose pyrophosphorylase [Cell envelope 87.89
TIGR00466238 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransfe 87.62
PRK14357 448 glmU bifunctional N-acetylglucosamine-1-phosphate 87.4
PF01644163 Chitin_synth_1: Chitin synthase; InterPro: IPR0048 87.13
cd06422221 NTP_transferase_like_1 NTP_transferase_like_1 is a 87.02
TIGR02623254 G1P_cyt_trans glucose-1-phosphate cytidylyltransfe 87.0
PF02434252 Fringe: Fringe-like; InterPro: IPR003378 The Notch 86.95
cd02508200 ADP_Glucose_PP ADP-glucose pyrophosphorylase is in 86.46
PLN02241 436 glucose-1-phosphate adenylyltransferase 86.38
cd02518233 GT2_SpsF SpsF is a glycosyltrnasferase implicated 86.36
COG0746192 MobA Molybdopterin-guanine dinucleotide biosynthes 86.32
cd06425233 M1P_guanylylT_B_like_N N-terminal domain of the M1 86.2
COG2068199 Uncharacterized MobA-related protein [General func 86.16
PLN02248 1135 cellulose synthase-like protein 85.93
PF03360207 Glyco_transf_43: Glycosyltransferase family 43; In 85.79
COG1207 460 GlmU N-acetylglucosamine-1-phosphate uridyltransfe 85.69
PRK14358 481 glmU bifunctional N-acetylglucosamine-1-phosphate 85.54
cd02541267 UGPase_prokaryotic Prokaryotic UGPase catalyses th 85.31
TIGR03552195 F420_cofC 2-phospho-L-lactate guanylyltransferase 85.28
PRK14502 694 bifunctional mannosyl-3-phosphoglycerate synthase/ 85.28
cd02516218 CDP-ME_synthetase CDP-ME synthetase is involved in 84.89
TIGR03552195 F420_cofC 2-phospho-L-lactate guanylyltransferase 84.69
PRK00576178 molybdopterin-guanine dinucleotide biosynthesis pr 84.59
PRK14355 459 glmU bifunctional N-acetylglucosamine-1-phosphate 84.45
PF01697285 Glyco_transf_92: Glycosyltransferase family 92; In 84.32
PF09837122 DUF2064: Uncharacterized protein conserved in bact 84.21
PRK05450245 3-deoxy-manno-octulosonate cytidylyltransferase; P 84.03
PRK13385230 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 83.9
PLN02436 1094 cellulose synthase A 83.66
PRK14359 430 glmU bifunctional N-acetylglucosamine-1-phosphate 83.33
cd06431280 GT8_LARGE_C LARGE catalytic domain has closest hom 83.27
cd06428257 M1P_guanylylT_A_like_N N-terminal domain of M1P_gu 83.27
TIGR01173 451 glmU UDP-N-acetylglucosamine diphosphorylase/gluco 83.09
cd02538240 G1P_TT_short G1P_TT_short is the short form of glu 83.06
PF03552 720 Cellulose_synt: Cellulose synthase; InterPro: IPR0 83.06
PLN03153 537 hypothetical protein; Provisional 82.98
COG1210291 GalU UDP-glucose pyrophosphorylase [Cell envelope 82.53
PRK14489366 putative bifunctional molybdopterin-guanine dinucl 82.52
PRK09382 378 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosp 81.96
PF03071434 GNT-I: GNT-I family; InterPro: IPR004139 The biosy 81.95
PRK14352482 glmU bifunctional N-acetylglucosamine-1-phosphate 81.7
cd04198214 eIF-2B_gamma_N The N-terminal domain of gamma subu 81.18
cd02517239 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes th 81.12
KOG1476|consensus330 80.8
PRK02726200 molybdopterin-guanine dinucleotide biosynthesis pr 80.33
PRK14353 446 glmU bifunctional N-acetylglucosamine-1-phosphate 80.08
>KOG2978|consensus Back     alignment and domain information
Probab=100.00  E-value=5.2e-41  Score=263.41  Aligned_cols=237  Identities=72%  Similarity=1.190  Sum_probs=226.9

Q ss_pred             CcceEEEEeccCCCCChHHHHHHHHHHhhcCCCCeEEEEEeCCCCcchHHHHHHHHHHhCCceEEEecCCCCCCHHHHHH
Q psy3650         199 KNKYTVLLPTYNEKENLPIIVYLITKYMDEGNYPYEIIVIDDGSPDGTLDAAKQLQSIYGSEKIVLKPRKKKLGLGTAYM  278 (435)
Q Consensus       199 ~~~isivip~~n~~~~l~~~l~~l~~~~~~~~~~~eiivvdd~s~d~t~~~~~~~~~~~~~~~i~~~~~~~n~g~~~a~n  278 (435)
                      .+++||++|+|||.++++-++.-+...+.+...++|||+|||+|+|.|.+.++.+++.+..-++.+.+.....|.+.|..
T Consensus         2 ~~kYsvilPtYnEk~Nlpi~~~li~~~~~e~~~~~eiIivDD~SpDGt~~~a~~L~k~yg~d~i~l~pR~~klGLgtAy~   81 (238)
T KOG2978|consen    2 SIKYSVILPTYNEKENLPIITRLIAKYMSEEGKKYEIIIVDDASPDGTQEVAKALQKIYGEDNILLKPRTKKLGLGTAYI   81 (238)
T ss_pred             CcceeEEeccccCCCCCeeeHHHHHhhhhhhcCceEEEEEeCCCCCccHHHHHHHHHHhCCCcEEEEeccCcccchHHHH
Confidence            57899999999999999988888888888878899999999999999999999999988888999999999999999999


Q ss_pred             HHHhhccCCEEEEEeCCCCCCCccHHHHHHHHhcCCCceEEeeeEECCCceeccchhHHHHHHHHHHHHHHhcCCCcccc
Q psy3650         279 HGLKYATGNFIIIMDADLSHHPKFIPEMIKLQQQENLDVVTGTRYVGTGGVYGWDFKRKLVSRGANYLTQLLLRPGVSDL  358 (435)
Q Consensus       279 ~g~~~a~~d~v~~~d~D~~~~~~~l~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  358 (435)
                      .|+++|+|+|+++||+|..++|..+.++++..+++..|+|.|.|+..+++..+|+..|+.+++..+.+.+..++....+.
T Consensus        82 hgl~~a~g~fiviMDaDlsHhPk~ipe~i~lq~~~~~div~GTRYa~~ggV~gW~mkRk~IS~gAn~la~~ll~~~~sdl  161 (238)
T KOG2978|consen   82 HGLKHATGDFIVIMDADLSHHPKFIPEFIRLQKEGNYDIVLGTRYAGGGGVYGWDMKRKIISRGANFLARILLNPGVSDL  161 (238)
T ss_pred             hhhhhccCCeEEEEeCccCCCchhHHHHHHHhhccCcceeeeeeEcCCCceecchhhHHHHhhhhHHHHHHhccCCCccC
Confidence            99999999999999999999999999999999888899999999999999999999999999999999999999999999


Q ss_pred             ccceeeecHHHHHHhhhcccCcccchhhHHHHHHHHCCCcEEEeeeEEeecccccccCCHHHHHHHHHHHHHHhhcC
Q psy3650         359 TGSFRLYKKQVLENLVSSCVSKGYVFQMEMVIRARQYNYTIGEVPISFVDRVYGESKLGGTEIFQFAKALLYLFATT  435 (435)
Q Consensus       359 ~~~~~~~~r~~~~~~~~~~~~~~~~~D~el~lr~~~~G~~i~~~p~~~~~~~~~~s~~~~~~~~~~~~~~~~~f~~~  435 (435)
                      +|+|+++++++++..-....+.+|-+.+||..|+.+.||.|.+||++++.|..|.|+.+...+..+++.++.+|++|
T Consensus       162 tGsFrLykk~vl~~li~e~vSkGyvfqmEll~ra~~~~y~IgEvPitFvdR~~GeSKLg~~eIv~ylk~l~~Lf~~~  238 (238)
T KOG2978|consen  162 TGSFRLYKKEVLEKLIEESVSKGYVFQMELLARARQHGYTIGEVPITFVDRTYGESKLGGKEIVQYLKGLLYLFAFT  238 (238)
T ss_pred             cceeeeehHHHHHhhHHHhhccchhhhHHHHHhccccCceEeecceEEEeeccccccccHHHHHHHHHHHhhheeeC
Confidence            99999999999999876778899999999999999999999999999999999999999999999999999999876



