Psyllid ID: psy3656
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 185 | ||||||
| 328709648 | 424 | PREDICTED: paxillin-like isoform 2 [Acyr | 0.718 | 0.313 | 0.804 | 7e-64 | |
| 270016014 | 488 | hypothetical protein TcasGA2_TC010609 [T | 0.945 | 0.358 | 0.664 | 1e-63 | |
| 189242184 | 448 | PREDICTED: similar to paxillin [Triboliu | 0.945 | 0.390 | 0.664 | 1e-63 | |
| 383863879 | 607 | PREDICTED: paxillin-like [Megachile rotu | 0.702 | 0.214 | 0.854 | 3e-63 | |
| 328709646 | 474 | PREDICTED: paxillin-like isoform 3 [Acyr | 0.745 | 0.291 | 0.804 | 5e-63 | |
| 380025704 | 572 | PREDICTED: paxillin-like isoform 1 [Apis | 0.702 | 0.227 | 0.854 | 5e-63 | |
| 380025706 | 607 | PREDICTED: paxillin-like isoform 2 [Apis | 0.702 | 0.214 | 0.854 | 6e-63 | |
| 350421197 | 607 | PREDICTED: paxillin-like [Bombus impatie | 0.702 | 0.214 | 0.854 | 7e-63 | |
| 340714019 | 605 | PREDICTED: paxillin-like [Bombus terrest | 0.702 | 0.214 | 0.854 | 7e-63 | |
| 312372729 | 286 | hypothetical protein AND_19782 [Anophele | 0.681 | 0.440 | 0.873 | 2e-62 |
| >gi|328709648|ref|XP_003244023.1| PREDICTED: paxillin-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 248 bits (633), Expect = 7e-64, Method: Compositional matrix adjust.
Identities = 111/138 (80%), Positives = 119/138 (86%)
Query: 42 SSSVSYSKPNQPVHQKGKQLDCMLDSLTAEMSRQGVTTTQKGCCSSCDKPIVGQVITALG 101
SS V S + +LDCML SLTAEM+RQGV TTQKGCC++CDK IVGQVITALG
Sbjct: 206 SSPVRASYATESADSAAPRLDCMLGSLTAEMNRQGVNTTQKGCCTACDKAIVGQVITALG 265
Query: 102 KTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILDKCVTALEK 161
KTWHPEHF C HC+QELGTRNFFER+ RPYCEPDYHNLFSPRC+YCNGPILDKCVTALEK
Sbjct: 266 KTWHPEHFTCNHCSQELGTRNFFEREGRPYCEPDYHNLFSPRCAYCNGPILDKCVTALEK 325
Query: 162 TWHTEHFFCAQCGKQFGE 179
TWHTEHFFCAQCGKQFGE
Sbjct: 326 TWHTEHFFCAQCGKQFGE 343
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270016014|gb|EFA12462.1| hypothetical protein TcasGA2_TC010609 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|189242184|ref|XP_969819.2| PREDICTED: similar to paxillin [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|383863879|ref|XP_003707407.1| PREDICTED: paxillin-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|328709646|ref|XP_001945795.2| PREDICTED: paxillin-like isoform 3 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|380025704|ref|XP_003696608.1| PREDICTED: paxillin-like isoform 1 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|380025706|ref|XP_003696609.1| PREDICTED: paxillin-like isoform 2 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|350421197|ref|XP_003492766.1| PREDICTED: paxillin-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340714019|ref|XP_003395530.1| PREDICTED: paxillin-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|312372729|gb|EFR20625.1| hypothetical protein AND_19782 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 185 | ||||||
| FB|FBgn0041789 | 581 | Pax "Paxillin" [Drosophila mel | 0.648 | 0.206 | 0.841 | 3.2e-58 | |
| UNIPROTKB|F1MFD1 | 586 | PXN "Uncharacterized protein" | 0.843 | 0.266 | 0.579 | 2.4e-51 | |
| UNIPROTKB|E7EMK8 | 403 | PXN "Paxillin" [Homo sapiens ( | 0.843 | 0.387 | 0.587 | 3.1e-51 | |
| UNIPROTKB|F1PUT6 | 590 | PXN "Uncharacterized protein" | 0.805 | 0.252 | 0.603 | 4e-51 | |
| UNIPROTKB|F1NB68 | 559 | PXN "Paxillin" [Gallus gallus | 0.697 | 0.230 | 0.674 | 5.1e-51 | |
| UNIPROTKB|P49024 | 559 | PXN "Paxillin" [Gallus gallus | 0.697 | 0.230 | 0.674 | 5.1e-51 | |
| MGI|MGI:108295 | 591 | Pxn "paxillin" [Mus musculus ( | 0.805 | 0.252 | 0.597 | 5.1e-51 | |
| UNIPROTKB|F1M1Z5 | 591 | Pxn "Paxillin" [Rattus norvegi | 0.805 | 0.252 | 0.597 | 5.1e-51 | |
| UNIPROTKB|F5GZ78 | 589 | PXN "Paxillin" [Homo sapiens ( | 0.691 | 0.217 | 0.682 | 5.1e-51 | |
| UNIPROTKB|P49023 | 591 | PXN "Paxillin" [Homo sapiens ( | 0.691 | 0.216 | 0.682 | 5.1e-51 |
| FB|FBgn0041789 Pax "Paxillin" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 598 (215.6 bits), Expect = 3.2e-58, P = 3.2e-58
Identities = 101/120 (84%), Positives = 109/120 (90%)
Query: 60 QLDCMLDSLTAEMSRQGVTTTQKGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELG 119
QLD ML +L A MSRQGV T QKGCC++C+KPIVGQVITALGKTWHPEHF C HC+QELG
Sbjct: 323 QLDSMLGNLQANMSRQGVNTVQKGCCNACEKPIVGQVITALGKTWHPEHFTCNHCSQELG 382
Query: 120 TRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILDKCVTALEKTWHTEHFFCAQCGKQFGE 179
TRNFFERD PYCEPDYHNLFSPRC+YCNG ILDKCVTAL+KTWHTEHFFCAQCG+QFGE
Sbjct: 383 TRNFFERDGFPYCEPDYHNLFSPRCAYCNGAILDKCVTALDKTWHTEHFFCAQCGQQFGE 442
|
|
| UNIPROTKB|F1MFD1 PXN "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EMK8 PXN "Paxillin" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PUT6 PXN "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NB68 PXN "Paxillin" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P49024 PXN "Paxillin" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:108295 Pxn "paxillin" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M1Z5 Pxn "Paxillin" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F5GZ78 PXN "Paxillin" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P49023 PXN "Paxillin" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 185 | |||
| cd09336 | 53 | cd09336, LIM1_Paxillin_like, The first LIM domain | 2e-31 | |
| cd09406 | 55 | cd09406, LIM1_Leupaxin, The first LIM domain of Le | 2e-26 | |
| cd09405 | 54 | cd09405, LIM1_Paxillin, The first LIM domain of pa | 9e-26 | |
| cd09337 | 52 | cd09337, LIM2_Paxillin_like, The second LIM domain | 1e-19 | |
| pfam00412 | 58 | pfam00412, LIM, LIM domain | 7e-19 | |
| cd09337 | 52 | cd09337, LIM2_Paxillin_like, The second LIM domain | 5e-18 | |
| cd08368 | 53 | cd08368, LIM, LIM is a small protein-protein inter | 2e-16 | |
| cd09338 | 53 | cd09338, LIM3_Paxillin_like, The third LIM domain | 4e-16 | |
| cd09408 | 52 | cd09408, LIM2_Leupaxin, The second LIM domain of L | 1e-15 | |
| cd09407 | 52 | cd09407, LIM2_Paxillin, The second LIM domain of p | 3e-15 | |
| cd09334 | 54 | cd09334, LIM4_PINCH, The fourth LIM domain of prot | 1e-14 | |
| cd09407 | 52 | cd09407, LIM2_Paxillin, The second LIM domain of p | 4e-14 | |
| smart00132 | 54 | smart00132, LIM, Zinc-binding domain present in Li | 5e-13 | |
| cd09408 | 52 | cd09408, LIM2_Leupaxin, The second LIM domain of L | 8e-13 | |
| cd09339 | 52 | cd09339, LIM4_Paxillin_like, The fourth LIM domain | 8e-13 | |
| cd09362 | 52 | cd09362, LIM2_Enigma_like, The second LIM domain o | 8e-12 | |
| cd09361 | 52 | cd09361, LIM1_Enigma_like, The first LIM domain of | 8e-12 | |
| cd09411 | 52 | cd09411, LIM4_Paxillin, The fourth LIM domain of P | 1e-11 | |
| cd09412 | 52 | cd09412, LIM4_Leupaxin, The fourth LIM domain of L | 1e-11 | |
| cd09410 | 53 | cd09410, LIM3_Leupaxin, The third LIM domain of Le | 8e-11 | |
| cd09409 | 53 | cd09409, LIM3_Paxillin, The third LIM domain of pa | 8e-11 | |
| cd09336 | 53 | cd09336, LIM1_Paxillin_like, The first LIM domain | 5e-10 | |
| cd09457 | 52 | cd09457, LIM2_ENH, The second LIM domain of the En | 8e-10 | |
| cd09392 | 53 | cd09392, LIM2_Lrg1p_like, The second LIM domain of | 9e-10 | |
| cd09455 | 54 | cd09455, LIM1_Enigma_like_1, The first LIM domain | 1e-09 | |
| cd09453 | 52 | cd09453, LIM1_ENH, The first LIM domain of the Eni | 2e-09 | |
| cd09452 | 52 | cd09452, LIM1_Enigma, The first LIM domain of Enig | 2e-09 | |
| cd09341 | 56 | cd09341, LIM2_Testin_like, The second LIM domain o | 2e-09 | |
| cd09456 | 52 | cd09456, LIM2_Enigma, The second LIM domain of Eni | 3e-09 | |
| cd09334 | 54 | cd09334, LIM4_PINCH, The fourth LIM domain of prot | 6e-09 | |
| cd09353 | 60 | cd09353, LIM2_Zyxin, The second LIM domain of Zyxi | 6e-09 | |
| cd09335 | 54 | cd09335, LIM5_PINCH, The fifth LIM domain of prote | 1e-08 | |
| cd09406 | 55 | cd09406, LIM1_Leupaxin, The first LIM domain of Le | 2e-08 | |
| cd09329 | 52 | cd09329, LIM3_abLIM, The third LIM domain of actin | 2e-08 | |
| cd09331 | 59 | cd09331, LIM1_PINCH, The first LIM domain of prote | 3e-08 | |
| cd08368 | 53 | cd08368, LIM, LIM is a small protein-protein inter | 7e-08 | |