>PLN02726 dolichyl-phosphate beta-D-mannosyltransferase Back     alignment and domain information
>PTZ00260 dolichyl-phosphate beta-glucosyltransferase; Provisional Back     alignment and domain information
>cd06442 DPM1_like DPM1_like represents putative enzymes similar to eukaryotic DPM1 Back     alignment and domain information
>PRK10714 undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose transferase; Provisional Back     alignment and domain information
>cd04188 DPG_synthase DPG_synthase is involved in protein N-linked glycosylation Back     alignment and domain information
>KOG2978|consensus Back     alignment and domain information
>cd02520 Glucosylceramide_synthase Glucosylceramide synthase catalyzes the first glycosylation step of glycosphingolipid synthesis Back     alignment and domain information
>cd06427 CESA_like_2 CESA_like_2 is a member of the cellulose synthase superfamily Back     alignment and domain information
>cd02510 pp-GalNAc-T pp-GalNAc-T initiates the formation of mucin-type O-linked glycans Back     alignment and domain information
>PRK11204 N-glycosyltransferase; Provisional Back     alignment and domain information
>cd06437 CESA_CaSu_A2 Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex Back     alignment and domain information
>TIGR03472 HpnI hopanoid biosynthesis associated glycosyl transferase protein HpnI Back     alignment and domain information
>PRK14583 hmsR N-glycosyltransferase; Provisional Back     alignment and domain information
>cd06421 CESA_CelA_like CESA_CelA_like are involved in the elongation of the glucan chain of cellulose Back     alignment and domain information
>PLN02726 dolichyl-phosphate beta-D-mannosyltransferase Back     alignment and domain information
>TIGR03111 glyc2_xrt_Gpos1 putative glycosyltransferase TIGR03111 Back     alignment and domain information
>PF13641 Glyco_tranf_2_3: Glycosyltransferase like family 2; PDB: 4FIY_B 4FIX_A Back     alignment and domain information
>cd06439 CESA_like_1 CESA_like_1 is a member of the cellulose synthase (CESA) superfamily Back     alignment and domain information
>cd06435 CESA_NdvC_like NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase Back     alignment and domain information
>PRK13915 putative glucosyl-3-phosphoglycerate synthase; Provisional Back     alignment and domain information
>TIGR03469 HonB hopene-associated glycosyltransferase HpnB Back     alignment and domain information
>cd04184 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis Back     alignment and domain information
>cd04188 DPG_synthase DPG_synthase is involved in protein N-linked glycosylation Back     alignment and domain information
>cd04179 DPM_DPG-synthase_like DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily Back     alignment and domain information
>cd02525 Succinoglycan_BP_ExoA ExoA is involved in the biosynthesis of succinoglycan Back     alignment and domain information
>PRK10063 putative glycosyl transferase; Provisional Back     alignment and domain information
>cd06913 beta3GnTL1_like Beta 1, 3-N-acetylglucosaminyltransferase is essential for the formation of poly-N-acetyllactosamine Back     alignment and domain information
>PTZ00260 dolichyl-phosphate beta-glucosyltransferase; Provisional Back     alignment and domain information
>cd04187 DPM1_like_bac Bacterial DPM1_like enzymes are related to eukaryotic DPM1 Back     alignment and domain information
>cd04192 GT_2_like_e Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>PRK10073 putative glycosyl transferase; Provisional Back     alignment and domain information
>PRK11498 bcsA cellulose synthase catalytic subunit; Provisional Back     alignment and domain information
>cd06433 GT_2_WfgS_like WfgS and WfeV are involved in O-antigen biosynthesis Back     alignment and domain information
>cd06442 DPM1_like DPM1_like represents putative enzymes similar to eukaryotic DPM1 Back     alignment and domain information
>cd06434 GT2_HAS Hyaluronan synthases catalyze polymerization of hyaluronan Back     alignment and domain information
>cd04195 GT2_AmsE_like GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis Back     alignment and domain information
>KOG2977|consensus Back     alignment and domain information
>TIGR03030 CelA cellulose synthase catalytic subunit (UDP-forming) Back     alignment and domain information
>cd04185 GT_2_like_b Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd04196 GT_2_like_d Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>COG1216 Predicted glycosyltransferases [General function prediction only] Back     alignment and domain information
>PRK10018 putative glycosyl transferase; Provisional Back     alignment and domain information
>cd02522 GT_2_like_a GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function Back     alignment and domain information
>PRK14716 bacteriophage N4 adsorption protein B; Provisional Back     alignment and domain information
>COG1215 Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd06420 GT2_Chondriotin_Pol_N N-terminal domain of Chondroitin polymerase functions as a GalNAc transferase Back     alignment and domain information
>cd02526 GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl transferase Back     alignment and domain information
>cd04186 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd04191 Glucan_BSP_ModH Glucan_BSP_ModH catalyzes the elongation of beta-1,2 polyglucose chains of glucan Back     alignment and domain information
>PF00535 Glycos_transf_2: Glycosyl transferase family 2; InterPro: IPR001173 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>cd04190 Chitin_synth_C C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin Back     alignment and domain information
>PRK10714 undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose transferase; Provisional Back     alignment and domain information
>TIGR01556 rhamnosyltran L-rhamnosyltransferase Back     alignment and domain information
>cd06438 EpsO_like EpsO protein participates in the methanolan synthesis Back     alignment and domain information
>PRK11234 nfrB bacteriophage N4 adsorption protein B; Provisional Back     alignment and domain information
>PF10111 Glyco_tranf_2_2: Glycosyltransferase like family 2; InterPro: IPR019290 This conserved domain is found in a set of prokaryotic proteins including putative glucosyltransferases, which are involved in bacterial capsule biosynthesis [, ] Back     alignment and domain information
>cd06913 beta3GnTL1_like Beta 1, 3-N-acetylglucosaminyltransferase is essential for the formation of poly-N-acetyllactosamine Back     alignment and domain information
>cd04179 DPM_DPG-synthase_like DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily Back     alignment and domain information
>cd02520 Glucosylceramide_synthase Glucosylceramide synthase catalyzes the first glycosylation step of glycosphingolipid synthesis Back     alignment and domain information
>cd02510 pp-GalNAc-T pp-GalNAc-T initiates the formation of mucin-type O-linked glycans Back     alignment and domain information
>cd06436 GlcNAc-1-P_transferase N-acetyl-glucosamine transferase is involved in the synthesis of Poly-beta-1,6-N-acetyl-D-glucosamine Back     alignment and domain information
>cd04195 GT2_AmsE_like GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis Back     alignment and domain information
>cd04187 DPM1_like_bac Bacterial DPM1_like enzymes are related to eukaryotic DPM1 Back     alignment and domain information
>cd06427 CESA_like_2 CESA_like_2 is a member of the cellulose synthase superfamily Back     alignment and domain information
>PRK10073 putative glycosyl transferase; Provisional Back     alignment and domain information
>cd06423 CESA_like CESA_like is the cellulose synthase superfamily Back     alignment and domain information
>cd04192 GT_2_like_e Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd06433 GT_2_WfgS_like WfgS and WfeV are involved in O-antigen biosynthesis Back     alignment and domain information
>cd04184 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis Back     alignment and domain information
>TIGR03472 HpnI hopanoid biosynthesis associated glycosyl transferase protein HpnI Back     alignment and domain information
>cd06437 CESA_CaSu_A2 Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex Back     alignment and domain information
>PRK05454 glucosyltransferase MdoH; Provisional Back     alignment and domain information
>TIGR03469 HonB hopene-associated glycosyltransferase HpnB Back     alignment and domain information
>cd06421 CESA_CelA_like CESA_CelA_like are involved in the elongation of the glucan chain of cellulose Back     alignment and domain information
>PRK15489 nfrB bacteriophage N4 adsorption protein B; Provisional Back     alignment and domain information
>cd04196 GT_2_like_d Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd02525 Succinoglycan_BP_ExoA ExoA is involved in the biosynthesis of succinoglycan Back     alignment and domain information
>PRK11204 N-glycosyltransferase; Provisional Back     alignment and domain information
>PRK13915 putative glucosyl-3-phosphoglycerate synthase; Provisional Back     alignment and domain information
>cd04185 GT_2_like_b Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd06439 CESA_like_1 CESA_like_1 is a member of the cellulose synthase (CESA) superfamily Back     alignment and domain information
>PRK10063 putative glycosyl transferase; Provisional Back     alignment and domain information
>PRK14583 hmsR N-glycosyltransferase; Provisional Back     alignment and domain information
>cd06435 CESA_NdvC_like NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase Back     alignment and domain information
>cd06420 GT2_Chondriotin_Pol_N N-terminal domain of Chondroitin polymerase functions as a GalNAc transferase Back     alignment and domain information
>PRK10018 putative glycosyl transferase; Provisional Back     alignment and domain information
>PF13641 Glyco_tranf_2_3: Glycosyltransferase like family 2; PDB: 4FIY_B 4FIX_A Back     alignment and domain information
>PF00535 Glycos_transf_2: Glycosyl transferase family 2; InterPro: IPR001173 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>KOG2977|consensus Back     alignment and domain information
>TIGR03111 glyc2_xrt_Gpos1 putative glycosyltransferase TIGR03111 Back     alignment and domain information
>cd02526 GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl transferase Back     alignment and domain information
>cd04186 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd06434 GT2_HAS Hyaluronan synthases catalyze polymerization of hyaluronan Back     alignment and domain information
>TIGR01556 rhamnosyltran L-rhamnosyltransferase Back     alignment and domain information
>cd02522 GT_2_like_a GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function Back     alignment and domain information
>cd06438 EpsO_like EpsO protein participates in the methanolan synthesis Back     alignment and domain information
>cd02511 Beta4Glucosyltransferase UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide Back     alignment and domain information
>PRK11498 bcsA cellulose synthase catalytic subunit; Provisional Back     alignment and domain information
>cd00761 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold Back     alignment and domain information
>TIGR03030 CelA cellulose synthase catalytic subunit (UDP-forming) Back     alignment and domain information
>PRK14716 bacteriophage N4 adsorption protein B; Provisional Back     alignment and domain information
>COG1216 Predicted glycosyltransferases [General function prediction only] Back     alignment and domain information
>PF10111 Glyco_tranf_2_2: Glycosyltransferase like family 2; InterPro: IPR019290 This conserved domain is found in a set of prokaryotic proteins including putative glucosyltransferases, which are involved in bacterial capsule biosynthesis [, ] Back     alignment and domain information
>COG1215 Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd06423 CESA_like CESA_like is the cellulose synthase superfamily Back     alignment and domain information
>cd06436 GlcNAc-1-P_transferase N-acetyl-glucosamine transferase is involved in the synthesis of Poly-beta-1,6-N-acetyl-D-glucosamine Back     alignment and domain information
>COG0463 WcaA Glycosyltransferases involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04191 Glucan_BSP_ModH Glucan_BSP_ModH catalyzes the elongation of beta-1,2 polyglucose chains of glucan Back     alignment and domain information
>PF13506 Glyco_transf_21: Glycosyl transferase family 21 Back     alignment and domain information
>PRK11234 nfrB bacteriophage N4 adsorption protein B; Provisional Back     alignment and domain information
>cd04190 Chitin_synth_C C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin Back     alignment and domain information
>KOG3737|consensus Back     alignment and domain information
>KOG3738|consensus Back     alignment and domain information
>KOG3736|consensus Back     alignment and domain information
>cd02511 Beta4Glucosyltransferase UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide Back     alignment and domain information
>cd00761 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold Back     alignment and domain information
>PRK15489 nfrB bacteriophage N4 adsorption protein B; Provisional Back     alignment and domain information
>PRK05454 glucosyltransferase MdoH; Provisional Back     alignment and domain information
>PF13632 Glyco_trans_2_3: Glycosyl transferase family group 2 Back     alignment and domain information
>KOG2547|consensus Back     alignment and domain information
>PF13712 Glyco_tranf_2_5: Glycosyltransferase like family; PDB: 2QGI_A 2NXV_B Back     alignment and domain information
>COG0463 WcaA Glycosyltransferases involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3738|consensus Back     alignment and domain information
>PF13506 Glyco_transf_21: Glycosyl transferase family 21 Back     alignment and domain information
>KOG3736|consensus Back     alignment and domain information
>KOG3737|consensus Back     alignment and domain information
>cd02514 GT13_GLCNAC-TI GT13_GLCNAC-TI is involved in an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides Back     alignment and domain information
>cd00899 b4GalT Beta-4-Galactosyltransferase is involved in the formation of the poly-N-acetyllactosamine core structures present in glycoproteins and glycosphingolipids Back     alignment and domain information
>PF03142 Chitin_synth_2: Chitin synthase; InterPro: IPR004835 Chitin synthase (2 Back     alignment and domain information
>PF13632 Glyco_trans_2_3: Glycosyl transferase family group 2 Back     alignment and domain information
>PLN02893 Cellulose synthase-like protein Back     alignment and domain information
>COG4092 Predicted glycosyltransferase involved in capsule biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF13712 Glyco_tranf_2_5: Glycosyltransferase like family; PDB: 2QGI_A 2NXV_B Back     alignment and domain information
>KOG2571|consensus Back     alignment and domain information
>PF05679 CHGN: Chondroitin N-acetylgalactosaminyltransferase; InterPro: IPR008428 This family represents Chondroitin N-acetylgalactosaminyltransferase Back     alignment and domain information
>KOG2547|consensus Back     alignment and domain information
>PF13704 Glyco_tranf_2_4: Glycosyl transferase family 2 Back     alignment and domain information
>cd02514 GT13_GLCNAC-TI GT13_GLCNAC-TI is involved in an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides Back     alignment and domain information
>PF13704 Glyco_tranf_2_4: Glycosyl transferase family 2 Back     alignment and domain information
>COG2943 MdoH Membrane glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF03071 GNT-I: GNT-I family; InterPro: IPR004139 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PRK14503 mannosyl-3-phosphoglycerate synthase; Provisional Back     alignment and domain information
>TIGR02460 osmo_MPGsynth mannosyl-3-phosphoglycerate synthase Back     alignment and domain information
>PF03452 Anp1: Anp1; InterPro: IPR005109 The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function Back     alignment and domain information
>KOG3916|consensus Back     alignment and domain information
>PF09488 Osmo_MPGsynth: Mannosyl-3-phosphoglycerate synthase (osmo_MPGsynth); InterPro: IPR012812 This family consists of examples of mannosyl-3-phosphoglycerate synthase (MPGS), which together with mannosyl-3-phosphoglycerate phosphatase (MPGP), comprises a two-step pathway for mannosylglycerate biosynthesis Back     alignment and domain information
>PF11735 CAP59_mtransfer: Cryptococcal mannosyltransferase 1 ; InterPro: IPR021047 The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1 [, ] Back     alignment and domain information
>PF06306 CgtA: Beta-1,4-N-acetylgalactosaminyltransferase (CgtA); InterPro: IPR010446 This family consists of several beta-1,4-N-acetylgalactosaminyltransferase proteins from Campylobacter jejuni [] Back     alignment and domain information
>KOG3588|consensus Back     alignment and domain information
>COG4092 Predicted glycosyltransferase involved in capsule biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02893 Cellulose synthase-like protein Back     alignment and domain information
>PF02709 Glyco_transf_7C: N-terminal domain of galactosyltransferase; InterPro: IPR003859 This is a family of galactosyltransferases from a wide range of metazoa with three related galactosyltransferase activities; all three of which are possessed by one sequence in some cases Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>PF01762 Galactosyl_T: Galactosyltransferase; InterPro: IPR002659 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars Back     alignment and domain information
>cd02508 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch Back     alignment and domain information
>cd06428 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase Back     alignment and domain information
>PF11316 Rhamno_transf: Putative rhamnosyl transferase ; InterPro: IPR021466 This bacterial family of proteins has no known function Back     alignment and domain information
>PLN02917 CMP-KDO synthetase Back     alignment and domain information
>cd00899 b4GalT Beta-4-Galactosyltransferase is involved in the formation of the poly-N-acetyllactosamine core structures present in glycoproteins and glycosphingolipids Back     alignment and domain information
>PRK05450 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>PLN02458 transferase, transferring glycosyl groups Back     alignment and domain information
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit Back     alignment and domain information
>cd00218 GlcAT-I Beta1,3-glucuronyltransferase I (GlcAT-I) is involved in the initial steps of proteoglycan synthesis Back     alignment and domain information
>PF12804 NTP_transf_3: MobA-like NTP transferase domain; PDB: 3FWW_A 2XME_D 2XMH_C 2DPW_A 2WAW_A 2OI5_B 1HV9_B 1FWY_A 2OI6_A 2OI7_B Back     alignment and domain information
>KOG1413|consensus Back     alignment and domain information
>PLN02195 cellulose synthase A Back     alignment and domain information
>PF11397 GlcNAc: Glycosyltransferase (GlcNAc); InterPro: IPR021067 GlcNAc is an enzyme that carries out the first glycosylation step of hydroxylated Skp1; it is found in the cytoplasm and results in a pentasaccharide-linked 'HyPro-143[, ] Back     alignment and domain information
>PF03452 Anp1: Anp1; InterPro: IPR005109 The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function Back     alignment and domain information
>PLN02248 cellulose synthase-like protein Back     alignment and domain information
>cd02517 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide Back     alignment and domain information
>KOG2571|consensus Back     alignment and domain information
>PF03214 RGP: Reversibly glycosylated polypeptide; InterPro: IPR004901 Alpha-1,4-glucan-protein synthase catalyses the reaction: protein + UDP-D-glucose = alpha-D-glucosyl-protein + UDP The enzyme has a possible role in the synthesis of cell wall polysaccharides in plants [] Back     alignment and domain information
>cd02516 CDP-ME_synthetase CDP-ME synthetase is involved in mevalonate-independent isoprenoid production Back     alignment and domain information
>cd04182 GT_2_like_f GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function Back     alignment and domain information
>PF11735 CAP59_mtransfer: Cryptococcal mannosyltransferase 1 ; InterPro: IPR021047 The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1 [, ] Back     alignment and domain information
>PF05679 CHGN: Chondroitin N-acetylgalactosaminyltransferase; InterPro: IPR008428 This family represents Chondroitin N-acetylgalactosaminyltransferase Back     alignment and domain information
>PF13733 Glyco_transf_7N: N-terminal region of glycosyl transferase group 7; PDB: 2AGD_B 3EE5_A 2AE7_B 2AEC_A 2FYA_A 2AES_B 2AH9_A 2FYB_A 2FY7_A 3LW6_A Back     alignment and domain information
>PRK00317 mobA molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed Back     alignment and domain information
>cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>TIGR02460 osmo_MPGsynth mannosyl-3-phosphoglycerate synthase Back     alignment and domain information
>PF09258 Glyco_transf_64: Glycosyl transferase family 64 domain; InterPro: IPR015338 Members of this entry catalyse the transfer reaction of N-acetylglucosamine and N-acetylgalactosamine from the respective UDP-sugars to the non-reducing end of [glucuronic acid]beta 1-3[galactose]beta 1-O-naphthalenemethanol, an acceptor substrate analogue of the natural common linker of various glycosylaminoglycans Back     alignment and domain information
>cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins Back     alignment and domain information
>cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>cd02513 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-acetylneuraminic acid by adding CMP moiety Back     alignment and domain information
>PRK14503 mannosyl-3-phosphoglycerate synthase; Provisional Back     alignment and domain information
>PF11316 Rhamno_transf: Putative rhamnosyl transferase ; InterPro: IPR021466 This bacterial family of proteins has no known function Back     alignment and domain information
>COG1209 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars Back     alignment and domain information
>cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family Back     alignment and domain information
>TIGR00466 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase Back     alignment and domain information
>PLN02190 cellulose synthase-like protein Back     alignment and domain information
>cd06426 NTP_transferase_like_2 NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family Back     alignment and domain information
>cd02503 MobA MobA catalyzes the formation of molybdopterin guanine dinucleotide Back     alignment and domain information
>KOG1476|consensus Back     alignment and domain information
>KOG2287|consensus Back     alignment and domain information
>PF03142 Chitin_synth_2: Chitin synthase; InterPro: IPR004835 Chitin synthase (2 Back     alignment and domain information
>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU Back     alignment and domain information
>PF12804 NTP_transf_3: MobA-like NTP transferase domain; PDB: 3FWW_A 2XME_D 2XMH_C 2DPW_A 2WAW_A 2OI5_B 1HV9_B 1FWY_A 2OI6_A 2OI7_B Back     alignment and domain information
>PF06306 CgtA: Beta-1,4-N-acetylgalactosaminyltransferase (CgtA); InterPro: IPR010446 This family consists of several beta-1,4-N-acetylgalactosaminyltransferase proteins from Campylobacter jejuni [] Back     alignment and domain information
>TIGR03202 pucB xanthine dehydrogenase accessory protein pucB Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information
>TIGR02665 molyb_mobA molybdopterin-guanine dinucleotide biosynthesis protein A, proteobacterial Back     alignment and domain information
>TIGR03202 pucB xanthine dehydrogenase accessory protein pucB Back     alignment and domain information
>KOG3917|consensus Back     alignment and domain information
>PRK00155 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>COG1213 Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>PF05060 MGAT2: N-acetylglucosaminyltransferase II (MGAT2); InterPro: IPR007754 N-acetylglucosaminyltransferase II (2 Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05045 RgpF: Rhamnan synthesis protein F; InterPro: IPR007739 This family consists of a group of proteins which are related to the Streptococcal rhamnose-glucose polysaccharide assembly protein (RgpF) Back     alignment and domain information
>PRK13368 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>PLN02458 transferase, transferring glycosyl groups Back     alignment and domain information
>PF00483 NTP_transferase: Nucleotidyl transferase This Prosite entry is only a sub-family of the Pfam entry Back     alignment and domain information
>PRK13385 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Provisional Back     alignment and domain information
>PF04666 Glyco_transf_54: N-Acetylglucosaminyltransferase-IV (GnT-IV) conserved region; InterPro: IPR006759 The complex-type of oligosaccharides are synthesised through elongation by glycosyltransferases after trimming of the precursor oligosaccharides transferred to proteins in the endoplasmic reticulum Back     alignment and domain information
>cd02509 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose Back     alignment and domain information
>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional Back     alignment and domain information
>cd04182 GT_2_like_f GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function Back     alignment and domain information
>TIGR01207 rmlA glucose-1-phosphate thymidylyltransferase, short form Back     alignment and domain information
>TIGR01105 galF UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit Back     alignment and domain information
>PRK02726 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>TIGR03310 matur_ygfJ molybdenum hydroxylase accessory protein, YgfJ family Back     alignment and domain information
>PF01697 Glyco_transf_92: Glycosyltransferase family 92; InterPro: IPR008166 This entry represents a region approximately 300 residues long that is of unknown function Back     alignment and domain information
>PF09488 Osmo_MPGsynth: Mannosyl-3-phosphoglycerate synthase (osmo_MPGsynth); InterPro: IPR012812 This family consists of examples of mannosyl-3-phosphoglycerate synthase (MPGS), which together with mannosyl-3-phosphoglycerate phosphatase (MPGP), comprises a two-step pathway for mannosylglycerate biosynthesis Back     alignment and domain information
>PF02434 Fringe: Fringe-like; InterPro: IPR003378 The Notch receptor is a large, cell surface transmembrane protein involved in a wide variety of developmental processes in higher organisms [] Back     alignment and domain information
>PLN02195 cellulose synthase A Back     alignment and domain information
>PF02709 Glyco_transf_7C: N-terminal domain of galactosyltransferase; InterPro: IPR003859 This is a family of galactosyltransferases from a wide range of metazoa with three related galactosyltransferase activities; all three of which are possessed by one sequence in some cases Back     alignment and domain information
>TIGR02665 molyb_mobA molybdopterin-guanine dinucleotide biosynthesis protein A, proteobacterial Back     alignment and domain information
>PRK15480 glucose-1-phosphate thymidylyltransferase RfbA; Provisional Back     alignment and domain information
>PLN02915 cellulose synthase A [UDP-forming], catalytic subunit Back     alignment and domain information
>PLN03180 reversibly glycosylated polypeptide; Provisional Back     alignment and domain information
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit Back     alignment and domain information
>cd02518 GT2_SpsF SpsF is a glycosyltrnasferase implicated in the synthesis of the spore coat Back     alignment and domain information
>cd02524 G1P_cytidylyltransferase G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose Back     alignment and domain information
>cd00218 GlcAT-I Beta1,3-glucuronyltransferase I (GlcAT-I) is involved in the initial steps of proteoglycan synthesis Back     alignment and domain information
>TIGR03310 matur_ygfJ molybdenum hydroxylase accessory protein, YgfJ family Back     alignment and domain information
>COG1213 Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd02523 PC_cytidylyltransferase Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline Back     alignment and domain information
>cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU Back     alignment and domain information
>cd02503 MobA MobA catalyzes the formation of molybdopterin guanine dinucleotide Back     alignment and domain information
>cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>KOG3588|consensus Back     alignment and domain information
>PLN03153 hypothetical protein; Provisional Back     alignment and domain information
>PLN02400 cellulose synthase Back     alignment and domain information
>PF01762 Galactosyl_T: Galactosyltransferase; InterPro: IPR002659 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>cd04198 eIF-2B_gamma_N The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>cd04183 GT2_BcE_like GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule Back     alignment and domain information
>TIGR03584 PseF pseudaminic acid CMP-transferase Back     alignment and domain information
>PF11397 GlcNAc: Glycosyltransferase (GlcNAc); InterPro: IPR021067 GlcNAc is an enzyme that carries out the first glycosylation step of hydroxylated Skp1; it is found in the cytoplasm and results in a pentasaccharide-linked 'HyPro-143[, ] Back     alignment and domain information
>PRK00317 mobA molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed Back     alignment and domain information
>TIGR01099 galU UTP-glucose-1-phosphate uridylyltransferase Back     alignment and domain information
>PRK10122 GalU regulator GalF; Provisional Back     alignment and domain information
>TIGR00453 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Back     alignment and domain information
>COG1209 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00466 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase Back     alignment and domain information
>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PF01644 Chitin_synth_1: Chitin synthase; InterPro: IPR004834 This region is found commonly in chitin synthases classes I, II and III 2 Back     alignment and domain information
>cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family Back     alignment and domain information
>TIGR02623 G1P_cyt_trans glucose-1-phosphate cytidylyltransferase Back     alignment and domain information
>PF02434 Fringe: Fringe-like; InterPro: IPR003378 The Notch receptor is a large, cell surface transmembrane protein involved in a wide variety of developmental processes in higher organisms [] Back     alignment and domain information
>cd02508 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch Back     alignment and domain information
>PLN02241 glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>cd02518 GT2_SpsF SpsF is a glycosyltrnasferase implicated in the synthesis of the spore coat Back     alignment and domain information
>COG0746 MobA Molybdopterin-guanine dinucleotide biosynthesis protein A [Coenzyme metabolism] Back     alignment and domain information
>cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins Back     alignment and domain information
>COG2068 Uncharacterized MobA-related protein [General function prediction only] Back     alignment and domain information
>PLN02248 cellulose synthase-like protein Back     alignment and domain information
>PF03360 Glyco_transf_43: Glycosyltransferase family 43; InterPro: IPR005027 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd02541 UGPase_prokaryotic Prokaryotic UGPase catalyses the synthesis of UDP-glucose Back     alignment and domain information
>TIGR03552 F420_cofC 2-phospho-L-lactate guanylyltransferase CofC Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>cd02516 CDP-ME_synthetase CDP-ME synthetase is involved in mevalonate-independent isoprenoid production Back     alignment and domain information
>TIGR03552 F420_cofC 2-phospho-L-lactate guanylyltransferase CofC Back     alignment and domain information
>PRK00576 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PF01697 Glyco_transf_92: Glycosyltransferase family 92; InterPro: IPR008166 This entry represents a region approximately 300 residues long that is of unknown function Back     alignment and domain information
>PF09837 DUF2064: Uncharacterized protein conserved in bacteria (DUF2064); InterPro: IPR018641 This entry contains proteins that have no known function Back     alignment and domain information
>PRK05450 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>PRK13385 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Provisional Back     alignment and domain information
>PLN02436 cellulose synthase A Back     alignment and domain information
>PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd06431 GT8_LARGE_C LARGE catalytic domain has closest homology to GT8 glycosyltransferase involved in lipooligosaccharide synthesis Back     alignment and domain information
>cd06428 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>PF03552 Cellulose_synt: Cellulose synthase; InterPro: IPR005150 Cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues, is the major component of wood and thus paper, and is synthesized by plants, most algae, some bacteria and fungi, and even some animals Back     alignment and domain information
>PLN03153 hypothetical protein; Provisional Back     alignment and domain information
>COG1210 GalU UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional Back     alignment and domain information
>PRK09382 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein; Provisional Back     alignment and domain information
>PF03071 GNT-I: GNT-I family; InterPro: IPR004139 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd04198 eIF-2B_gamma_N The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>cd02517 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide Back     alignment and domain information
>KOG1476|consensus Back     alignment and domain information
>PRK02726 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query435
2z86_A 625 Crystal Structure Of Chondroitin Polymerase From Es 1e-05
2z87_A 624 Crystal Structure Of Chondroitin Polymerase From Es 1e-05
3e25_A337 Crystal Structure Of M. Tuberculosis Glucosyl-3- Ph 5e-05
4ddz_A344 Crystal Structure Of Glucosyl-3-Phosphoglycerate Sy 6e-05
3ckj_A329 Crystal Structure Of A Mycobacterial Protein Length 1e-04
3bcv_A240 Crystal Structure Of A Putative Glycosyltransferase 7e-04
>pdb|2Z86|A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp Length = 625 Back     alignment and structure