| cd09454 | 52 | cd09454, LIM1_ZASP_Cypher, The first LIM domain of | 8e-08 | |
| cd09430 | 52 | cd09430, LIM5_LIMPETin, The fifth LIM domain of pr | 9e-08 | |
| cd09346 | 52 | cd09346, LIM3_FHL, The third LIM domain of Four an | 1e-07 | |
| cd09332 | 52 | cd09332, LIM2_PINCH, The second LIM domain of prot | 2e-07 | |
| pfam00412 | 58 | pfam00412, LIM, LIM domain | 3e-07 | |
| cd09451 | 53 | cd09451, LIM_RIL, The LIM domain of RIL | 3e-07 | |
| cd09418 | 56 | cd09418, LIM2_Prickle, The second LIM domain of Pr | 3e-07 | |
| cd09354 | 60 | cd09354, LIM2_LPP, The second LIM domain of lipoma | 4e-07 | |
| cd09424 | 58 | cd09424, LIM2_FHL1, The second LIM domain of Four | 4e-07 | |
| cd09328 | 56 | cd09328, LIM2_abLIM, The second LIM domain on acti | 5e-07 | |
| cd09345 | 54 | cd09345, LIM2_FHL, The second LIM domain of Four a | 7e-07 | |
| cd09339 | 52 | cd09339, LIM4_Paxillin_like, The fourth LIM domain | 1e-06 | |
| cd09431 | 57 | cd09431, LIM3_Fhl2, The third LIM domain of Four a | 1e-06 | |
| cd09401 | 53 | cd09401, LIM_TLP_like, The LIM domains of thymus L | 1e-06 | |
| cd09396 | 53 | cd09396, LIM_DA1, The Lim domain of DA1 | 1e-06 | |
| cd09364 | 53 | cd09364, LIM1_LIMK, The first LIM domain of LIMK ( | 1e-06 | |
| cd09355 | 53 | cd09355, LIM2_Ajuba_like, The second LIM domain of | 2e-06 | |
| cd09450 | 53 | cd09450, LIM_ALP, This family represents the LIM d | 2e-06 | |
| cd09391 | 57 | cd09391, LIM1_Lrg1p_like, The first LIM domain of | 2e-06 | |
| cd09360 | 52 | cd09360, LIM_ALP_like, The LIM domain of ALP (acti | 4e-06 | |
| cd09392 | 53 | cd09392, LIM2_Lrg1p_like, The second LIM domain of | 6e-06 | |
| cd09440 | 63 | cd09440, LIM1_SF3, The first Lim domain of pollen | 6e-06 | |
| cd09411 | 52 | cd09411, LIM4_Paxillin, The fourth LIM domain of P | 9e-06 | |
| cd09363 | 54 | cd09363, LIM3_Enigma_like, The third LIM domain of | 1e-05 | |
| cd09459 | 55 | cd09459, LIM3_ENH, The third LIM domain of the Eni | 1e-05 | |
| cd09372 | 53 | cd09372, LIM2_FBLP-1, The second LIM domain of the | 1e-05 | |
| cd09351 | 54 | cd09351, LIM1_LPP, The first LIM domain of lipoma | 1e-05 | |
| smart00132 | 54 | smart00132, LIM, Zinc-binding domain present in Li | 2e-05 | |
| cd09425 | 54 | cd09425, LIM4_LIMPETin, The fourth LIM domain of p | 2e-05 | |
| cd09460 | 55 | cd09460, LIM3_ZASP_Cypher, The third LIM domain of | 2e-05 | |
| cd09335 | 54 | cd09335, LIM5_PINCH, The fifth LIM domain of prote | 3e-05 | |
| cd09462 | 74 | cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 | 4e-05 | |
| cd09426 | 57 | cd09426, LIM2_FHL2, The second LIM domain of Four | 6e-05 | |
| cd09350 | 54 | cd09350, LIM1_TRIP6, The first LIM domain of Thyro | 9e-05 | |
| cd09417 | 56 | cd09417, LIM2_LIMPETin_like, The second LIM domain | 9e-05 | |
| cd09461 | 54 | cd09461, LIM3_Enigma_like_1, The third LIM domain | 9e-05 | |
| cd09405 | 54 | cd09405, LIM1_Paxillin, The first LIM domain of pa | 1e-04 | |
| cd09338 | 53 | cd09338, LIM3_Paxillin_like, The third LIM domain | 1e-04 | |
| cd09412 | 52 | cd09412, LIM4_Leupaxin, The fourth LIM domain of L | 1e-04 | |
| cd09327 | 52 | cd09327, LIM1_abLIM, The first LIM domain of actin | 1e-04 | |
| cd09427 | 58 | cd09427, LIM2_FHL3, The second LIM domain of Four | 1e-04 | |
| cd09349 | 87 | cd09349, LIM1_Zyxin, The first LIM domain of Zyxin | 1e-04 | |
| cd09361 | 52 | cd09361, LIM1_Enigma_like, The first LIM domain of | 2e-04 | |
| cd09367 | 52 | cd09367, LIM1_Lhx1_Lhx5, The first LIM domain of L | 2e-04 | |
| cd09356 | 53 | cd09356, LIM2_TRIP6, The second LIM domain of Thyr | 2e-04 | |
| cd09418 | 56 | cd09418, LIM2_Prickle, The second LIM domain of Pr | 3e-04 | |
| cd09429 | 53 | cd09429, LIM3_FHL1, The third LIM domain of Four a | 3e-04 | |
| cd09410 | 53 | cd09410, LIM3_Leupaxin, The third LIM domain of Le | 4e-04 | |
| cd09333 | 51 | cd09333, LIM3_PINCH, The third LIM domain of prote | 4e-04 | |
| cd09478 | 54 | cd09478, LIM_CRIP, The LIM domain of Cysteine-Rich | 4e-04 | |
| cd09341 | 56 | cd09341, LIM2_Testin_like, The second LIM domain o | 5e-04 | |
| cd09455 | 54 | cd09455, LIM1_Enigma_like_1, The first LIM domain | 7e-04 | |
| cd09352 | 54 | cd09352, LIM1_Ajuba_like, The first LIM domain of | 7e-04 | |
| cd09369 | 54 | cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of L | 8e-04 | |
| cd09476 | 54 | cd09476, LIM1_TLP, The first LIM domain of thymus | 9e-04 | |
| cd09362 | 52 | cd09362, LIM2_Enigma_like, The second LIM domain o | 0.001 | |
| cd09328 | 56 | cd09328, LIM2_abLIM, The second LIM domain on acti | 0.001 | |
| cd09391 | 57 | cd09391, LIM1_Lrg1p_like, The first LIM domain of | 0.001 | |
| cd09340 | 58 | cd09340, LIM1_Testin_like, The first LIM domain of | 0.001 | |
| cd09348 | 64 | cd09348, LIM4_FHL1, The fourth LIM domain of Four | 0.001 | |
| cd09466 | 56 | cd09466, LIM1_Lhx3a, The first LIM domain of Lhx3a | 0.001 | |
| cd09458 | 55 | cd09458, LIM3_Enigma, The third LIM domain of Enig | 0.001 | |
| cd09448 | 52 | cd09448, LIM_CLP36, This family represents the LIM | 0.002 | |
| cd09416 | 56 | cd09416, LIM2_Testin, The second LIM domain of Tes | 0.002 | |
| cd09393 | 56 | cd09393, LIM3_Lrg1p_like, The third LIM domain of | 0.002 | |
| cd09428 | 54 | cd09428, LIM2_FHL5, The second LIM domain of Four | 0.002 | |
| cd09452 | 52 | cd09452, LIM1_Enigma, The first LIM domain of Enig | 0.003 | |
| cd09447 | 53 | cd09447, LIM_LASP, The LIM domain of LIM and SH3 P | 0.003 | |
| cd09359 | 53 | cd09359, LIM_LASP_like, The LIM domain of LIM and | 0.003 | |
| cd09376 | 56 | cd09376, LIM2_Lhx3_Lhx4, The second LIM domain of | 0.004 | |
| cd09463 | 53 | cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 | 0.004 |
| >gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin like protein family | Back alignment and domain information |
|---|
Score = 107 bits (269), Expect = 2e-31
Identities = 40/53 (75%), Positives = 46/53 (86%)
Query: 85 CSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYH 137
C++C KPIVGQV+TALGKTWHPEHF+C C ELGT+NFFERD +PYCE DYH
Sbjct: 1 CAACKKPIVGQVVTALGKTWHPEHFVCAECKTELGTKNFFERDGQPYCEKDYH 53
|
The first LIM domain of the paxillin like protein family: This family consists of paxillin, leupaxin, Hic-5 (ARA55), and other related proteins. There are four LIM domains in the C-terminal of the proteins and leucine-rich LD-motifs in the N-terminal region. Members of this family are adaptor proteins to recruit key components of signal-transduction machinery to specific sub-cellular locations. Paxillin is found at the interface between the plasma membrane and the actin cytoskeleton. Paxillin serves as a platform for the recruitment of numerous regulatory and structural proteins that together control the dynamic changes in cell adhesion, cytoskeletal reorganization and gene expression that are necessary for cell migration and survival. Leupaxin is a cytoskeleton adaptor protein, which is preferentially expressed in hematopoietic cells. It associates with focal adhesion kinases PYK2 and pp125FAK and identified to be a component of the osteoclast pososomal signaling complex. Hic-5 controls cell proliferation, migration and senescence by functioning as coactivator for steroid receptors such as androgen receptor, glucocorticoid receptor and progesterone receptor. LIM domains are 50-60 amino acids in size and share two characteristic zinc finger motifs. The two zinc fingers contain eight conserved residues, mostly cysteines and histidines, which coordinately bond to two zinc atoms. LIM domains function as adaptors or scaffolds to support the assembly of multimeric protein complexes. Length = 53 |
| >gnl|CDD|188790 cd09406, LIM1_Leupaxin, The first LIM domain of Leupaxin | Back alignment and domain information |
|---|
| >gnl|CDD|188789 cd09405, LIM1_Paxillin, The first LIM domain of paxillin | Back alignment and domain information |
|---|
| >gnl|CDD|188723 cd09337, LIM2_Paxillin_like, The second LIM domain of the paxillin like protein family | Back alignment and domain information |
|---|
| >gnl|CDD|215907 pfam00412, LIM, LIM domain | Back alignment and domain information |