Iteration: 1

Score = 47.8 bits (112), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 29/109 (26%), Positives = 58/109 (53%), Gaps = 8/109 (7%) Query: 203 TVLLPTYNEKENLPIIVYLITKYMDEGNYPYEIIVIDDGSPDGTLDAAKQLQSIYGSEKI 262 ++++PTYN + L I + + + Y YE+IV DDGS + + ++ +S+ + + Sbjct: 96 SIVIPTYNRAKILAITLACLCN--QKTIYDYEVIVADDGSKENIEEIVREFESLLNIKYV 153 Query: 263 VLKPRKKKLG--LGTAYMHGLKYATGNFIIIMDADLSHHPKFIPEMIKL 309 R+K G L GL+ A N++ I+D D++ +P ++ ++L Sbjct: 154 ----RQKDYGYQLCAVRNLGLRAAKYNYVAILDCDMAPNPLWVQSYMEL 198
>pdb|2Z87|A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp- Galnac And Udp Length = 624 Back     alignment and structure
>pdb|3E25|A Chain A, Crystal Structure Of M. Tuberculosis Glucosyl-3- Phosphoglycerate Synthase Length = 337 Back     alignment and structure
>pdb|4DDZ|A Chain A, Crystal Structure Of Glucosyl-3-Phosphoglycerate Synthase From Mycobacterium Tuberculosis Length = 344 Back     alignment and structure
>pdb|3CKJ|A Chain A, Crystal Structure Of A Mycobacterial Protein Length = 329 Back     alignment and structure
>pdb|3BCV|A Chain A, Crystal Structure Of A Putative Glycosyltransferase From Bacteroides Fragilis Length = 240 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query435
3ckj_A329 Putative uncharacterized protein; mycobacteria, un 1e-33
3ckj_A329 Putative uncharacterized protein; mycobacteria, un 9e-26
3f1y_A387 Mannosyl-3-phosphoglycerate synthase; GT-A type gl 3e-30
3f1y_A387 Mannosyl-3-phosphoglycerate synthase; GT-A type gl 3e-21
2bo4_A 397 Mannosylglycerate synthase; catalysis, glycosyltra 9e-16
2bo4_A397 Mannosylglycerate synthase; catalysis, glycosyltra 1e-12
2z86_A 625 Chondroitin synthase; GT-A, glycosyltransferase A, 3e-12
2z86_A625 Chondroitin synthase; GT-A, glycosyltransferase A, 3e-12
2z86_A625 Chondroitin synthase; GT-A, glycosyltransferase A, 3e-12
2z86_A625 Chondroitin synthase; GT-A, glycosyltransferase A, 6e-11
1qg8_A255 Protein (spore coat polysaccharide biosynthesis P 1e-11
1qg8_A255 Protein (spore coat polysaccharide biosynthesis P 3e-11
3l7i_A 729 Teichoic acid biosynthesis protein F; GT-B fold, m 1e-10
3l7i_A 729 Teichoic acid biosynthesis protein F; GT-B fold, m 1e-10
3bcv_A240 Putative glycosyltransferase protein; protein stru 3e-10
3bcv_A240 Putative glycosyltransferase protein; protein stru 3e-10
1xhb_A 472 Polypeptide N-acetylgalactosaminyltransferase 1; g 7e-10
1xhb_A472 Polypeptide N-acetylgalactosaminyltransferase 1; g 2e-08
2ffu_A 501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 4e-09
2ffu_A501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 2e-07
2d7i_A 570 Polypeptide N-acetylgalactosaminyltransferase 10; 5e-09
2d7i_A570 Polypeptide N-acetylgalactosaminyltransferase 10; 7e-08
4fix_A 657 UDP-galactofuranosyl transferase GLFT2; CAZY GT-2 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
>3ckj_A Putative uncharacterized protein; mycobacteria, unknown function; HET: CIT; 1.80A {Mycobacterium paratuberculosis} PDB: 3ckn_A* 3cko_A* 3ckq_A* 3ckv_A* 3e26_A 3e25_A Length = 329 Back     alignment and structure
 Score =  127 bits (321), Expect = 1e-33
 Identities = 45/244 (18%), Positives = 93/244 (38%), Gaps = 18/244 (7%)

Query: 203 TVLLPTYNEKENLPIIVYLITKYMDEGNYPYEIIVIDDGSPDGTLDAAKQLQSIYGSEKI 262
           +V+LP  +E++ +  ++  I+  +D      E+IV+D GS D T   A    +   S + 
Sbjct: 51  SVVLPALDEEDTIGSVIDSISPLVDG--LVDELIVLDSGSTDDTEIRAVAAGARVVSREQ 108

Query: 263 VLKPRKKKLGLGTAYMHGLKYATGNFIIIMDAD-LSHHPKFIPEMIKLQQQENLDVVTGT 321
            L     + G G A    L  + G+ ++ +D+D ++ HP F+P ++      +   +  +
Sbjct: 109 ALPEVPIRPGKGEALWRSLAASRGDIVVFVDSDLINPHPMFVPWLVGPLLTGDGVHLVKS 168

Query: 322 RYVGTGGVYGWD--FKRKLVSRGANYLTQLLLRP------GVSDLTGSFRLYKKQVLENL 373
            Y     V             R    + + LL         +    G      +++L ++
Sbjct: 169 FYRRPLNVGDAGGGAGATGGGRVTELVARPLLAALRPELGCILQPLGGEYAATRELLTSV 228

Query: 374 VSSCVSKGYVFQMEMVIRA--RQYNYTIGEVPISFVDRVY-GESKLGGTEIFQFAKALLY 430
                + GY  ++ +++    R     I +V +   +      ++LG     Q    LL 
Sbjct: 229 ---PFAPGYGVEIGLLVDTFDRLGLDAIAQVNLGVREHRNRPLAELGAMS-RQVIATLLS 284

Query: 431 LFAT 434
               
Sbjct: 285 RCGI 288


>3ckj_A Putative uncharacterized protein; mycobacteria, unknown function; HET: CIT; 1.80A {Mycobacterium paratuberculosis} PDB: 3ckn_A* 3cko_A* 3ckq_A* 3ckv_A* 3e26_A 3e25_A Length = 329 Back     alignment and structure
>3f1y_A Mannosyl-3-phosphoglycerate synthase; GT-A type glycosyltransferase, GT-81, mannosyl-3-phosphoglyc synthase, GDP-mannose, transferas; 2.20A {Rubrobacter xylanophilus} PDB: 3kia_A* 3o3p_A* Length = 387 Back     alignment and structure
>3f1y_A Mannosyl-3-phosphoglycerate synthase; GT-A type glycosyltransferase, GT-81, mannosyl-3-phosphoglyc synthase, GDP-mannose, transferas; 2.20A {Rubrobacter xylanophilus} PDB: 3kia_A* 3o3p_A* Length = 387 Back     alignment and structure
>2bo4_A Mannosylglycerate synthase; catalysis, glycosyltransferase, mannose, transferase, stereoselectivity; HET: FLC; 1.95A {Rhodothermus marinus} SCOP: c.68.1.18 PDB: 2bo6_A 2bo7_A* 2bo8_A* 2xw2_A 2y4j_A 2xw3_A* 2xw4_A* 2xw5_A* 2y4k_A* 2y4l_A* 2y4m_A* Length = 397 Back     alignment and structure
>2bo4_A Mannosylglycerate synthase; catalysis, glycosyltransferase, mannose, transferase, stereoselectivity; HET: FLC; 1.95A {Rhodothermus marinus} SCOP: c.68.1.18 PDB: 2bo6_A 2bo7_A* 2bo8_A* 2xw2_A 2y4j_A 2xw3_A* 2xw4_A* 2xw5_A* 2y4k_A* 2y4l_A* 2y4m_A* Length = 397 Back     alignment and structure
>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Length = 625 Back     alignment and structure
>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Length = 625 Back     alignment and structure
>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Length = 625 Back     alignment and structure
>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Length = 625 Back     alignment and structure
>1qg8_A Protein (spore coat polysaccharide biosynthesis P SPSA); glycosyltransferase, transferase; 1.50A {Bacillus subtilis} SCOP: c.68.1.1 PDB: 1h7q_A* 1h7l_A 1qgq_A* 1qgs_A* Length = 255 Back     alignment and structure
>1qg8_A Protein (spore coat polysaccharide biosynthesis P SPSA); glycosyltransferase, transferase; 1.50A {Bacillus subtilis} SCOP: c.68.1.1 PDB: 1h7q_A* 1h7l_A 1qgq_A* 1qgs_A* Length = 255 Back     alignment and structure
>3l7i_A Teichoic acid biosynthesis protein F; GT-B fold, monotopic membrane protein, structural protein; 2.70A {Staphylococcus epidermidis} PDB: 3l7j_A 3l7k_A* 3l7l_A* 3l7m_A* Length = 729 Back     alignment and structure
>3l7i_A Teichoic acid biosynthesis protein F; GT-B fold, monotopic membrane protein, structural protein; 2.70A {Staphylococcus epidermidis} PDB: 3l7j_A 3l7k_A* 3l7l_A* 3l7m_A* Length = 729 Back     alignment and structure
>3bcv_A Putative glycosyltransferase protein; protein structure initiative II, PSI-II NYSGXRC, structural genomics; 2.35A {Bacteroides fragilis} Length = 240 Back     alignment and structure
>3bcv_A Putative glycosyltransferase protein; protein structure initiative II, PSI-II NYSGXRC, structural genomics; 2.35A {Bacteroides fragilis} Length = 240 Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Length = 472 Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Length = 472 Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Length = 501 Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Length = 501 Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Length = 570 Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Length = 570 Back     alignment and structure
>4fix_A UDP-galactofuranosyl transferase GLFT2; CAZY GT-2 family, glycosyltrans carbohydrate binding, membrane; 2.45A {Mycobacterium tuberculosis} PDB: 4fiy_A* Length = 657 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query435
2z86_A625 Chondroitin synthase; GT-A, glycosyltransferase A, 100.0
3f1y_A387 Mannosyl-3-phosphoglycerate synthase; GT-A type gl 99.96
3bcv_A240 Putative glycosyltransferase protein; protein stru 99.96
3ckj_A329 Putative uncharacterized protein; mycobacteria, un 99.94
1qg8_A255 Protein (spore coat polysaccharide biosynthesis P 99.94
1xhb_A 472 Polypeptide N-acetylgalactosaminyltransferase 1; g 99.94
2d7i_A 570 Polypeptide N-acetylgalactosaminyltransferase 10; 99.93
2ffu_A 501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 99.93
4fix_A 657 UDP-galactofuranosyl transferase GLFT2; CAZY GT-2 99.92
4hg6_A 802 Cellulose synthase subunit A; membrane translocati 99.91
2bo4_A 397 Mannosylglycerate synthase; catalysis, glycosyltra 99.91
3l7i_A 729 Teichoic acid biosynthesis protein F; GT-B fold, m 99.89
2z86_A 625 Chondroitin synthase; GT-A, glycosyltransferase A, 99.89
3bcv_A240 Putative glycosyltransferase protein; protein stru 99.87
3f1y_A387 Mannosyl-3-phosphoglycerate synthase; GT-A type gl 99.86
2nxv_A249 ATP synthase subunits region ORF 6; majastridin, A 99.83
2bo4_A397 Mannosylglycerate synthase; catalysis, glycosyltra 99.83
1qg8_A255 Protein (spore coat polysaccharide biosynthesis P 99.81
3ckj_A329 Putative uncharacterized protein; mycobacteria, un 99.8
1xhb_A472 Polypeptide N-acetylgalactosaminyltransferase 1; g 99.79
2zu9_A394 Mannosyl-3-phosphoglycerate synthase; GT-A fold, g 99.79
2d7i_A570 Polypeptide N-acetylgalactosaminyltransferase 10; 99.77
2fy7_A287 Beta-1,4-galactosyltransferase 1; M339H mutant, AP 99.76
2ffu_A501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 99.75
3l7i_A 729 Teichoic acid biosynthesis protein F; GT-B fold, m 99.71
4fix_A657 UDP-galactofuranosyl transferase GLFT2; CAZY GT-2 99.7
2wvl_A391 Mannosyl-3-phosphoglycerate synthase; GT-A fold, t 99.68
4hg6_A 802 Cellulose synthase subunit A; membrane translocati 99.62
2zu9_A394 Mannosyl-3-phosphoglycerate synthase; GT-A fold, g 99.48
2nxv_A249 ATP synthase subunits region ORF 6; majastridin, A 99.43
2wvl_A391 Mannosyl-3-phosphoglycerate synthase; GT-A fold, t 99.36
2fy7_A287 Beta-1,4-galactosyltransferase 1; M339H mutant, AP 99.03
1fo8_A343 Alpha-1,3-mannosyl-glycoprotein beta-1,2-N- acetyl 98.78
3lw6_A287 FI08434P, beta-4-galactosyltransferase 7; protein- 98.44
2c0n_A203 A197; thermophil protein, thermophilic virus, STIV 98.41
2c0n_A203 A197; thermophil protein, thermophilic virus, STIV 98.22
1fo8_A343 Alpha-1,3-mannosyl-glycoprotein beta-1,2-N- acetyl 97.73
3k8d_A264 3-deoxy-manno-octulosonate cytidylyltransferase; K 96.91
3tqd_A256 3-deoxy-manno-octulosonate cytidylyltransferase; c 96.72
4ecm_A269 Glucose-1-phosphate thymidylyltransferase; HET: DA 95.74
3oam_A252 3-deoxy-manno-octulosonate cytidylyltransferase; c 95.65
3cu0_A281 Galactosylgalactosylxylosylprotein 3-beta- glucuro 95.58
4fcu_A253 3-deoxy-manno-octulosonate cytidylyltransferase; s 94.72
1v84_A253 Galactosylgalactosylxylosylprotein 3-beta- glucuro 94.46
1qwj_A229 Cytidine monophospho-N-acetylneuraminic acid synth 94.23
3lw6_A287 FI08434P, beta-4-galactosyltransferase 7; protein- 94.19
2d0j_A246 Galactosylgalactosylxylosylprotein 3-beta- glucuro 94.16
1h7e_A245 3-deoxy-manno-octulosonate cytidylyltransferase; n 94.04
1ezi_A228 CMP-N-acetylneuraminic acid synthetase; homodimer, 93.79
2waw_A199 MOBA relate protein; unknown function; HET: PGE; 1 93.66
2y6p_A234 3-deoxy-manno-octulosonate cytidylyltransferase; l 93.65
3st8_A 501 Bifunctional protein GLMU; acetyltransferase, pyro 93.4
4fce_A 459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 92.58
3ngw_A208 Molybdopterin-guanine dinucleotide biosynthesis P 92.37
3juk_A281 UDP-glucose pyrophosphorylase (GALU); transfer; HE 92.16
1vgw_A231 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; 92.13
1e5k_A201 Molybdopterin-guanine dinucleotide biosynthesis pr 91.97
3d5n_A197 Q97W15_sulso; NESG, SSR125, structural genomics, P 91.77
1hm9_A 468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 91.75
2wee_A197 MOBA-related protein; unknown function; 1.65A {Myc 91.65
3k8d_A264 3-deoxy-manno-octulosonate cytidylyltransferase; K 91.44
3oam_A252 3-deoxy-manno-octulosonate cytidylyltransferase; c 90.97
1vic_A262 3-deoxy-manno-octulosonate cytidylyltransferase; s 90.76
1omz_A293 Alpha-1,4-N-acetylhexosaminyltransferase EXTL2; ro 90.38
3ngw_A208 Molybdopterin-guanine dinucleotide biosynthesis P 89.91
2y6p_A234 3-deoxy-manno-octulosonate cytidylyltransferase; l 89.52
2yc3_A228 2-C-methyl-D-erythritol 4-phosphate cytidylyltran 89.17
3tqd_A256 3-deoxy-manno-octulosonate cytidylyltransferase; c 88.59
1yp2_A 451 Glucose-1-phosphate adenylyltransferase small subu 88.54
1h7e_A245 3-deoxy-manno-octulosonate cytidylyltransferase; n 87.74
2ux8_A297 Glucose-1-phosphate uridylyltransferase; UGPG, GAL 87.55
2e3d_A302 UTP--glucose-1-phosphate uridylyltransferase; UDP- 87.51
2qh5_A308 PMI, ALGA, mannose-6-phosphate isomerase; structur 87.38
4ecm_A269 Glucose-1-phosphate thymidylyltransferase; HET: DA 87.19
3f1c_A246 Putative 2-C-methyl-D-erythritol 4-phosphate cytid 87.17
3cu0_A281 Galactosylgalactosylxylosylprotein 3-beta- glucuro 87.02
1qwj_A229 Cytidine monophospho-N-acetylneuraminic acid synth 86.87
1i52_A236 4-diphosphocytidyl-2-C-methylerythritol synthase; 86.82
1v84_A253 Galactosylgalactosylxylosylprotein 3-beta- glucuro 85.48
2waw_A199 MOBA relate protein; unknown function; HET: PGE; 1 84.74
3pnn_A303 Conserved domain protein; structural genomics, PSI 84.7
2d0j_A246 Galactosylgalactosylxylosylprotein 3-beta- glucuro 84.39
1vgw_A231 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; 84.17
1fxo_A293 Glucose-1-phosphate thymidylyltransferase; rhamnos 84.0
2vsh_A236 TARI, 2-C-methyl-D-erythritol 4-phosphate cytidyly 83.76
3juk_A281 UDP-glucose pyrophosphorylase (GALU); transfer; HE 83.36
2v0h_A 456 Bifunctional protein GLMU; cell WALL, magnesium, c 83.27
2xwl_A223 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; 83.04
4fcu_A253 3-deoxy-manno-octulosonate cytidylyltransferase; s 82.64
1e5k_A201 Molybdopterin-guanine dinucleotide biosynthesis pr 82.14
2wee_A197 MOBA-related protein; unknown function; 1.65A {Myc 82.0
2e8b_A201 Probable molybdopterin-guanine dinucleotide biosy 81.71
2dpw_A232 Hypothetical protein TTHA0179; transferase, struct 81.65
3st8_A501 Bifunctional protein GLMU; acetyltransferase, pyro 81.54
1lvw_A295 Glucose-1-phosphate thymidylyltransferase; protein 80.94
1ezi_A228 CMP-N-acetylneuraminic acid synthetase; homodimer, 80.76
3rsb_A196 Adenosylcobinamide-phosphate guanylyltransferase; 80.15
>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Back     alignment and structure
Probab=100.00  E-value=3.1e-44  Score=362.58  Aligned_cols=382  Identities=16%  Similarity=0.139  Sum_probs=273.2

Q ss_pred             CeEEEEEeCCCCcChHHHHHHHHHHhCCceEEEccCCC-CCCHHHHHHHHHhhccCCEEEEEcCCCCCCCCcHHHHHHHH
Q psy3650           7 PYEIIVIDDGSPDGTLDAAKQLQSIYGSEKIVLKPRKK-KLGLGTAYMHGLKYATGNFIIIMDADLSHHPKFIPEMIKLQ   85 (435)
Q Consensus         7 ~~EiivvDd~S~d~t~~i~~~~~~~~~~~~i~~~~~~~-n~g~~~a~n~gl~~a~gd~i~~lD~D~~~~~~~l~~~~~~~   85 (435)
                      ++|||||||||+|+|.++++++.+. +  .+.++..+. +.|+++++|.|++.|+||||+++|+|+.++|++|+.+++.+
T Consensus       123 ~~eiivvDd~s~d~t~~~~~~~~~~-~--~i~~i~~~~~~~g~~~a~N~g~~~a~g~~v~~lD~D~~~~~~~l~~~~~~~  199 (625)
T 2z86_A          123 DYEVIVADDGSKENIEEIVREFESL-L--NIKYVRQKDYGYQLCAVRNLGLRAAKYNYVAILDCDMAPNPLWVQSYMELL  199 (625)
T ss_dssp             CEEEEEEEESCSSCHHHHHHTTTTT-S--CEEEEEECCCSCCHHHHHHHHHHHCCSSEEEEECTTEEECTTHHHHHHHHH
T ss_pred             CeEEEEEeCCCchhHHHHHHHhhhc-C--CeEEEEeCCCCcchhHHHHHHHHhCCcCEEEEECCCCCCCHHHHHHHHHHH
Confidence            6999999999999999999988543 3  344444333 45799999999999999999999999999999999999999


Q ss_pred             hcCCCcEEEEeeeecCCCccCc-------ccchhh----h-------------hchHHHHHHHHh-----CCCccccccc
Q psy3650          86 QQENLDVVTGTRYVGTGGVYGW-------DFKRKL----V-------------SRGANYLTQLLL-----RPGVSDLTGS  136 (435)
Q Consensus        86 ~~~~~~~v~g~~~~~~~~~~~~-------~~~~~~----~-------------~~~~~~~~~~~~-----~~~~~~~~~~  136 (435)
                      .+++...++|.+..........       .+....    .             ............     ........|+
T Consensus       200 ~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~  279 (625)
T 2z86_A          200 AVDDNVALIGPRKYIDTSKHTYLDFLSQKSLINEIPEIITNNQVAGKVEQNKSVDWRIEHFKNTDNLRLCNTPFRFFSGG  279 (625)
T ss_dssp             HHCTTEEEECCEEEECCTTCCHHHHHHSTTGGGTSCC---------------CCCTHHHHHHHTTTTTTCSCGGGGCCTT
T ss_pred             hcCCceEEEEeeeeccCcccchhhcccchHHhhhcchhccCCchhhhhccCCccccchhhhcccccccccCCceeEEeec
Confidence            8777778888765443322100       000000    0             000000000000     1112235677


Q ss_pred             eehhhHHHHHHhhccccccC-c-hhhHHHHHHHHhhcceeEeeeeEeeeccccee-------------------------
Q psy3650         137 FRLYKKQVLENLVSSCVSKG-Y-VFQMEMVIRARQYNYTIGEVPISFVDRVVFTT-------------------------  189 (435)
Q Consensus       137 ~~~~~~~~~~~~~~~~~~~~-~-~~d~~l~~r~~~~g~~~~~~~~~~~~r~~~~~-------------------------  189 (435)
                      +.++++++++++|++..... | .+|.++++|+.++|+++..+|.....+.....                         
T Consensus       280 ~~~~rr~~l~~iGgfde~~~~~g~ED~dl~~Rl~~~G~~i~~~p~~~v~H~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~  359 (625)
T 2z86_A          280 NVAFAKKWLFRAGWFDEEFTHWGGEDNEFGYRLYREGCYFRSVEGAMAYHQEPPGKENETDRAAGKNITVQLLQQKVPYF  359 (625)
T ss_dssp             EEEEETHHHHHHCCCCTTCSSCCCHHHHHHHHHHHTTCEEEECGGGCEEEECCC----------------CTTTTTCTTT
T ss_pred             eeeeEHHHHHHhCCCccccccCCcchhhhhhhHHhCCceEEEcccchhhccCCccccchhhhhhcccchhhhcccCcceE
Confidence            88999999999976654433 3 68999999999999999887654322221110                         