|---|
| >gnl|CDD|188723 cd09337, LIM2_Paxillin_like, The second LIM domain of the paxillin like protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin like protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188792 cd09408, LIM2_Leupaxin, The second LIM domain of Leupaxin | Back alignment and domain information |
|---|
| >gnl|CDD|188791 cd09407, LIM2_Paxillin, The second LIM domain of paxillin | Back alignment and domain information |
|---|
| >gnl|CDD|188720 cd09334, LIM4_PINCH, The fourth LIM domain of protein PINCH | Back alignment and domain information |
|---|
| >gnl|CDD|188791 cd09407, LIM2_Paxillin, The second LIM domain of paxillin | Back alignment and domain information |
|---|
| >gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >gnl|CDD|188792 cd09408, LIM2_Leupaxin, The second LIM domain of Leupaxin | Back alignment and domain information |
|---|
| >gnl|CDD|188725 cd09339, LIM4_Paxillin_like, The fourth LIM domain of the Paxillin-like protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188748 cd09362, LIM2_Enigma_like, The second LIM domain of Enigma-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188747 cd09361, LIM1_Enigma_like, The first LIM domain of Enigma-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188795 cd09411, LIM4_Paxillin, The fourth LIM domain of Paxillin | Back alignment and domain information |
|---|
| >gnl|CDD|188796 cd09412, LIM4_Leupaxin, The fourth LIM domain of Leupaxin | Back alignment and domain information |
|---|
| >gnl|CDD|188794 cd09410, LIM3_Leupaxin, The third LIM domain of Leupaxin | Back alignment and domain information |
|---|
| >gnl|CDD|188793 cd09409, LIM3_Paxillin, The third LIM domain of paxillin | Back alignment and domain information |
|---|
| >gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin like protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188841 cd09457, LIM2_ENH, The second LIM domain of the Enigma Homolog (ENH) family | Back alignment and domain information |
|---|
| >gnl|CDD|188778 cd09392, LIM2_Lrg1p_like, The second LIM domain of Lrg1p, a LIM and RhoGap domain containing protein | Back alignment and domain information |
|---|
| >gnl|CDD|188839 cd09455, LIM1_Enigma_like_1, The first LIM domain of an Enigma subfamily with unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|188837 cd09453, LIM1_ENH, The first LIM domain of the Enigma Homolog (ENH) family | Back alignment and domain information |
|---|
| >gnl|CDD|188836 cd09452, LIM1_Enigma, The first LIM domain of Enigma | Back alignment and domain information |
|---|
| >gnl|CDD|188727 cd09341, LIM2_Testin_like, The second LIM domain of Testin-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188840 cd09456, LIM2_Enigma, The second LIM domain of Enigma | Back alignment and domain information |
|---|
| >gnl|CDD|188720 cd09334, LIM4_PINCH, The fourth LIM domain of protein PINCH | Back alignment and domain information |
|---|
| >gnl|CDD|188739 cd09353, LIM2_Zyxin, The second LIM domain of Zyxin | Back alignment and domain information |
|---|
| >gnl|CDD|188721 cd09335, LIM5_PINCH, The fifth LIM domain of protein PINCH | Back alignment and domain information |
|---|
| >gnl|CDD|188790 cd09406, LIM1_Leupaxin, The first LIM domain of Leupaxin | Back alignment and domain information |
|---|
| >gnl|CDD|188715 cd09329, LIM3_abLIM, The third LIM domain of actin binding LIM (abLIM) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188717 cd09331, LIM1_PINCH, The first LIM domain of protein PINCH | Back alignment and domain information |
|---|
| >gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|188838 cd09454, LIM1_ZASP_Cypher, The first LIM domain of ZASP/Cypher family | Back alignment and domain information |
|---|
| >gnl|CDD|188814 cd09430, LIM5_LIMPETin, The fifth LIM domain of protein LIMPETin | Back alignment and domain information |
|---|
| >gnl|CDD|188732 cd09346, LIM3_FHL, The third LIM domain of Four and a half LIM domains protein (FHL) | Back alignment and domain information |
|---|
| >gnl|CDD|188718 cd09332, LIM2_PINCH, The second LIM domain of protein PINCH | Back alignment and domain information |
|---|
| >gnl|CDD|215907 pfam00412, LIM, LIM domain | Back alignment and domain information |
|---|
| >gnl|CDD|188835 cd09451, LIM_RIL, The LIM domain of RIL | Back alignment and domain information |
|---|
| >gnl|CDD|188802 cd09418, LIM2_Prickle, The second LIM domain of Prickle | Back alignment and domain information |
|---|
| >gnl|CDD|188740 cd09354, LIM2_LPP, The second LIM domain of lipoma preferred partner (LPP) | Back alignment and domain information |
|---|
| >gnl|CDD|188808 cd09424, LIM2_FHL1, The second LIM domain of Four and a half LIM domains protein 1 (FHL1) | Back alignment and domain information |
|---|
| >gnl|CDD|188714 cd09328, LIM2_abLIM, The second LIM domain on actin binding LIM (abLIM) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188731 cd09345, LIM2_FHL, The second LIM domain of Four and a half LIM domains protein (FHL) | Back alignment and domain information |
|---|
| >gnl|CDD|188725 cd09339, LIM4_Paxillin_like, The fourth LIM domain of the Paxillin-like protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188815 cd09431, LIM3_Fhl2, The third LIM domain of Four and a half LIM domains protein 2 (FHL2) | Back alignment and domain information |
|---|
| >gnl|CDD|188785 cd09401, LIM_TLP_like, The LIM domains of thymus LIM protein (TLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188782 cd09396, LIM_DA1, The Lim domain of DA1 | Back alignment and domain information |
|---|
| >gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain Kinase ) | Back alignment and domain information |
|---|
| >gnl|CDD|188741 cd09355, LIM2_Ajuba_like, The second LIM domain of Ajuba-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188834 cd09450, LIM_ALP, This family represents the LIM domain of ALP, actinin-associated LIM protein | Back alignment and domain information |
|---|
| >gnl|CDD|188777 cd09391, LIM1_Lrg1p_like, The first LIM domain of Lrg1p, a LIM and RhoGap domain containing protein | Back alignment and domain information |
|---|
| >gnl|CDD|188746 cd09360, LIM_ALP_like, The LIM domain of ALP (actinin-associated LIM protein) family | Back alignment and domain information |
|---|
| >gnl|CDD|188778 cd09392, LIM2_Lrg1p_like, The second LIM domain of Lrg1p, a LIM and RhoGap domain containing protein | Back alignment and domain information |
|---|
| >gnl|CDD|188824 cd09440, LIM1_SF3, The first Lim domain of pollen specific protein SF3 | Back alignment and domain information |
|---|
| >gnl|CDD|188795 cd09411, LIM4_Paxillin, The fourth LIM domain of Paxillin | Back alignment and domain information |
|---|
| >gnl|CDD|188749 cd09363, LIM3_Enigma_like, The third LIM domain of Enigma-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188843 cd09459, LIM3_ENH, The third LIM domain of the Enigma Homolog (ENH) family | Back alignment and domain information |
|---|
| >gnl|CDD|188758 cd09372, LIM2_FBLP-1, The second LIM domain of the filamin-binding LIM protein-1 (FBLP-1) | Back alignment and domain information |
|---|
| >gnl|CDD|188737 cd09351, LIM1_LPP, The first LIM domain of lipoma preferred partner (LPP) | Back alignment and domain information |
|---|
| >gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >gnl|CDD|188809 cd09425, LIM4_LIMPETin, The fourth LIM domain of protein LIMPETin | Back alignment and domain information |
|---|
| >gnl|CDD|188844 cd09460, LIM3_ZASP_Cypher, The third LIM domain of ZASP/Cypher family | Back alignment and domain information |
|---|
| >gnl|CDD|188721 cd09335, LIM5_PINCH, The fifth LIM domain of protein PINCH | Back alignment and domain information |
|---|
| >gnl|CDD|188846 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 (LIM domain Kinase 1) | Back alignment and domain information |
|---|
| >gnl|CDD|188810 cd09426, LIM2_FHL2, The second LIM domain of Four and a half LIM domains protein 2 (FHL2) | Back alignment and domain information |