Q ss_pred             ----eee-ecCCCCCcceEEEEeccCCCCChHHHHHHHHHHhhcCCCCeEEEEEeCCCCcchHHHHHHHHHHhCCceEEE
Q psy3650         190 ----QAI-MSGDSVKNKYTVLLPTYNEKENLPIIVYLITKYMDEGNYPYEIIVIDDGSPDGTLDAAKQLQSIYGSEKIVL  264 (435)
Q Consensus       190 ----~~~-~~~~~~~~~isivip~~n~~~~l~~~l~~l~~~~~~~~~~~eiivvdd~s~d~t~~~~~~~~~~~~~~~i~~  264 (435)
                          ... ......+|+||||||+||+++.+.++|+++..   |+++++|||||||||+|+|.++++++.+.++.  +.+
T Consensus       360 ~rk~~~~~~~~~~~~~~vsiii~~yn~~~~l~~~l~s~~~---q~~~~~eiivvdd~S~d~t~~~~~~~~~~~~~--i~~  434 (625)
T 2z86_A          360 YRKKEKIESATLKRVPLVSIYIPAYNCSKYIVRCVESALN---QTITDLEVCICDDGSTDDTLRILQEHYANHPR--VRF  434 (625)
T ss_dssp             TCCCCCTTTCCCCSSCSEEEEEEESSCTTTHHHHHHHHHS---SSCCSEEEEEEEESCSSSHHHHHHHHHTTCTT--EEE
T ss_pred             EecccccccchhccCCeEEEEEeCCCCHHHHHHHHHHHHh---CcCCCeEEEEEECcCChhHHHHHHHHHhhCCc--EEE
Confidence                000 01112357899999999999999999988754   77889999999999999999999998777665  444


Q ss_pred             ecCCCCCCHHHHHHHHHhhccCCEEEEEeCCCCCCCccHHHHHHHHh-cCCCceEEeeeEECC-Cc-eeccch-hHHHHH
Q psy3650         265 KPRKKKLGLGTAYMHGLKYATGNFIIIMDADLSHHPKFIPEMIKLQQ-QENLDVVTGTRYVGT-GG-VYGWDF-KRKLVS  340 (435)
Q Consensus       265 ~~~~~n~g~~~a~n~g~~~a~~d~v~~~d~D~~~~~~~l~~~~~~~~-~~~~~~v~~~~~~~~-~~-~~~~~~-~~~~~~  340 (435)
                      +. .+|.|++.|+|.|++.|+||||+++|+|+.+.|++|+.++..+. +++.++|.+.....+ .+ .....+ +..+..
T Consensus       435 ~~-~~n~G~~~a~n~g~~~a~g~~i~~ld~D~~~~~~~l~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~  513 (625)
T 2z86_A          435 IS-QKNKGIGSASNTAVRLCRGFYIGQLDSDDFLEPDAVELCLDEFRKDLSLACVYTTNRNIDREGNLISNGYNWPIYSR  513 (625)
T ss_dssp             EE-ECCCCHHHHHHHHHHHCCSSEEEECCTTCEECTTHHHHHHHHHHHCTTCSEEEEEEEEECTTSCEEEECCCCSSCCH
T ss_pred             Ee-CCCCCHHHHHHHHHHhcCCCEEEEECCCcccChhHHHHHHHHHHhCCCeeEEEeeeEEECCCCCEeccCcccccCCH
Confidence            44 67999999999999999999999999999999999999999885 456777777544322 22 111000 000000


Q ss_pred             HHHHHHHHHhcCCCccccccceeeecHHHHHHhhhcccCcccchhhHHHHHHHHCCCcEEEeeeEEee
Q psy3650         341 RGANYLTQLLLRPGVSDLTGSFRLYKKQVLENLVSSCVSKGYVFQMEMVIRARQYNYTIGEVPISFVD  408 (435)
Q Consensus       341 ~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~D~el~lr~~~~G~~i~~~p~~~~~  408 (435)
                         .    .. .  .....|++++++|++++++|++.+...+.+|+|+++|+.+.| ++.++|....+
T Consensus       514 ---~----~~-~--~~~~~~~~~~~~r~~~~~~ggfd~~~~~~eD~dl~~r~~~~g-~~~~~~~~~~~  570 (625)
T 2z86_A          514 ---E----KL-T--SAMICHHFRMFTARAWNLTEGFNESISNAVDYDMYLKLSEVG-PFKHINKICYN  570 (625)
T ss_dssp             ---H----HH-T--TSCCCCSCEEEEHHHHTTTTCCCSSCSSCHHHHHHHHHTTTS-CEEEEEEEEEE
T ss_pred             ---H----HH-h--hcccCCceEEEEHHHHHHhCCCCCccCChHHHHHHHHHHHhC-CEEEeCCcEEE
Confidence               0    01 1  123456778999999999988777666789999999999999 99999976654