|---|
| >gnl|CDD|188736 cd09350, LIM1_TRIP6, The first LIM domain of Thyroid receptor-interacting protein 6 (TRIP6) | Back alignment and domain information |
|---|
| >gnl|CDD|188801 cd09417, LIM2_LIMPETin_like, The second LIM domain of protein LIMPETin and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188845 cd09461, LIM3_Enigma_like_1, The third LIM domain of an Enigma subfamily with unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|188789 cd09405, LIM1_Paxillin, The first LIM domain of paxillin | Back alignment and domain information |
|---|
| >gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin like protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188796 cd09412, LIM4_Leupaxin, The fourth LIM domain of Leupaxin | Back alignment and domain information |
|---|
| >gnl|CDD|188713 cd09327, LIM1_abLIM, The first LIM domain of actin binding LIM (abLIM) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188811 cd09427, LIM2_FHL3, The second LIM domain of Four and a half LIM domains protein 3 (FHL3) | Back alignment and domain information |
|---|
| >gnl|CDD|188735 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin | Back alignment and domain information |
|---|
| >gnl|CDD|188747 cd09361, LIM1_Enigma_like, The first LIM domain of Enigma-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188753 cd09367, LIM1_Lhx1_Lhx5, The first LIM domain of Lhx1 (also known as Lim1) and Lhx5 | Back alignment and domain information |
|---|
| >gnl|CDD|188742 cd09356, LIM2_TRIP6, The second LIM domain of Thyroid receptor-interacting protein 6 (TRIP6) | Back alignment and domain information |
|---|
| >gnl|CDD|188802 cd09418, LIM2_Prickle, The second LIM domain of Prickle | Back alignment and domain information |
|---|
| >gnl|CDD|188813 cd09429, LIM3_FHL1, The third LIM domain of Four and a half LIM domains protein 1 (FHL1) | Back alignment and domain information |
|---|
| >gnl|CDD|188794 cd09410, LIM3_Leupaxin, The third LIM domain of Leupaxin | Back alignment and domain information |
|---|
| >gnl|CDD|188719 cd09333, LIM3_PINCH, The third LIM domain of protein PINCH | Back alignment and domain information |
|---|
| >gnl|CDD|188862 cd09478, LIM_CRIP, The LIM domain of Cysteine-Rich Intestinal Protein (CRIP) | Back alignment and domain information |
|---|
| >gnl|CDD|188727 cd09341, LIM2_Testin_like, The second LIM domain of Testin-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188839 cd09455, LIM1_Enigma_like_1, The first LIM domain of an Enigma subfamily with unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|188738 cd09352, LIM1_Ajuba_like, The first LIM domain of Ajuba-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188755 cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of Lhx2 and Lhx9 family | Back alignment and domain information |
|---|
| >gnl|CDD|188860 cd09476, LIM1_TLP, The first LIM domain of thymus LIM protein (TLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188748 cd09362, LIM2_Enigma_like, The second LIM domain of Enigma-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188714 cd09328, LIM2_abLIM, The second LIM domain on actin binding LIM (abLIM) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188777 cd09391, LIM1_Lrg1p_like, The first LIM domain of Lrg1p, a LIM and RhoGap domain containing protein | Back alignment and domain information |
|---|
| >gnl|CDD|188726 cd09340, LIM1_Testin_like, The first LIM domain of Testin-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188734 cd09348, LIM4_FHL1, The fourth LIM domain of Four and a half LIM domains protein 1 (FHL1) | Back alignment and domain information |
|---|
| >gnl|CDD|188850 cd09466, LIM1_Lhx3a, The first LIM domain of Lhx3a | Back alignment and domain information |
|---|
| >gnl|CDD|188842 cd09458, LIM3_Enigma, The third LIM domain of Enigma | Back alignment and domain information |
|---|
| >gnl|CDD|188832 cd09448, LIM_CLP36, This family represents the LIM domain of CLP36 | Back alignment and domain information |
|---|
| >gnl|CDD|188800 cd09416, LIM2_Testin, The second LIM domain of Testin | Back alignment and domain information |
|---|
| >gnl|CDD|188779 cd09393, LIM3_Lrg1p_like, The third LIM domain of Lrg1p, a LIM and RhoGap domain containing protein | Back alignment and domain information |
|---|
| >gnl|CDD|188812 cd09428, LIM2_FHL5, The second LIM domain of Four and a half LIM domains protein 5 (FHL5) | Back alignment and domain information |
|---|
| >gnl|CDD|188836 cd09452, LIM1_Enigma, The first LIM domain of Enigma | Back alignment and domain information |
|---|
| >gnl|CDD|188831 cd09447, LIM_LASP, The LIM domain of LIM and SH3 Protein (LASP) | Back alignment and domain information |
|---|
| >gnl|CDD|188745 cd09359, LIM_LASP_like, The LIM domain of LIM and SH3 Protein (LASP)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188762 cd09376, LIM2_Lhx3_Lhx4, The second LIM domain of Lhx3-Lhx4 family | Back alignment and domain information |
|---|
| >gnl|CDD|188847 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 (LIM domain Kinase 2) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 185 | |||
| KOG1701|consensus | 468 | 99.9 | ||
| KOG1701|consensus | 468 | 99.89 | ||
| KOG4577|consensus | 383 | 99.86 | ||
| KOG1044|consensus | 670 | 99.83 | ||
| KOG2272|consensus | 332 | 99.77 | ||
| KOG2272|consensus | 332 | 99.75 | ||
| KOG1703|consensus | 479 | 99.73 | ||
| KOG1703|consensus | 479 | 99.66 | ||
| PF00412 | 58 | LIM: LIM domain; InterPro: IPR001781 Zinc finger ( | 99.46 | |
| KOG1044|consensus | 670 | 99.39 | ||
| KOG1700|consensus | 200 | 99.36 | ||
| PF00412 | 58 | LIM: LIM domain; InterPro: IPR001781 Zinc finger ( | 99.02 | |
| smart00132 | 39 | LIM Zinc-binding domain present in Lin-11, Isl-1, | 98.95 | |
| smart00132 | 39 | LIM Zinc-binding domain present in Lin-11, Isl-1, | 98.55 | |
| KOG4577|consensus | 383 | 98.13 | ||
| KOG1700|consensus | 200 | 98.11 | ||
| KOG0490|consensus | 235 | 97.97 | ||
| KOG1702|consensus | 264 | 97.95 | ||
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 94.92 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 90.48 | |
| PF08394 | 37 | Arc_trans_TRASH: Archaeal TRASH domain; InterPro: | 86.91 | |
| PF09943 | 101 | DUF2175: Uncharacterized protein conserved in arch | 85.56 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 85.51 | |
| KOG0320|consensus | 187 | 84.25 | ||
| PF10235 | 90 | Cript: Microtubule-associated protein CRIPT; Inter | 82.93 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 82.05 | |
| KOG1813|consensus | 313 | 80.77 |
| >KOG1701|consensus | Back alignment and domain information |
|---|
Probab=99.90 E-value=5e-26 Score=183.46 Aligned_cols=104 Identities=29% Similarity=0.749 Sum_probs=96.7
Q ss_pred CCCCccccccccccc--ceeeecCcccccCCccCCCCCCCCCCCCeeeeCCcCCCccchhhccCCCCCccCCcccCceEE
Q psy3656 80 TQKGCCSSCDKPIVG--QVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILDKCVT 157 (185)
Q Consensus 80 ~~~~~C~~C~~~i~~--~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~~~~~C~~C~~~i~~~~~~ 157 (185)
.+..+|.+|+|.|.+ ..+.+|++.||..||+|..|+++|.+..||..++++||+.||.... +||.+|++.|++++|+
T Consensus 272 ~~~~iC~~C~K~V~g~~~ac~Am~~~fHv~CFtC~~C~r~L~Gq~FY~v~~k~~CE~cyq~tl-ekC~~Cg~~I~d~iLr 350 (468)
T KOG1701|consen 272 DYFGICAFCHKTVSGQGLAVEAMDQLFHVQCFTCRTCRRQLAGQSFYQVDGKPYCEGCYQDTL-EKCNKCGEPIMDRILR 350 (468)
T ss_pred hhhhhhhhcCCcccCcchHHHHhhhhhcccceehHhhhhhhccccccccCCcccchHHHHHHH-HHHhhhhhHHHHHHHH
Confidence 345699999999964 4789999999999999999999999999999999999999998776 9999999999999999
Q ss_pred eCCCeecccCcccccCCCccCCCCeee
Q psy3656 158 ALEKTWHTEHFFCAQCGKQFGEAMVKF 184 (185)
Q Consensus 158 ~~~~~~H~~Cf~C~~C~~~l~~~~~~~ 184 (185)
|+|+.||+.||+|..|++.|++.-|.+
T Consensus 351 A~GkayHp~CF~Cv~C~r~ldgipFtv 377 (468)
T KOG1701|consen 351 ALGKAYHPGCFTCVVCARCLDGIPFTV 377 (468)
T ss_pred hcccccCCCceEEEEeccccCCccccc
Confidence 999999999999999999999988753
|
|
| >KOG1701|consensus | Back alignment and domain information |
|---|
| >KOG4577|consensus | Back alignment and domain information |
|---|
| >KOG1044|consensus | Back alignment and domain information |
|---|
| >KOG2272|consensus | Back alignment and domain information |
|---|
| >KOG2272|consensus | Back alignment and domain information |
|---|
| >KOG1703|consensus | Back alignment and domain information |
|---|
| >KOG1703|consensus | Back alignment and domain information |
|---|
| >PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1044|consensus | Back alignment and domain information |
|---|
| >KOG1700|consensus | Back alignment and domain information |
|---|
| >PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >KOG4577|consensus | Back alignment and domain information |
|---|
| >KOG1700|consensus | Back alignment and domain information |
|---|
| >KOG0490|consensus | Back alignment and domain information |
|---|
| >KOG1702|consensus | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >PF08394 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators | Back alignment and domain information |
|---|
| >PF09943 DUF2175: Uncharacterized protein conserved in archaea (DUF2175); InterPro: IPR018686 This family of various hypothetical archaeal proteins has no known function | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >KOG0320|consensus | Back alignment and domain information |
|---|
| >PF10235 Cript: Microtubule-associated protein CRIPT; InterPro: IPR019367 The CRIPT protein is a cytoskeletal protein involved in microtubule production | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >KOG1813|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 185 | ||||
| 1nyp_A | 66 | 4th Lim Domain Of Pinch Protein Length = 66 | 3e-10 | ||
| 1nyp_A | 66 | 4th Lim Domain Of Pinch Protein Length = 66 | 1e-04 | ||
| 1x3h_A | 80 | Solution Structure Of The Lim Domain Of Human Leupa | 1e-09 | ||
| 1x3h_A | 80 | Solution Structure Of The Lim Domain Of Human Leupa | 3e-05 | ||
| 2dar_A | 90 | Solution Structure Of First Lim Domain Of Enigma-Li | 3e-08 | ||
| 2jtn_A | 182 | Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Compl | 2e-05 | ||
| 2dj7_A | 80 | Solution Structure Of 3rd Lim Domain Of Actin-Bindi | 3e-05 | ||
| 2rgt_A | 169 | Crystal Structure Of Lhx3 Lim Domains 1 And 2 With | 3e-05 | ||
| 1x64_A | 89 | Solution Structure Of The Lim Domain Of Alpha-Actin | 3e-05 | ||
| 2d8z_A | 70 | Solution Structure Of The Third Lim Domain Of Four | 4e-05 | ||
| 2d8x_A | 70 | Solution Structure Of The Second Lim Domain Of Part | 5e-05 | ||
| 2dlo_A | 81 | Solution Structure Of The Second Lim Domain Of Huma | 6e-05 | ||
| 2xqn_T | 126 | Complex Of The 2nd And 3rd Lim Domains Of Tes With | 7e-05 | ||
| 3mmk_A | 169 | The Structural Basis For Partial Redundancy In A Cl | 7e-05 | ||
| 2kbx_B | 70 | Solution Structure Of Ilk-Pinch Complex Length = 70 | 8e-05 | ||
| 1g47_A | 77 | 1st Lim Domain Of Pinch Protein Length = 77 | 1e-04 | ||
| 1v6g_A | 81 | Solution Structure Of The Lim Domain Of The Human A | 1e-04 | ||
| 2cuq_A | 80 | Solution Structure Of Second Lim Domain From Human | 2e-04 | ||
| 1iml_A | 76 | Cysteine Rich Intestinal Protein, Nmr, 48 Structure | 2e-04 | ||
| 2xjy_A | 131 | Crystal Structure Of The Lmo2:ldb1-Lid Complex, P21 | 2e-04 | ||
| 1wyh_A | 72 | Solution Structure Of The Lim Domain From Human Ske | 2e-04 | ||
| 1x4k_A | 72 | Solution Structure Of Lim Domain In Lim-Protein 3 L | 5e-04 | ||
| 3f6q_B | 72 | Crystal Structure Of Integrin-Linked Kinase Ankyrin | 6e-04 | ||
| 2cur_A | 69 | Solution Structure Of Skeletal Muscle Lim-Protein 1 | 8e-04 |
| >pdb|1NYP|A Chain A, 4th Lim Domain Of Pinch Protein Length = 66 | Back alignment and structure |
|
| >pdb|1NYP|A Chain A, 4th Lim Domain Of Pinch Protein Length = 66 | Back alignment and structure |
| >pdb|1X3H|A Chain A, Solution Structure Of The Lim Domain Of Human Leupaxin Length = 80 | Back alignment and structure |
| >pdb|1X3H|A Chain A, Solution Structure Of The Lim Domain Of Human Leupaxin Length = 80 | Back alignment and structure |
| >pdb|2DAR|A Chain A, Solution Structure Of First Lim Domain Of Enigma-Like Pdz And Lim Domains Protein Length = 90 | Back alignment and structure |
| >pdb|2JTN|A Chain A, Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Complex Length = 182 | Back alignment and structure |
| >pdb|2DJ7|A Chain A, Solution Structure Of 3rd Lim Domain Of Actin-Binding Lim Protein 3 Length = 80 | Back alignment and structure |
| >pdb|2RGT|A Chain A, Crystal Structure Of Lhx3 Lim Domains 1 And 2 With The Binding Domain Of Isl1 Length = 169 | Back alignment and structure |
| >pdb|1X64|A Chain A, Solution Structure Of The Lim Domain Of Alpha-Actinin-2 Associated Lim Protein Length = 89 | Back alignment and structure |
| >pdb|2D8Z|A Chain A, Solution Structure Of The Third Lim Domain Of Four And A Half Lim Domains Protein 2 (Fhl-2) Length = 70 | Back alignment and structure |
| >pdb|2D8X|A Chain A, Solution Structure Of The Second Lim Domain Of Particularly Interesting New Cys-His Protein (Pinch) Length = 70 | Back alignment and structure |
| >pdb|2DLO|A Chain A, Solution Structure Of The Second Lim Domain Of Human Thyroid Receptor-Interacting Protein 6 Length = 81 | Back alignment and structure |
| >pdb|2XQN|T Chain T, Complex Of The 2nd And 3rd Lim Domains Of Tes With The Evh1 Domain Of Mena And The N-Terminal Domain Of Actin-Like Protein Arp7a Length = 126 | Back alignment and structure |
| >pdb|3MMK|A Chain A, The Structural Basis For Partial Redundancy In A Class Of Transcription Factors, The Lim-Homeodomain Proteins, In Neural Cell Type Specification Length = 169 | Back alignment and structure |
| >pdb|2KBX|B Chain B, Solution Structure Of Ilk-Pinch Complex Length = 70 | Back alignment and structure |
| >pdb|1G47|A Chain A, 1st Lim Domain Of Pinch Protein Length = 77 | Back alignment and structure |
| >pdb|1V6G|A Chain A, Solution Structure Of The Lim Domain Of The Human Actin Binding Lim Protein 2 Length = 81 | Back alignment and structure |
| >pdb|2CUQ|A Chain A, Solution Structure Of Second Lim Domain From Human Skeletal Muscle Lim-Protein 2 Length = 80 | Back alignment and structure |
| >pdb|1IML|A Chain A, Cysteine Rich Intestinal Protein, Nmr, 48 Structures Length = 76 | Back alignment and structure |
| >pdb|2XJY|A Chain A, Crystal Structure Of The Lmo2:ldb1-Lid Complex, P21 Crystal Form Length = 131 | Back alignment and structure |
| >pdb|1WYH|A Chain A, Solution Structure Of The Lim Domain From Human Skeletal Muscle Lim-Protein 2 Length = 72 | Back alignment and structure |
| >pdb|1X4K|A Chain A, Solution Structure Of Lim Domain In Lim-Protein 3 Length = 72 | Back alignment and structure |
| >pdb|3F6Q|B Chain B, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 72 | Back alignment and structure |
| >pdb|2CUR|A Chain A, Solution Structure Of Skeletal Muscle Lim-Protein 1 Length = 69 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 185 | |||
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 5e-34 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 2e-14 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 5e-11 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 2e-33 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 2e-12 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 3e-33 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 1e-10 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 5e-07 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 2e-32 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 8e-26 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 1e-31 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 3e-15 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 5e-10 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 6e-29 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 9e-18 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 1e-27 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 4e-15 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 8e-27 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 2e-12 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 2e-26 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 3e-15 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 3e-26 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 2e-19 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 4e-26 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 2e-11 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 5e-26 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 2e-20 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 7e-26 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 2e-18 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 5e-11 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 1e-25 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 1e-09 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 2e-25 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 3e-12 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 4e-25 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 7e-10 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 6e-25 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 1e-09 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 1e-24 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 1e-10 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 5e-24 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 7e-10 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 9e-24 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 3e-15 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 7e-23 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 7e-12 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 2e-22 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 6e-08 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 2e-22 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 1e-08 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 1e-21 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 2e-10 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 4e-20 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 4e-08 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 8e-20 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 2e-05 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 2e-19 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 1e-08 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 2e-19 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 2e-08 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 4e-19 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 6e-19 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 3e-12 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 7e-19 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 3e-17 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 7e-19 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 2e-09 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 7e-19 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 2e-13 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 1e-18 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 8e-06 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 2e-18 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 3e-17 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 3e-08 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 3e-16 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 5e-16 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 4e-16 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 1e-05 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 5e-16 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 3e-10 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 8e-16 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 8e-16 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 5e-10 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 1e-08 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 7e-08 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 1e-05 |
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
Score = 115 bits (291), Expect = 5e-34
Identities = 30/104 (28%), Positives = 47/104 (45%), Gaps = 5/104 (4%)
Query: 80 TQKGCCSSCDKPIV-GQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHN 138
++K C+ CD+ I + A + WH +HF C C+ L + + +P C+P Y
Sbjct: 1 SEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVK 60
Query: 139 LFSPRCSYCNGPILDKC--VTALEKTWH--TEHFFCAQCGKQFG 178
+ C C+ I + VT +WH TE F C+ C K
Sbjct: 61 NHAVVCQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLI 104
|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 73 | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 73 | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 185 | |||
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 99.95 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 99.94 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 99.94 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 99.93 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 99.93 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 99.92 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 99.92 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 99.76 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 99.73 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 99.7 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 99.7 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 99.69 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 99.69 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 99.69 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 99.69 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 99.68 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 99.68 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 99.67 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 99.67 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 99.67 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 99.66 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 99.66 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 99.66 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 99.65 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.64 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 99.64 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.64 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 99.64 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 99.64 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 99.64 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 99.64 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 99.63 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 99.63 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 99.63 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 99.63 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 99.63 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 99.62 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 99.61 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 99.61 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 99.58 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 99.57 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 99.56 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 99.55 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 99.55 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 99.52 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 99.52 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 99.51 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 99.49 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 99.46 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 99.45 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 99.36 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 99.33 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 99.33 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 99.33 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 99.32 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 99.31 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 99.29 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 99.29 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.27 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.26 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 99.25 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 99.25 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 99.24 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 99.22 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 99.21 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 99.19 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 99.18 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 99.18 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 99.16 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 99.13 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 99.13 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 99.12 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 99.11 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 99.08 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 99.06 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 99.05 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 99.05 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 99.04 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 99.03 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 99.02 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 99.02 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 99.02 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 98.93 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 98.88 | |
| 1zfo_A | 31 | LAsp-1; LIM domain, zinc-finger, metal-binding pro | 98.17 | |
| 1zfo_A | 31 | LAsp-1; LIM domain, zinc-finger, metal-binding pro | 97.86 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 94.22 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 92.38 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 85.25 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 85.25 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 85.2 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 83.77 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 82.71 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 81.89 | |
| 2jrp_A | 81 | Putative cytoplasmic protein; two-zinc binding pro | 81.63 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 80.34 |
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.95 E-value=5.5e-28 Score=170.37 Aligned_cols=103 Identities=29% Similarity=0.590 Sum_probs=96.4
Q ss_pred CCcccccccccc-cceeeecCcccccCCccCCCCCCCCCCCCeeeeCCcCCCccchhhccCCCCCccCCccc--CceEEe
Q psy3656 82 KGCCSSCDKPIV-GQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPIL--DKCVTA 158 (185)
Q Consensus 82 ~~~C~~C~~~i~-~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~~~~~C~~C~~~i~--~~~~~~ 158 (185)
.++|..|+++|. ++.+.++|+.||.+||+|..|+.+|.+..|+.++|++||+.||.++|+++|..|+++|. +..|.+
T Consensus 3 ~~~C~~C~~~I~~~~~~~a~~~~~H~~CF~C~~C~~~L~~~~f~~~~g~~yC~~cy~~~~~~~C~~C~~~I~~~~~~~~a 82 (126)
T 2xqn_T 3 KPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTY 82 (126)
T ss_dssp CCBBTTTSSBCCSSCEEEETTEEECGGGSBCTTTCCBCTTSEEEEETTEEEEHHHHHHHSCCBCTTTCSBCCTTSCEEEE
T ss_pred CCCCccCCCEeCCceEEeeCCCCccCCCCCcCCCCCCCCcCEEEeECCEEechHHhCcCcCccCcccCCcCCcCceEEEC
Confidence 467999999997 57899999999999999999999998888999999999999999999999999999999 578999
Q ss_pred CCCeec--ccCcccccCCCccCCCCeee
Q psy3656 159 LEKTWH--TEHFFCAQCGKQFGEAMVKF 184 (185)
Q Consensus 159 ~~~~~H--~~Cf~C~~C~~~l~~~~~~~ 184 (185)
+++.|| ++||+|..|+++|+++.|..
T Consensus 83 ~~~~~H~~~~CF~C~~C~~~l~~~~f~~ 110 (126)
T 2xqn_T 83 NNFSWHASTECFLCSCCSKCLIGQKFMP 110 (126)
T ss_dssp TTEEEESSTTTSBCTTTCCBCTTSEEEE
T ss_pred CCCEeeCCCCCcCcCCCCCccCCCeeEe
Confidence 999999 99999999999999888754
|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 | Back alignment and structure |
|---|
| >1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 185 | ||||
| d1x3ha1 | 35 | g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [ | 8e-13 | |
| d1x3ha1 | 35 | g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [ | 2e-09 | |
| d1u5sb1 | 31 | g.39.1.3 (B:72-102) Pinch (particularly interestin | 5e-12 | |
| d1u5sb1 | 31 | g.39.1.3 (B:72-102) Pinch (particularly interestin | 7e-10 | |
| d1g47a2 | 35 | g.39.1.3 (A:36-70) Pinch (particularly interesting | 2e-11 | |
| d2dara2 | 45 | g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, En | 7e-11 | |
| d2dara2 | 45 | g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, En | 2e-10 | |
| d1b8ta4 | 49 | g.39.1.3 (A:144-192) Cysteine-rich (intestinal) pr | 2e-05 | |
| d1x3ha2 | 32 | g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) | 9e-05 | |
| d2d8ya2 | 42 | g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapie | 2e-04 | |
| d2d8za2 | 32 | g.39.1.3 (A:33-64) Four and a half LIM domains pro | 4e-04 | |
| d1v6ga1 | 41 | g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abL | 5e-04 | |
| d1v6ga1 | 41 | g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abL | 0.003 | |
| d2cuqa1 | 32 | g.39.1.3 (A:43-74) Four and a half LIM domains 3, | 0.001 | |
| d1x4ka1 | 32 | g.39.1.3 (A:35-66) Four and a half LIM domains pro | 0.002 | |
| d2d8xa2 | 26 | g.39.1.3 (A:8-32) Pinch (particularly interesting | 0.002 |
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Length = 35 | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: LIM domain domain: Leupaxin species: Human (Homo sapiens) [TaxId: 9606]
Score = 57.7 bits (140), Expect = 8e-13
Identities = 14/34 (41%), Positives = 23/34 (67%)
Query: 135 DYHNLFSPRCSYCNGPILDKCVTALEKTWHTEHF 168
D+ +FSP+C CN P+L+ ++A++ WH E F
Sbjct: 2 DFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECF 35
|
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Length = 35 | Back information, alignment and structure |
|---|
| >d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 31 | Back information, alignment and structure |
|---|
| >d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 31 | Back information, alignment and structure |
|---|
| >d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 35 | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 49 | Back information, alignment and structure |
|---|
| >d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Length = 32 | Back information, alignment and structure |
|---|
| >d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Length = 32 | Back information, alignment and structure |
|---|
| >d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 32 | Back information, alignment and structure |
|---|
| >d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Length = 32 | Back information, alignment and structure |
|---|
| >d2d8xa2 g.39.1.3 (A:8-32) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 26 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 185 | |||
| d1x3ha1 | 35 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 99.52 | |
| d2dloa1 | 35 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 99.25 | |
| d1v6ga1 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 99.12 | |
| d2cuqa2 | 35 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 99.07 | |
| d2dara2 | 45 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 99.05 | |
| d1x6aa1 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 98.91 | |
| d1x63a1 | 37 | Four and a half LIM domains protein 1, FHL-1 {Huma | 98.88 | |
| d2d8xa2 | 26 | Pinch (particularly interesting new Cys-His) prote | 98.87 | |
| d1u5sb1 | 31 | Pinch (particularly interesting new Cys-His) prote | 98.82 | |
| d1g47a2 | 35 | Pinch (particularly interesting new Cys-His) prote | 98.68 | |
| d1x3ha1 | 35 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 98.64 | |
| d1b8ta4 | 49 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.6 | |
| d2d8ya2 | 42 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 98.54 | |
| d2dloa1 | 35 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 98.5 | |
| d1x62a2 | 35 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 98.48 | |
| d2dara2 | 45 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 98.45 | |
| d2d8xa2 | 26 | Pinch (particularly interesting new Cys-His) prote | 98.39 | |
| d1x64a1 | 45 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 98.38 | |
| d1imla2 | 48 | Cysteine-rich (intestinal) protein, CRP, CRIP {Rat | 98.35 | |
| d1rutx3 | 31 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 98.35 | |
| d2d8ya1 | 35 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 98.3 | |
| d2co8a2 | 36 | Nedd9 interacting protein with calponin homology, | 98.3 | |
| d2d8za1 | 26 | Four and a half LIM domains protein 2, FHL2 {Human | 98.29 | |
| d2cu8a1 | 30 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 98.28 | |
| d2dj7a2 | 36 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 98.28 | |
| d1x4la1 | 29 | Four and a half LIM domains protein 2, FHL2 {Human | 98.28 | |
| d1b8ta3 | 43 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.24 | |
| d2dj7a2 | 36 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 98.22 | |
| d2dj7a1 | 31 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 98.2 | |
| d1x68a1 | 29 | Four and a half LIM domains protein 5, FHL-5 {Huma | 98.18 | |
| d1wiga1 | 32 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 98.15 | |
| d2cura2 | 26 | Four and a half LIM domains protein 1, FHL-1 {Huma | 98.15 | |
| d1ibia2 | 31 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 98.14 | |
| d1zfoa_ | 30 | LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | 98.14 | |
| d2d8za2 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 98.12 | |
| d1u5sb1 | 31 | Pinch (particularly interesting new Cys-His) prote | 98.09 | |
| d1x3ha2 | 32 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 98.08 | |
| d1rutx1 | 30 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 98.08 | |
| d1b8ta2 | 65 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.07 | |
| d1u5sb2 | 35 | Pinch (particularly interesting new Cys-His) prote | 98.04 | |
| d2cu8a2 | 33 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 98.02 | |
| d1j2oa1 | 30 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 97.96 | |
| d1zfoa_ | 30 | LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | 97.95 | |
| d1x4ka2 | 27 | Four and a half LIM domains protein 2, FHL2 {Human | 97.94 | |
| d2d8ya1 | 35 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 97.89 | |
| d2cuqa1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.88 | |
| d1wyha2 | 27 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.82 | |
| d1a7ia2 | 32 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.8 | |
| d2co8a2 | 36 | Nedd9 interacting protein with calponin homology, | 97.79 | |
| d2dara1 | 32 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 97.79 | |
| d1x63a1 | 37 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.78 | |
| d1b8ta3 | 43 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 97.72 | |
| d1rutx1 | 30 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 97.72 | |
| d2d8za1 | 26 | Four and a half LIM domains protein 2, FHL2 {Human | 97.71 | |
| d1x4la1 | 29 | Four and a half LIM domains protein 2, FHL2 {Human | 97.68 | |
| d1ibia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.67 | |
| d2cuqa2 | 35 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.67 | |
| d2cu8a1 | 30 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 97.65 | |
| d1j2oa1 | 30 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 97.64 | |
| d1b8ta1 | 35 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 97.62 | |
| d2cura2 | 26 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.55 | |
| d1a7ia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.53 | |
| d1x4ka1 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 97.48 | |
| d1x68a1 | 29 | Four and a half LIM domains protein 5, FHL-5 {Huma | 97.47 | |
| d1x4ka2 | 27 | Four and a half LIM domains protein 2, FHL2 {Human | 97.46 | |
| d1rutx3 | 31 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 97.43 | |
| d1wyha1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.41 | |
| d1x61a2 | 32 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.4 | |
| d1wyha2 | 27 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.37 | |
| d1x62a2 | 35 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 97.33 | |
| d2cura1 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.28 | |
| d1v6ga1 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 97.23 | |
| d1x64a1 | 45 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 97.17 | |
| d2cupa3 | 27 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.09 | |
| d2dloa2 | 33 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.0 | |
| d1a7ia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 96.91 | |
| d1rutx2 | 34 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 96.86 | |
| d1x61a1 | 27 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 96.83 | |
| d2cora2 | 35 | Pinch (particularly interesting new Cys-His) prote | 96.79 | |
| d1b8ta1 | 35 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 96.76 | |
| d2cupa3 | 27 | Four and a half LIM domains protein 1, FHL-1 {Huma | 96.63 | |
| d1x64a2 | 31 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 96.34 | |
| d1wiga1 | 32 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 96.33 | |
| d1x61a1 | 27 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 95.94 | |
| d1x63a2 | 32 | Four and a half LIM domains protein 1, FHL-1 {Huma | 95.92 | |
| d1g47a1 | 35 | Pinch (particularly interesting new Cys-His) prote | 95.62 | |
| d1x62a1 | 31 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 95.36 | |
| d1ibia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 95.25 | |
| d1x6aa1 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 95.22 | |
| d2co8a1 | 33 | Nedd9 interacting protein with calponin homology, | 95.17 | |
| d1j2oa2 | 33 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 94.23 | |
| d1wiga2 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 94.05 | |
| d1rutx4 | 33 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 93.87 | |
| d1x6aa2 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 93.7 | |
| d2cora1 | 31 | Pinch (particularly interesting new Cys-His) prote | 93.63 | |
| d1rutx4 | 33 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 93.01 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 92.96 | |
| d2cora2 | 35 | Pinch (particularly interesting new Cys-His) prote | 92.86 | |
| d1g47a1 | 35 | Pinch (particularly interesting new Cys-His) prote | 91.31 | |
| d2d8xa1 | 32 | Pinch (particularly interesting new Cys-His) prote | 90.49 | |
| d2cupa2 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 90.42 | |
| d1g47a2 | 35 | Pinch (particularly interesting new Cys-His) prote | 90.32 | |
| d1x68a2 | 34 | Four and a half LIM domains protein 5, FHL-5 {Huma | 88.11 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 85.66 |
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: LIM domain domain: Leupaxin species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.52 E-value=2.2e-15 Score=79.71 Aligned_cols=35 Identities=40% Similarity=1.047 Sum_probs=33.7
Q ss_pred cchhhccCCCCCccCCcccCceEEeCCCeecccCc
Q psy3656 134 PDYHNLFSPRCSYCNGPILDKCVTALEKTWHTEHF 168 (185)
Q Consensus 134 ~~~~~~~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf 168 (185)
++|.++|+++|..|+++|+|++|+|+++.||++||
T Consensus 1 ~DY~~~fapkC~~C~~~I~g~~v~Al~~~wHpeCF 35 (35)
T d1x3ha1 1 KDFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECF 35 (35)
T ss_dssp CCCCCCCSCBCTTTCCBCCSSCEEETTEEECTTTC
T ss_pred CcHHHHhChhhhhcCCcccchheeecCCccCcccC
Confidence 47999999999999999999999999999999998
|
| >d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2co8a1 g.39.1.3 (A:44-76) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j2oa2 g.39.1.3 (A:31-63) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|