>3f1y_A Mannosyl-3-phosphoglycerate synthase; GT-A type glycosyltransferase, GT-81, mannosyl-3-phosphoglyc synthase, GDP-mannose, transferas; 2.20A {Rubrobacter xylanophilus} PDB: 3kia_A* 3o3p_A* Back     alignment and structure
>3bcv_A Putative glycosyltransferase protein; protein structure initiative II, PSI-II NYSGXRC, structural genomics; 2.35A {Bacteroides fragilis} Back     alignment and structure
>3ckj_A Putative uncharacterized protein; mycobacteria, unknown function; HET: CIT; 1.80A {Mycobacterium paratuberculosis} PDB: 3ckn_A* 3cko_A* 3ckq_A* 3ckv_A* 3e26_A 3e25_A Back     alignment and structure
>1qg8_A Protein (spore coat polysaccharide biosynthesis P SPSA); glycosyltransferase, transferase; 1.50A {Bacillus subtilis} SCOP: c.68.1.1 PDB: 1h7q_A* 1h7l_A 1qgq_A* 1qgs_A* Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Back     alignment and structure
>4fix_A UDP-galactofuranosyl transferase GLFT2; CAZY GT-2 family, glycosyltrans carbohydrate binding, membrane; 2.45A {Mycobacterium tuberculosis} PDB: 4fiy_A* Back     alignment and structure
>4hg6_A Cellulose synthase subunit A; membrane translocation, cellulose synthesis, UDP-GLC binding membrane, transferase; HET: BGC UDP LDA; 3.25A {Rhodobacter sphaeroides} Back     alignment and structure
>2bo4_A Mannosylglycerate synthase; catalysis, glycosyltransferase, mannose, transferase, stereoselectivity; HET: FLC; 1.95A {Rhodothermus marinus} SCOP: c.68.1.18 PDB: 2bo6_A 2bo7_A* 2bo8_A* 2xw2_A 2y4j_A 2xw3_A* 2xw4_A* 2xw5_A* 2y4k_A* 2y4l_A* 2y4m_A* Back     alignment and structure
>3l7i_A Teichoic acid biosynthesis protein F; GT-B fold, monotopic membrane protein, structural protein; 2.70A {Staphylococcus epidermidis} PDB: 3l7j_A 3l7k_A* 3l7l_A* 3l7m_A* Back     alignment and structure
>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Back     alignment and structure
>3bcv_A Putative glycosyltransferase protein; protein structure initiative II, PSI-II NYSGXRC, structural genomics; 2.35A {Bacteroides fragilis} Back     alignment and structure
>3f1y_A Mannosyl-3-phosphoglycerate synthase; GT-A type glycosyltransferase, GT-81, mannosyl-3-phosphoglyc synthase, GDP-mannose, transferas; 2.20A {Rubrobacter xylanophilus} PDB: 3kia_A* 3o3p_A* Back     alignment and structure
>2nxv_A ATP synthase subunits region ORF 6; majastridin, ATPase operon, glycosyl transferase, rossmann F sulphur SAD, transferase; 1.10A {Rhodobacter blasticus} PDB: 2qgi_A* Back     alignment and structure
>2bo4_A Mannosylglycerate synthase; catalysis, glycosyltransferase, mannose, transferase, stereoselectivity; HET: FLC; 1.95A {Rhodothermus marinus} SCOP: c.68.1.18 PDB: 2bo6_A 2bo7_A* 2bo8_A* 2xw2_A 2y4j_A 2xw3_A* 2xw4_A* 2xw5_A* 2y4k_A* 2y4l_A* 2y4m_A* Back     alignment and structure
>1qg8_A Protein (spore coat polysaccharide biosynthesis P SPSA); glycosyltransferase, transferase; 1.50A {Bacillus subtilis} SCOP: c.68.1.1 PDB: 1h7q_A* 1h7l_A 1qgq_A* 1qgs_A* Back     alignment and structure
>3ckj_A Putative uncharacterized protein; mycobacteria, unknown function; HET: CIT; 1.80A {Mycobacterium paratuberculosis} PDB: 3ckn_A* 3cko_A* 3ckq_A* 3ckv_A* 3e26_A 3e25_A Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure
>2zu9_A Mannosyl-3-phosphoglycerate synthase; GT-A fold, glycosyltransferase, GT55, GDP, cytoplasm, magnesium, transferase; HET: GDP; 2.00A {Pyrococcus horikoshii} PDB: 2zu7_A* 2zu8_A* Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Back     alignment and structure
>2fy7_A Beta-1,4-galactosyltransferase 1; M339H mutant, APO enzyme; HET: PGE; 1.70A {Homo sapiens} PDB: 2aec_A* 2aes_A* 2ae7_A* 2ah9_A* 2agd_A* 2fya_A* 2fyb_A* 3ee5_A* 2fyc_B* 1tw1_A* 1tw5_A* 1tvy_A* 1nmm_B* 1o0r_A* 1yro_B* 1nf5_B* 1nhe_B* 1nkh_B* 1nqi_B* 1nwg_B* ... Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Back     alignment and structure
>3l7i_A Teichoic acid biosynthesis protein F; GT-B fold, monotopic membrane protein, structural protein; 2.70A {Staphylococcus epidermidis} PDB: 3l7j_A 3l7k_A* 3l7l_A* 3l7m_A* Back     alignment and structure
>4fix_A UDP-galactofuranosyl transferase GLFT2; CAZY GT-2 family, glycosyltrans carbohydrate binding, membrane; 2.45A {Mycobacterium tuberculosis} PDB: 4fiy_A* Back     alignment and structure
>2wvl_A Mannosyl-3-phosphoglycerate synthase; GT-A fold, transferase, glycosyltransferase, retaining mecha glucosyl transferase; HET: GDD; 2.81A {Thermus thermophilus} PDB: 2wvk_A* 2wvm_A* Back     alignment and structure
>4hg6_A Cellulose synthase subunit A; membrane translocation, cellulose synthesis, UDP-GLC binding membrane, transferase; HET: BGC UDP LDA; 3.25A {Rhodobacter sphaeroides} Back     alignment and structure
>2zu9_A Mannosyl-3-phosphoglycerate synthase; GT-A fold, glycosyltransferase, GT55, GDP, cytoplasm, magnesium, transferase; HET: GDP; 2.00A {Pyrococcus horikoshii} PDB: 2zu7_A* 2zu8_A* Back     alignment and structure
>2nxv_A ATP synthase subunits region ORF 6; majastridin, ATPase operon, glycosyl transferase, rossmann F sulphur SAD, transferase; 1.10A {Rhodobacter blasticus} PDB: 2qgi_A* Back     alignment and structure
>2wvl_A Mannosyl-3-phosphoglycerate synthase; GT-A fold, transferase, glycosyltransferase, retaining mecha glucosyl transferase; HET: GDD; 2.81A {Thermus thermophilus} PDB: 2wvk_A* 2wvm_A* Back     alignment and structure
>2fy7_A Beta-1,4-galactosyltransferase 1; M339H mutant, APO enzyme; HET: PGE; 1.70A {Homo sapiens} PDB: 2aec_A* 2aes_A* 2ae7_A* 2ah9_A* 2agd_A* 2fya_A* 2fyb_A* 3ee5_A* 2fyc_B* 1tw1_A* 1tw5_A* 1tvy_A* 1nmm_B* 1o0r_A* 1yro_B* 1nf5_B* 1nhe_B* 1nkh_B* 1nqi_B* 1nwg_B* ... Back     alignment and structure
>1fo8_A Alpha-1,3-mannosyl-glycoprotein beta-1,2-N- acetylglucosaminyltransferase; methylmercury derivative, N- acetylglucosaminyltransferase I; 1.40A {Oryctolagus cuniculus} SCOP: c.68.1.10 PDB: 1fo9_A 1foa_A* 2apc_A* 2am3_A* 2am4_A* 2am5_A* Back     alignment and structure
>3lw6_A FI08434P, beta-4-galactosyltransferase 7; protein-Mn-UDP complex, glycosyltransferase; HET: UDP; 1.81A {Drosophila melanogaster} Back     alignment and structure
>2c0n_A A197; thermophil protein, thermophilic virus, STIV, sulfolobus turreted ICOS virus; 1.86A {Sulfolobus turreted icosahedral virus} Back     alignment and structure
>2c0n_A A197; thermophil protein, thermophilic virus, STIV, sulfolobus turreted ICOS virus; 1.86A {Sulfolobus turreted icosahedral virus} Back     alignment and structure
>1fo8_A Alpha-1,3-mannosyl-glycoprotein beta-1,2-N- acetylglucosaminyltransferase; methylmercury derivative, N- acetylglucosaminyltransferase I; 1.40A {Oryctolagus cuniculus} SCOP: c.68.1.10 PDB: 1fo9_A 1foa_A* 2apc_A* 2am3_A* 2am4_A* 2am5_A* Back     alignment and structure
>3k8d_A 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB synthetase KDO complex, lipopolysaccharide biosynthesis magnesium, nucleotidyltransferase; HET: KDO CTP; 1.90A {Escherichia coli} SCOP: c.68.1.13 PDB: 3k8e_C 1vh1_A 3jtj_A* Back     alignment and structure
>3tqd_A 3-deoxy-manno-octulosonate cytidylyltransferase; cell envelope; 1.80A {Coxiella burnetii} SCOP: c.68.1.0 Back     alignment and structure
>4ecm_A Glucose-1-phosphate thymidylyltransferase; HET: DAU; 2.30A {Bacillus anthracis} PDB: 3hl3_A* Back     alignment and structure
>3oam_A 3-deoxy-manno-octulosonate cytidylyltransferase; center for structural genomics of infectious diseases; 1.75A {Vibrio cholerae o1 biovar el tor} SCOP: c.68.1.13 Back     alignment and structure
>3cu0_A Galactosylgalactosylxylosylprotein 3-beta- glucuronosyltransferase 3; glcat-I, glycosyltransferase, heparan sulfate biosynthesis, glycoprotein; HET: GAL UDP; 1.90A {Homo sapiens} SCOP: c.68.1.7 PDB: 1kws_A* 1fgg_A* Back     alignment and structure
>4fcu_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.90A {Acinetobacter baumannii} PDB: 3pol_A Back     alignment and structure
>1v84_A Galactosylgalactosylxylosylprotein 3-beta- glucuronosyltransferase 1; glycoprotein, glycocyltransferase, HNK-1 epitop; HET: GAL NDG NAG TLA UDP; 1.82A {Homo sapiens} SCOP: c.68.1.7 PDB: 1v83_A* 1v82_A* Back     alignment and structure
>1qwj_A Cytidine monophospho-N-acetylneuraminic acid synthetase; CMP-5-N-acetylneuraminic acid synthetase, CMP-NEU5AC, sialic acid, glycosylation; HET: NCC; 2.80A {Mus musculus} SCOP: c.68.1.13 Back     alignment and structure
>3lw6_A FI08434P, beta-4-galactosyltransferase 7; protein-Mn-UDP complex, glycosyltransferase; HET: UDP; 1.81A {Drosophila melanogaster} Back     alignment and structure
>2d0j_A Galactosylgalactosylxylosylprotein 3-beta- glucuronosyltransferase 2; rossmann-like fold, glucuronyltransferase; 2.00A {Homo sapiens} Back     alignment and structure
>1h7e_A 3-deoxy-manno-octulosonate cytidylyltransferase; nucleotidyltransferase, CMP-KDO synthetase, nucleoside monophosphate glycosides; 1.83A {Escherichia coli} SCOP: c.68.1.13 PDB: 1gqc_A* 1gq9_A 1h6j_A 1h7f_A* 1h7g_A* 1h7h_A* 1h7t_A* Back     alignment and structure
>1ezi_A CMP-N-acetylneuraminic acid synthetase; homodimer, alpha-beta-alpha, transferase; 2.00A {Neisseria meningitidis} SCOP: c.68.1.13 PDB: 1eyr_A Back     alignment and structure
>2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP} Back     alignment and structure
>2y6p_A 3-deoxy-manno-octulosonate cytidylyltransferase; lipid A; HET: CTP; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Back     alignment and structure
>3ngw_A Molybdopterin-guanine dinucleotide biosynthesis P (MOBA); alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.31A {Archaeoglobus fulgidus} Back     alignment and structure
>3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A* Back     alignment and structure
>1vgw_A 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; structural genomics, transferase; 2.35A {Neisseria gonorrhoeae} SCOP: c.68.1.13 PDB: 1vgz_A Back     alignment and structure
>1e5k_A Molybdopterin-guanine dinucleotide biosynthesis protein A; molybdopterin nucleotidyl-transferase,; HET: CIT; 1.35A {Escherichia coli} SCOP: c.68.1.8 PDB: 1h4e_A* 1hjl_A* 1hjj_A* 1h4c_A* 1h4d_A* 1fr9_A 1frw_A* Back     alignment and structure
>3d5n_A Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.80A {Sulfolobus solfataricus} Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Back     alignment and structure
>2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A Back     alignment and structure
>3k8d_A 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB synthetase KDO complex, lipopolysaccharide biosynthesis magnesium, nucleotidyltransferase; HET: KDO CTP; 1.90A {Escherichia coli} SCOP: c.68.1.13 PDB: 3k8e_C 1vh1_A 3jtj_A* Back     alignment and structure
>3oam_A 3-deoxy-manno-octulosonate cytidylyltransferase; center for structural genomics of infectious diseases; 1.75A {Vibrio cholerae o1 biovar el tor} SCOP: c.68.1.13 Back     alignment and structure
>1vic_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics; 1.80A {Haemophilus influenzae} SCOP: c.68.1.13 PDB: 1vh3_A 3duv_A* Back     alignment and structure
>1omz_A Alpha-1,4-N-acetylhexosaminyltransferase EXTL2; rossmann fold, DXD motif; HET: UD2; 2.10A {Mus musculus} SCOP: c.68.1.15 PDB: 1omx_A* 1on6_A* 1on8_A* Back     alignment and structure
>3ngw_A Molybdopterin-guanine dinucleotide biosynthesis P (MOBA); alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.31A {Archaeoglobus fulgidus} Back     alignment and structure
>2y6p_A 3-deoxy-manno-octulosonate cytidylyltransferase; lipid A; HET: CTP; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2yc3_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran chloroplastic; transferase, non-mevalonate-pathway, herbicide, allosteric P; HET: MW5; 1.40A {Arabidopsis thaliana} PDB: 2yc5_A* 1w77_A* 2ycm_A* Back     alignment and structure
>3tqd_A 3-deoxy-manno-octulosonate cytidylyltransferase; cell envelope; 1.80A {Coxiella burnetii} SCOP: c.68.1.0 Back     alignment and structure
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Back     alignment and structure
>1h7e_A 3-deoxy-manno-octulosonate cytidylyltransferase; nucleotidyltransferase, CMP-KDO synthetase, nucleoside monophosphate glycosides; 1.83A {Escherichia coli} SCOP: c.68.1.13 PDB: 1gqc_A* 1gq9_A 1h6j_A 1h7f_A* 1h7g_A* 1h7h_A* 1h7t_A* Back     alignment and structure
>2ux8_A Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyrophosphorylase, nucleotidyltransferase; HET: G1P; 2.65A {Sphingomonas elodea} Back     alignment and structure
>2e3d_A UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose, carbohydrate, pyrophosphorylase; 1.95A {Escherichia coli} Back     alignment and structure
>2qh5_A PMI, ALGA, mannose-6-phosphate isomerase; structural genomics, PSI, protein structure initi nysgrc; 2.30A {Helicobacter pylori} Back     alignment and structure
>4ecm_A Glucose-1-phosphate thymidylyltransferase; HET: DAU; 2.30A {Bacillus anthracis} PDB: 3hl3_A* Back     alignment and structure
>3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} SCOP: c.68.1.0 Back     alignment and structure
>3cu0_A Galactosylgalactosylxylosylprotein 3-beta- glucuronosyltransferase 3; glcat-I, glycosyltransferase, heparan sulfate biosynthesis, glycoprotein; HET: GAL UDP; 1.90A {Homo sapiens} SCOP: c.68.1.7 PDB: 1kws_A* 1fgg_A* Back     alignment and structure
>1qwj_A Cytidine monophospho-N-acetylneuraminic acid synthetase; CMP-5-N-acetylneuraminic acid synthetase, CMP-NEU5AC, sialic acid, glycosylation; HET: NCC; 2.80A {Mus musculus} SCOP: c.68.1.13 Back     alignment and structure
>1i52_A 4-diphosphocytidyl-2-C-methylerythritol synthase; cytidylyltransferase, deoxyxylulose-5-phosphate pathway (DXP isoprenoid biosynthesys, MEP; HET: CTP; 1.50A {Escherichia coli} SCOP: c.68.1.13 PDB: 1ini_A* 1inj_A 1vgt_A 1vgu_A 3n9w_A 1h3m_A Back     alignment and structure
>1v84_A Galactosylgalactosylxylosylprotein 3-beta- glucuronosyltransferase 1; glycoprotein, glycocyltransferase, HNK-1 epitop; HET: GAL NDG NAG TLA UDP; 1.82A {Homo sapiens} SCOP: c.68.1.7 PDB: 1v83_A* 1v82_A* Back     alignment and structure
>2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP} Back     alignment and structure
>3pnn_A Conserved domain protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE GOL; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>2d0j_A Galactosylgalactosylxylosylprotein 3-beta- glucuronosyltransferase 2; rossmann-like fold, glucuronyltransferase; 2.00A {Homo sapiens} Back     alignment and structure
>1vgw_A 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; structural genomics, transferase; 2.35A {Neisseria gonorrhoeae} SCOP: c.68.1.13 PDB: 1vgz_A Back     alignment and structure
>1fxo_A Glucose-1-phosphate thymidylyltransferase; rhamnose, nucleotidyltransferase, pyrophosphorylase, allostery; HET: TMP; 1.66A {Pseudomonas aeruginosa} SCOP: c.68.1.6 PDB: 1fzw_A 1g0r_A* 1g1l_A* 1g23_A* 1g2v_A* 1g3l_A* 1h5r_A* 1h5s_C* 1h5t_A* 1h5s_D* 1h5s_A* 1h5r_B* 1h5s_B* 1h5t_B* 1iim_A* 1iin_A* 3pkp_A* 3pkq_A* 1mp5_A* 1mp3_A* ... Back     alignment and structure
>2vsh_A TARI, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; nucleotidyltransferase; HET: 1PE PG4 P6G; 2.00A {Streptococcus pneumoniae} PDB: 2vsi_A* Back     alignment and structure
>3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A* Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Back     alignment and structure
>2xwl_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; transferase, MEP pathway; HET: CTP; 1.49A {Mycobacterium smegmatis} PDB: 2xwm_A* Back     alignment and structure
>4fcu_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.90A {Acinetobacter baumannii} PDB: 3pol_A Back     alignment and structure
>1e5k_A Molybdopterin-guanine dinucleotide biosynthesis protein A; molybdopterin nucleotidyl-transferase,; HET: CIT; 1.35A {Escherichia coli} SCOP: c.68.1.8 PDB: 1h4e_A* 1hjl_A* 1hjj_A* 1h4c_A* 1h4d_A* 1fr9_A 1frw_A* Back     alignment and structure
>2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A Back     alignment and structure
>2e8b_A Probable molybdopterin-guanine dinucleotide biosy protein A; putative protein, molybdenum cofactor, structural G NPPSFA; 1.61A {Aquifex aeolicus} Back     alignment and structure
>2dpw_A Hypothetical protein TTHA0179; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 2.90A {Thermus thermophilus} SCOP: c.68.1.19 Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Back     alignment and structure
>1lvw_A Glucose-1-phosphate thymidylyltransferase; protein nucleotide complex, nucleotide binding fold; HET: TYD; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.68.1.6 Back     alignment and structure
>1ezi_A CMP-N-acetylneuraminic acid synthetase; homodimer, alpha-beta-alpha, transferase; 2.00A {Neisseria meningitidis} SCOP: c.68.1.13 PDB: 1eyr_A Back     alignment and structure
>3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 435
d2bo4a1 381 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MG 1e-21
d2bo4a1381 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MG 7e-18
d1omza_265 c.68.1.15 (A:) Alpha-1,4-N-acetylhexosaminyltransf 4e-14
d1omza_265 c.68.1.15 (A:) Alpha-1,4-N-acetylhexosaminyltransf 3e-08
d1xhba2328 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosa 7e-09
d1xhba2328 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosa 8e-06
d1qg8a_255 c.68.1.1 (A:) Spore coat polysaccharide biosynthes 3e-07
d1qg8a_255 c.68.1.1 (A:) Spore coat polysaccharide biosynthes 0.002
>d2bo4a1 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]} Length = 381 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: MGS-like
domain: Mannosylglycerate synthase, MGS
species: Rhodothermus marinus [TaxId: 29549]
 Score = 93.5 bits (232), Expect = 1e-21
 Identities = 34/227 (14%), Positives = 60/227 (26%), Gaps = 25/227 (11%)

Query: 204 VLLPTYNEKENLPIIVYLITKYMDEGNYPYEIIVIDDGSPDGTLDAAKQLQSIYGSEKIV 263
           V+ P  +E   + +      +        +E++ I            +    I  +    
Sbjct: 3   VVFPFKHEHPEVLL---HNVRVAAAHPRVHEVLCIGYERDQTYEAVERAAPEISRATGTP 59

Query: 264 LKPRK----------KKLGLGTAYMHGLKYATGNFIIIMDADL-SHHPKFIPEMI-KLQQ 311
           +  R           K  G+ TA  + L+      I   DAD+ S  P +I +       
Sbjct: 60  VSVRLQERLGTLRPGKGDGMNTALRYFLEETQWERIHFYDADITSFGPDWITKAEEAADF 119

Query: 312 QENLDVVTGTRYVGTGGVYGWDFKRKLVSRGANYLTQLLLRPGVSDLTGSFRLYKKQVLE 371
              L      R      +  W   R   +              +    G   L +++V  
Sbjct: 120 GYGLVRHYFPRASTDAMI-TWMITRTGFALLWP----HTELSWIEQPLGGELLMRREVAA 174

Query: 372 NLVSSC---VSKGYVFQMEMVIRARQYNYTIGEVPI--SFVDRVYGE 413
            L           +           Q   +I E  I      R+YG 
Sbjct: 175 MLYEDERVRRRSDWGIDTLYTFVTVQQGVSIYECYIPEGKAHRLYGG 221


>d2bo4a1 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]} Length = 381 Back     information, alignment and structure
>d1omza_ c.68.1.15 (A:) Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-GalNAcT EXTL2) {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1omza_ c.68.1.15 (A:) Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-GalNAcT EXTL2) {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 328 Back     information, alignment and structure
>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 328 Back     information, alignment and structure
>d1qg8a_ c.68.1.1 (A:) Spore coat polysaccharide biosynthesis protein SpsA {Bacillus subtilis [TaxId: 1423]} Length = 255 Back     information, alignment and structure
>d1qg8a_ c.68.1.1 (A:) Spore coat polysaccharide biosynthesis protein SpsA {Bacillus subtilis [TaxId: 1423]} Length = 255 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query435
d1xhba2328 Polypeptide N-acetylgalactosaminyltransferase 1, N 99.96
d1qg8a_255 Spore coat polysaccharide biosynthesis protein Sps 99.91
d1xhba2328 Polypeptide N-acetylgalactosaminyltransferase 1, N 99.84
d2bo4a1 381 Mannosylglycerate synthase, MGS {Rhodothermus mari 99.79
d1omza_265 Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-Ga 99.76
d1qg8a_255 Spore coat polysaccharide biosynthesis protein Sps 99.71
d2bo4a1381 Mannosylglycerate synthase, MGS {Rhodothermus mari 99.61
d1omza_265 Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-Ga 99.49
d1pzta_271 beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos 98.63
d1fo8a_ 343 N-acetylglucosaminyltransferase I {Rabbit (Oryctol 97.79
d1pzta_271 beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos 95.94
d1v82a_252 Beta-1,3-glucuronyltransferase 1, GlcAT-P {Human ( 92.92
d1h7ea_245 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 92.89
d1qwja_228 CMP acylneuraminate synthetase {Mouse (Mus musculu 92.28
d3cu0a1261 1,3-Glucuronyltransferase I (glcAT-I) {Human (Homo 91.53
d1fxoa_292 RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} 91.15
d1fo8a_343 N-acetylglucosaminyltransferase I {Rabbit (Oryctol 89.12
d1w77a1226 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 87.42
d1e5ka_188 Molybdenum cofactor biosynthesis protein MobA {Esc 87.16
d1lvwa_295 RmlA (RfbA) {Archaeon Methanobacterium thermoautot 86.63
d1mc3a_291 RffH {Escherichia coli [TaxId: 562]} 85.66
d1w55a1205 IspD/IspF bifunctional enzyme, CDP-me synthase dom 84.13
d3cu0a1261 1,3-Glucuronyltransferase I (glcAT-I) {Human (Homo 83.78
d1vh1a_246 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 83.18
d1yp2a2307 Glucose-1-phosphate adenylyltransferase small subu 81.01
>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain
domain: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.96  E-value=2.3e-29  Score=231.49  Aligned_cols=214  Identities=15%  Similarity=0.172  Sum_probs=154.7

Q ss_pred             CCCCcceEEEEeccCCC-CChHHHHHHHHHHhhcCCCC--eEEEEEeCCCCcchH-HHHHHHHHHhCCceEEEecCCCCC
Q psy3650         196 DSVKNKYTVLLPTYNEK-ENLPIIVYLITKYMDEGNYP--YEIIVIDDGSPDGTL-DAAKQLQSIYGSEKIVLKPRKKKL  271 (435)
Q Consensus       196 ~~~~~~isivip~~n~~-~~l~~~l~~l~~~~~~~~~~--~eiivvdd~s~d~t~-~~~~~~~~~~~~~~i~~~~~~~n~  271 (435)
                      +...|.||||||+||+. ..|.++|+++.+   |+++.  +|||||||||+|++. +.++++.+..+. ++.++.+++|.
T Consensus        18 ~~~~P~vSIIIp~yNe~~~~l~~~l~Si~~---qt~~~~~~EIIvVDdgS~d~~~~~~l~~~~~~~~~-~i~vi~~~~n~   93 (328)
T d1xhba2          18 PDNLPTTSVVIVFHNEAWSTLLRTVHSVIN---RSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKV-PVHVIRMEQRS   93 (328)
T ss_dssp             CSCCCCEEEEEEESSCCHHHHHHHHHHHHH---SSCGGGEEEEEEEECSCCCGGGTHHHHHHHHSSSS-CEEEEECSSCC
T ss_pred             CCCCCCEEEEEeccCCcHHHHHHHHHHHHh---cCCCCCCeEEEEEECCCChhhHHHHHHHHHHhcCC-CeEEEEecccc
Confidence            34578999999999986 457777777755   65544  699999999999875 566776665543 68888888999


Q ss_pred             CHHHHHHHHHhhccCCEEEEEeCCCCCCCccHHHHHHHHhcCCCceEEeeeEECCCcee-------------ccchhHHH
Q psy3650         272 GLGTAYMHGLKYATGNFIIIMDADLSHHPKFIPEMIKLQQQENLDVVTGTRYVGTGGVY-------------GWDFKRKL  338 (435)
Q Consensus       272 g~~~a~n~g~~~a~~d~v~~~d~D~~~~~~~l~~~~~~~~~~~~~~v~~~~~~~~~~~~-------------~~~~~~~~  338 (435)
                      |.+.|+|.|++.|+||||+|+|+|+.+.|++|+.++..+.+++..++++..........             .+......
T Consensus        94 G~~~a~N~Gi~~a~gd~i~flD~D~~~~p~~l~~l~~~~~~~~~~~v~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~  173 (328)
T d1xhba2          94 GLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRW  173 (328)
T ss_dssp             CHHHHHHHHHHHCCSSEEEEEESSEEECTTCHHHHHHHHHHCTTEEEEEEEEEECSSSCCEECCCTTEEEEECTTCCEEE
T ss_pred             cchHHHHHHHHhhhcceeeecCcccccChhHHHHHHHHHhcCCCeEEecceeeeccCceeeccCCccccccccccccccc
Confidence            99999999999999999999999999999999999999988888777765433221100             00000000


Q ss_pred             HHHHHHHHHHHhc----CCCccccccceeeecHHHHHHhhhcccCcc-c-chhhHHHHHHHHCCCcEEEeeeEEeecccc
Q psy3650         339 VSRGANYLTQLLL----RPGVSDLTGSFRLYKKQVLENLVSSCVSKG-Y-VFQMEMVIRARQYNYTIGEVPISFVDRVYG  412 (435)
Q Consensus       339 ~~~~~~~~~~~~~----~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~-~-~~D~el~lr~~~~G~~i~~~p~~~~~~~~~  412 (435)
                      .............    ........|+|++++|++|+++|++.+... + +||.|||+|+.++|+++.++|.+.+.|..+
T Consensus       174 ~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~irr~~f~~vGgfDe~~~~~g~ED~Dl~~R~~~~G~~i~~~p~~~v~H~~~  253 (328)
T d1xhba2         174 YPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFR  253 (328)
T ss_dssp             EECCHHHHHHTTTCTTSCEECSBCCSSSEEEEHHHHHHTTSCCTTSCTTCCCCSHHHHHHHHTTCEEEEEEEEEEEEEC-
T ss_pred             cccchhhhhccccccccccccceecceeeeeeHHHHHHhCCCCCCCcCcCchHHHHHHHHHHhCCeEEEeCCeEEEEeCC
Confidence            0000011111111    112345688899999999999988766543 3 589999999999999999999888777554


Q ss_pred             c
Q psy3650         413 E  413 (435)
Q Consensus       413 ~  413 (435)
                      .
T Consensus       254 ~  254 (328)
T d1xhba2         254 K  254 (328)
T ss_dssp             -
T ss_pred             C
Confidence            3



>d1qg8a_ c.68.1.1 (A:) Spore coat polysaccharide biosynthesis protein SpsA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bo4a1 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]} Back     information, alignment and structure
>d1omza_ c.68.1.15 (A:) Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-GalNAcT EXTL2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qg8a_ c.68.1.1 (A:) Spore coat polysaccharide biosynthesis protein SpsA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bo4a1 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]} Back     information, alignment and structure
>d1omza_ c.68.1.15 (A:) Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-GalNAcT EXTL2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pzta_ c.68.1.2 (A:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fo8a_ c.68.1.10 (A:) N-acetylglucosaminyltransferase I {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1pzta_ c.68.1.2 (A:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v82a_ c.68.1.7 (A:) Beta-1,3-glucuronyltransferase 1, GlcAT-P {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h7ea_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KpsU [TaxId: 562]} Back     information, alignment and structure
>d1qwja_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3cu0a1 c.68.1.7 (A:75-335) 1,3-Glucuronyltransferase I (glcAT-I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fo8a_ c.68.1.10 (A:) N-acetylglucosaminyltransferase I {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1w77a1 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d1e5ka_ c.68.1.8 (A:) Molybdenum cofactor biosynthesis protein MobA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w55a1 c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, CDP-me synthase domain {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d3cu0a1 c.68.1.7 (A:75-335) 1,3-Glucuronyltransferase I (glcAT-I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vh1a_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KdsB [TaxId: 562]} Back     information, alignment and structure
>d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure