Psyllid ID: psy3664

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500----
MGKRQHQSDKLYLTYTEWTTLYGGKKAGPEKSDFKRLPFDHCCVSLQPYEHPYCDKDGNIFELEALMGYLKQYKHNPVTGKPLDVKSLIKLNFHKNAKGEYHCPVLYKVFSKHSHLVAIETTGNVYSFEAVDQLNIKTKSFKDLLTDEPFQRKNIITLQDPNELSKFNLTNFHHLKNNLRVLTDEEKEQLKDPESRLKTVTNETRDILDTFKREYKPTEAKVEEKVKADAFNAAHYSQEEKEQLKDPESRLKTVTNETRDILDTFKREYKPTEAKVEEKVKADAFNAAHYSQGEVSASFTSTAMVPVTENICAVVEEDLVRYSRVVKKEEKEQLKDPESRLKTVTNETRDILDTFKREYKPTEAKVEEKVKADAFNAAHYSQVWLVSSRKLRDRIQKVDSKLSPMKHETFWTHSRENTNQLKPKLKRRSKQTHSMQPTILKKNTKPNYTHTGRGVLSMANSGPNTNTSQFFITYRSCNHLDGKHTVFGKMVGGMDTLSAIEKVE
ccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccEEEEHHHHHHHHHHcccccccccccccccEEEEEEEcccccEEcccccccccccEEEEEEEccccEEHHHHHHHHHcccccccccccccccccccEEEEEcccccccccccccHHcccccccccHHHHHHHccccHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHcccccccccccccccccHHHHHHHccccHHHHHHHHHHHccccccccccccccccEEEcccccccccHHHHccccHHHHHHHHHHHHHHHcccccEEEEEEEcccccEEEcccccccccHHHHHHHHHcccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccEEEEccccccccccccEEEEEEccHHHHHHHHHcc
cccccccccEEEEEEHHHHHHccccccccccccccccccccEEEEcccccccccccccEEEEHHHHHHHHHHHcccccccccccHHHcEEEEEEEcccccEcccEEEEEEccccEEEEEEccccHHHHHHHHHHcccHHHHHHHcccccccHHHEEEEcccccHHHccHHHcHHEccccccccHHHHHHcccccHHHHcccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcHHHHHHccccccccccccccHHHHcccccHHHcccHHHcHccccccccHHcHccccHHHHccccccccccccccHHHccHccEEHHHEcccccccccccccEEEEEEEccccEEEEEcccccHHHHHHHHHHHHcccccccEccccccEEEEEccccEEcccccccccccccHccccHHHccccccccccccccEcccccccccHHcccccccccccEEEEcccccccEcccEEEEccccHHHcccccEEEEEEEcHHHHHHHHccc
mgkrqhqsdklYLTYTEWttlyggkkagpeksdfkrlpfdhccvslqpyehpycdkdgniFELEALMGYLKqykhnpvtgkpldvKSLIKLnfhknakgeyhcpVLYKVFSKHSHLVAIettgnvysfeAVDQLNIKTKSfkdlltdepfqrkniitlqdpnelskfnltnfhhlkNNLRVLTDeekeqlkdpesrlktvtnETRDILDTFKREYKPTEAKVEEKVKADAFNAAHYSQEEKEqlkdpesrlktvtnETRDILDTFKREYKPTEAKVEEKVKADAfnaahysqgevsasftstamvpVTENICAVVEEDLVRYSRVVKKEEkeqlkdpesrlktvtnETRDILDTFKREYKPTEAKVEEKVKADAFNAAHYSQVWLVSSRKLRDRIQKvdsklspmkhetfwthsrentnqlkpklkrrskqthsmqptilkkntkpnythtgrgvlsmansgpntntsQFFITYRscnhldgkhtVFGKMVGGMDTLSAIEKVE
mgkrqhqsdklyLTYTEWTTLYGGKKAGPEKSDFKRLPFDHCCVSLQPYEHPYCDKDGNIFELEALMGYLKQYKHNPVTGKPLDVKSLIKLNFHKNAKGEYHCPVLYKVFSKHSHLVAIETTGNVYSFEAVDQLNIKTKSFKDLLTDEPFQRKNIITLQDPNELSKFNLTNFHHLKNNLRVltdeekeqlkdpesrlktvtnetrdildtfkreykpteakvEEKVKADAFNaahysqeekeqlkdpesrlktvtnetrdildtfkreykpteakVEEKVKADAFNAAHYSQGEVSASFTSTAMVPVTENICAVVEEDLVRYSRvvkkeekeqlkdpesrlktvtnetrdildtfkreykpteaKVEEKVkadafnaahysqvwlvssrklRDRIQKvdsklspmkhetfwthsrentnqlkpklkrrskqthsmqptilkkntkpnytHTGRGVLSMANSGPNTNTSQFFITYRSCNHLDGKHTVFGKMVGGMDTLSAIEKVE
MGKRQHQSDKlyltytewttlyGGKKAGPEKSDFKRLPFDHCCVSLQPYEHPYCDKDGNIFELEALMGYLKQYKHNPVTGKPLDVKSLIKLNFHKNAKGEYHCPVLYKVFSKHSHLVAIETTGNVYSFEAVDQLNIKTKSFKDLLTDEPFQRKNIITLQDPNELSKFNLTNFHHLKNNLRVLTDEEKEQLKDPESRLKTVTNETRDILDTFKREYKPTEAKVEEKVKADAFNAAHYSQEEKEQLKDPESRLKTVTNETRDILDTFKREYKPTEAKVEEKVKADAFNAAHYSQGEVSASFTSTAMVPVTENICAVVEEDLVRYSRVVKKEEKEQLKDPESRLKTVTNETRDILDTFKREYKPTEAKVEEKVKADAFNAAHYSQVWLVSSRKLRDRIQKVDSKLSPMKHETFWTHSRENTNQLKPKLKRRSKQTHSMQPTILKKNTKPNYTHTGRGVLSMANSGPNTNTSQFFITYRSCNHLDGKHTVFGKMVGGMDTLSAIEKVE
**********LYLTYTEWTTLYGGKKAGPEKSDFKRLPFDHCCVSLQPYEHPYCDKDGNIFELEALMGYLKQYKHNPVTGKPLDVKSLIKLNFHKNAKGEYHCPVLYKVFSKHSHLVAIETTGNVYSFEAVDQLNIKTKSFKDLLTDEPFQRKNIITLQDPNELSKFNLTNFHHLKNNLRVL******************************************************************************************************FNAAHYSQGEVSASFTSTAMVPVTENICAVVEEDLVRYSRVV*******************************************VKADAFNAAHYSQVWLVSSRKL****************************************************************************SQFFITYRSCNHLDGKHTVFGKMVGGMD*********
******Q***LYLTYTEWT*******************FDHCCVSLQPYEHPYCDKDGNIFELEALMGYLKQYKHNPVTGKPLDVKSLIKLNFHKNAKGEYHCPVLYKVFSKHSHLVAIETTGNVYSFEAVDQLNIKTKSFKDLLTDEPFQRKNIITLQDPNELSKFNLTNFHHLK**************************ETRDILD*******************************************************************************HYSQG*V************TENICAVVEEDLVRY**************PESRLKTVTNETRDILDTFKREYKPTEAKVEEKVKADAFNAAHYSQVWLVSSRKLRDRIQKVDSKLSPMKHETFWTHSRENTN**************SMQPTILKKNTKPNYTHTGRGVLSMANSGPNTNTSQFFITYRSCNHLDGKHTVFGKMVGGMDTLSAIEKV*
********DKLYLTYTEWTTLYGGKKAGPEKSDFKRLPFDHCCVSLQPYEHPYCDKDGNIFELEALMGYLKQYKHNPVTGKPLDVKSLIKLNFHKNAKGEYHCPVLYKVFSKHSHLVAIETTGNVYSFEAVDQLNIKTKSFKDLLTDEPFQRKNIITLQDPNELSKFNLTNFHHLKNNLRVLTDE*********SRLKTVTNETRDILDTFKREYKPTEAKVEEKVKADAFNAAH*************SRLKTVTNETRDILDTFKREYKPTEAKVEEKVKADAFNAAHYSQGEVSASFTSTAMVPVTENICAVVEEDLVRYSRVVK***********SRLKTVTNETRDILDTFKREYKPTEAKVEEKVKADAFNAAHYSQVWLVSSRKLRDRIQKVDSKLSPMKHETFWTHSREN******************QPTILKKNTKPNYTHTGRGVLSMANSGPNTNTSQFFITYRSCNHLDGKHTVFGKMVGGMDTLSAIEKVE
******QSDKLYLTYTEWTTLYGGK*****KSDFKRLPFDHCCVSLQPYEHPYCDKDGNIFELEALMGYLKQYKHNPVTGKPLDVKSLIKLNFHKNAKGEYHCPVLYKVFSKHSHLVAIETTGNVYSFEAVDQLNIKTKSFKDLLTDEPFQRKNIITLQDPNELSKFNLTNFHHLKNNLRVLTDEEKEQLKDPESRLKTVTNETRDILDTFKREYKPTEAKVEEK*K*DAFNAAHYS******************************************************************MVPVTENICAVVEEDLVRYSRVVKKEEKEQLKDPESRLKTVTNETRDILDTFKREYKPTEAKVEEKVKADAFNAAHYSQVWLVSSRKLRDRIQKVDSKLSPMKHETFWTHSRENTNQLKPKLKRRSKQTHSMQPTILKKNTKPNYTHTGRGVLSMANSGPNTNTSQFFITYRSCNHLDGKHTVFGKMVGGMDTLSAIE***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKRQHQSDKLYLTYTEWTTLYGGKKAGPEKSDFKRLPFDHCCVSLQPYEHPYCDKDGNIFELEALMGYLKQYKHNPVTGKPLDVKSLIKLNFHKNAKGEYHCPVLYKVFSKHSHLVAIETTGNVYSFEAVDQLNIKTKSFKDLLTDEPFQRKNIITLQDPNELSKFNLTNFHHLKNNLRVLTDEEKEQLKDPESRLKTVTNETRDILDTFKREYKPTEAKVEEKVKADAFNAAHYSQEEKEQLKDPESRLKTVTNETRDILDTFKREYKPTEAKVEEKVKADAFNAAHYSQGEVSASFTSTAMVPVTENICAVVEEDLVRYSRVVKKEEKEQLKDPESRLKTVTNETRDILDTFKREYKPTEAKVEEKVKADAFNAAHYSQVWLVSSRKLRDRIQKVDSKLSPMKHETFWTHSRENTNQLKPKLKRRSKQTHSMQPTILKKNTKPNYTHTGRGVLSMANSGPNTNTSQFFITYRSCNHLDGKHTVFGKMVGGMDTLSAIEKVE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query504 2.2.26 [Sep-21-2011]
Q9D787 521 Peptidyl-prolyl cis-trans yes N/A 0.805 0.779 0.433 1e-104
Q13356 520 Peptidyl-prolyl cis-trans yes N/A 0.807 0.782 0.422 1e-103
Q9FJX0 595 Peptidyl-prolyl cis-trans yes N/A 0.882 0.747 0.327 2e-73
P0C1J1 533 Peptidyl-prolyl cis-trans N/A N/A 0.817 0.772 0.366 2e-72
P0CP90 573 Peptidyl-prolyl cis-trans yes N/A 0.853 0.750 0.343 3e-66
P0CP91 573 Peptidyl-prolyl cis-trans N/A N/A 0.853 0.750 0.343 3e-66
P52012523 Peptidyl-prolyl cis-trans yes N/A 0.472 0.455 0.481 2e-63
Q4WVU5 579 Peptidyl-prolyl cis-trans yes N/A 0.835 0.727 0.325 1e-62
Q5AXT6 580 Peptidyl-prolyl cis-trans yes N/A 0.827 0.718 0.332 6e-60
Q7RXA6 597 Peptidyl-prolyl cis-trans N/A N/A 0.871 0.735 0.323 1e-58
>sp|Q9D787|PPIL2_MOUSE Peptidyl-prolyl cis-trans isomerase-like 2 OS=Mus musculus GN=Ppil2 PE=2 SV=2 Back     alignment and function desciption
 Score =  380 bits (976), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 222/512 (43%), Positives = 296/512 (57%), Gaps = 106/512 (20%)

Query: 1   MGKRQHQSDKLYLTYTEWTTLYGGKKAGPEKSDFKRLPFDHCCVSLQPYEHPYCDKDGNI 60
           MGKRQHQ DK+Y+T  E+T  YGG+K    ++ F+RLPFDHC +SLQP+ +P C  +G +
Sbjct: 1   MGKRQHQKDKMYITCAEYTHFYGGRKPDISQTSFRRLPFDHCSLSLQPFVYPVCTPEGVV 60

Query: 61  FELEALMGYLKQYKHNPVTGKPLDVKSLIKLNFHKNAKGEYHCPVLYKVFSKHSHLVAIE 120
           F+L  ++ +LK+Y  NP TG+ LD KSLIKLNF KN++G+YHCPVLY VF+ ++H+VAI 
Sbjct: 61  FDLLNIVPWLKKYGTNPSTGEKLDGKSLIKLNFAKNSEGQYHCPVLYSVFTDNTHIVAIR 120

Query: 121 TTGNVYSFEAVDQLNIKTKSFKDLLTDEPFQRKNIITLQDPNELSKFNLTNFHHLKNNLR 180
           TTGNVY++EAV+QLNIK K+ +DLLTDEPF R++IITLQDP  L KFN++NF H+KNN+R
Sbjct: 121 TTGNVYTYEAVEQLNIKAKNLRDLLTDEPFSRQDIITLQDPTNLDKFNVSNFFHVKNNMR 180

Query: 181 VLTDEEKEQLKDPESRLKTVTNETRDILDTFKREYKPTEAKVEEKVKADAFNAAHYSQEE 240
           ++         DP+                            EEK K             
Sbjct: 181 II---------DPD----------------------------EEKAK------------- 190

Query: 241 KEQLKDPESRLKTVTNETRDILDTFKREYKPTE-----AKVEEKVKADAFNAAHYSQGEV 295
               +DP   LK   +ETR+ L    +E+K  E      +  EK K D  NAAHYS G+V
Sbjct: 191 ----QDPSYYLKNTNSETRETLQELYKEFKGDEILAATMRPPEKKKVDQLNAAHYSTGKV 246

Query: 296 SASFTSTAMVPVTENICAVVEEDLVRYSRVVKKEEKEQL--KDPESRLKTVTNETRDILD 353
           SASFTSTAMVP T +  AV++ED++RY + VKK+   +L     +  L+   + T    +
Sbjct: 247 SASFTSTAMVPETTHEAAVIDEDVLRY-QFVKKKGYVRLHTNKGDLNLELHCDLTPKTCE 305

Query: 354 TFKREYKPTEAKVEEKVKADAFNAAHYSQVWLVSSRKLRD-RIQKVDSKLSPMKHETFWT 412
            F         K+ +K   D            +  R +R+  IQ  D   +    E+FW 
Sbjct: 306 NF--------IKLCKKQYYDG----------TIFHRSIRNFVIQGGDPTGTGTGGESFWG 347

Query: 413 HSRENTNQLKPKLKRRSKQTHSMQPTILKKNTKPNYTHTGRGVLSMANSGPNTNTSQFFI 472
                    KP                 K   +PN +HTGRGVLSMANSGPNTN SQFFI
Sbjct: 348 ---------KP----------------FKDEFRPNLSHTGRGVLSMANSGPNTNKSQFFI 382

Query: 473 TYRSCNHLDGKHTVFGKMVGGMDTLSAIEKVE 504
           T+RSC +LD KHT+FG++VGG DTL+A+E VE
Sbjct: 383 TFRSCAYLDKKHTIFGRVVGGFDTLTAMENVE 414
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Mus musculus (taxid: 10090)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q13356|PPIL2_HUMAN Peptidyl-prolyl cis-trans isomerase-like 2 OS=Homo sapiens GN=PPIL2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FJX0|PPIL2_ARATH Peptidyl-prolyl cis-trans isomerase-like 2 OS=Arabidopsis thaliana GN=PUB49 PE=2 SV=1 Back     alignment and function description
>sp|P0C1J1|PPIL2_RHIO9 Peptidyl-prolyl cis-trans isomerase-like 2 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp14 PE=3 SV=1 Back     alignment and function description
>sp|P0CP90|PPIL2_CRYNJ Peptidyl-prolyl cis-trans isomerase-like 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP8 PE=3 SV=1 Back     alignment and function description
>sp|P0CP91|PPIL2_CRYNB Peptidyl-prolyl cis-trans isomerase-like 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP8 PE=3 SV=1 Back     alignment and function description
>sp|P52012|CYP4_CAEEL Peptidyl-prolyl cis-trans isomerase 4 OS=Caenorhabditis elegans GN=cyn-4 PE=1 SV=3 Back     alignment and function description
>sp|Q4WVU5|PPIL2_ASPFU Peptidyl-prolyl cis-trans isomerase-like 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp8 PE=3 SV=2 Back     alignment and function description
>sp|Q5AXT6|PPIL2_EMENI Peptidyl-prolyl cis-trans isomerase-like 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp8 PE=3 SV=1 Back     alignment and function description
>sp|Q7RXA6|PPIL2_NEUCR Peptidyl-prolyl cis-trans isomerase-like 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyp-8 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query504
193713765521 PREDICTED: peptidyl-prolyl cis-trans iso 0.809 0.783 0.472 1e-123
156547840520 PREDICTED: peptidyl-prolyl cis-trans iso 0.809 0.784 0.477 1e-123
383863623520 PREDICTED: peptidyl-prolyl cis-trans iso 0.803 0.778 0.467 1e-116
380025708521 PREDICTED: peptidyl-prolyl cis-trans iso 0.809 0.783 0.450 1e-114
66509307521 PREDICTED: peptidyl-prolyl cis-trans iso 0.809 0.783 0.447 1e-113
157131145522 cyclophilin [Aedes aegypti] gi|108871631 0.809 0.781 0.438 1e-112
307174006523 Peptidyl-prolyl cis-trans isomerase-like 0.809 0.780 0.449 1e-112
157137109522 cyclophilin [Aedes aegypti] gi|108869800 0.809 0.781 0.437 1e-112
322801489518 hypothetical protein SINV_11188 [Solenop 0.799 0.777 0.448 1e-112
242018129517 conserved hypothetical protein [Pediculu 0.811 0.791 0.447 1e-111
>gi|193713765|ref|XP_001949317.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  448 bits (1153), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 239/506 (47%), Positives = 308/506 (60%), Gaps = 98/506 (19%)

Query: 1   MGKRQHQSDKLYLTYTEWTTLYGGKKAGPEKSDFKRLPFDHCCVSLQPYEHPYCDKDGNI 60
           MGKRQHQ DK+YLTYTEW+TLYGGK+ G EK  F RLPFDHCC+SL  ++ PYCD DGNI
Sbjct: 1   MGKRQHQKDKMYLTYTEWSTLYGGKRPGIEKPKFARLPFDHCCLSLVAFKTPYCDPDGNI 60

Query: 61  FELEALMGYLKQYKHNPVTGKPLDVKSLIKLNFHKNAKGEYHCPVLYKVFSKHSHLVAIE 120
           FE EAL+ Y+KQ+KHNPVTGKP+++K LIKLNFH+NA GEYHCPVL+K  +KHSH++AI+
Sbjct: 61  FEYEALLEYIKQFKHNPVTGKPIELKKLIKLNFHRNAAGEYHCPVLFKSLTKHSHIIAIK 120

Query: 121 TTGNVYSFEAVDQLNIKTKSFKDLLTDEPFQRKNIITLQDPNELSKFNLTNFHHLKNNLR 180
           TTGNV+S+EA++QLNIKTK++KDLLTDEPF RK++ITLQDP  L+KFN+  FHH+   ++
Sbjct: 121 TTGNVFSYEAIEQLNIKTKNWKDLLTDEPFLRKDMITLQDPTNLTKFNIAKFHHVVKKIK 180

Query: 181 VLTDEEKEQLKDPESRLKTVTNETRDILDTFKREYKPTEAKVEEKVKADAFNAAHYSQEE 240
           V+         DP+                                             E
Sbjct: 181 VV---------DPD---------------------------------------------E 186

Query: 241 KEQLKDPESRLKTVTNETRDILDTFKREYKPTEAKVEEKV-KADAFNAAHYSQGEVSASF 299
           + Q KDPE RLK+V+  TRDILDT  R+YK    KVE    K D  NAAHYS G V+ASF
Sbjct: 187 EAQSKDPEGRLKSVSKTTRDILDTLDRDYKEPAKKVELVAQKPDKLNAAHYSTGRVAASF 246

Query: 300 TSTAMVPVTENICAVVEEDLVRYSRVVKKEEKEQLKDPESRLKTVTNETRDILDTFKREY 359
           TSTAMVPV E+  A++EE+ +R+ R+ KK            ++  TN     L+ F +E 
Sbjct: 247 TSTAMVPVLEHESAIIEENEIRFERIKKK----------GYVRLTTNYGPLNLELFCKEV 296

Query: 360 KPTEAKVEEKVKADAFNAAHYSQVWLVSSRKLRD-RIQKVDSKLSPMKHETFWTHSRENT 418
             T     +  + D ++   +        R +R+  +Q  D   +    E++W    E+ 
Sbjct: 297 PKTCENFIKLCQKDYYDGTKF-------HRSIRNFMVQGGDPTGTGKGGESYWGQPFED- 348

Query: 419 NQLKPKLKRRSKQTHSMQPTILKKNTKPNYTHTGRGVLSMANSGPNTNTSQFFITYRSCN 478
                                     K N  H+GRGVLSMANSGP+TN SQFFITYRSC 
Sbjct: 349 ------------------------EFKQNLNHSGRGVLSMANSGPDTNKSQFFITYRSCK 384

Query: 479 HLDGKHTVFGKMVGGMDTLSAIEKVE 504
           HLD KHTVFG++VGG +TL+AIE++E
Sbjct: 385 HLDNKHTVFGRIVGGFETLNAIEEIE 410

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|156547840|ref|XP_001602955.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 2-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383863623|ref|XP_003707279.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380025708|ref|XP_003696610.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 2-like [Apis florea] Back     alignment and taxonomy information
>gi|66509307|ref|XP_623363.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|157131145|ref|XP_001662138.1| cyclophilin [Aedes aegypti] gi|108871631|gb|EAT35856.1| AAEL012008-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|307174006|gb|EFN64716.1| Peptidyl-prolyl cis-trans isomerase-like 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|157137109|ref|XP_001663891.1| cyclophilin [Aedes aegypti] gi|108869800|gb|EAT34025.1| AAEL013705-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|322801489|gb|EFZ22150.1| hypothetical protein SINV_11188 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|242018129|ref|XP_002429533.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212514481|gb|EEB16795.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query504
FB|FBgn0034109517 CG7747 [Drosophila melanogaste 0.470 0.458 0.553 7.5e-101
ZFIN|ZDB-GENE-040426-1096524 ppil2 "peptidylprolyl isomeras 0.531 0.511 0.492 1e-92
UNIPROTKB|F1NPF4521 PPIL2 "Uncharacterized protein 0.541 0.523 0.487 1.6e-92
UNIPROTKB|Q2T9V1554 PPIL2 "Uncharacterized protein 0.323 0.294 0.567 3.3e-91
MGI|MGI:2447857521 Ppil2 "peptidylprolyl isomeras 0.470 0.454 0.520 6.2e-91
UNIPROTKB|Q13356520 PPIL2 "Peptidyl-prolyl cis-tra 0.470 0.455 0.516 4.4e-90
UNIPROTKB|F1RL00522 PPIL2 "Uncharacterized protein 0.470 0.454 0.512 7.1e-90
UNIPROTKB|E2RE23523 PPIL2 "Uncharacterized protein 0.468 0.451 0.526 9e-90
RGD|1309484521 Ppil2 "peptidylprolyl isomeras 0.470 0.454 0.516 1.5e-89
WB|WBGene00000880523 cyn-4 [Caenorhabditis elegans 0.519 0.500 0.436 6.6e-77
FB|FBgn0034109 CG7747 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 744 (267.0 bits), Expect = 7.5e-101, Sum P(2) = 7.5e-101
 Identities = 134/242 (55%), Positives = 183/242 (75%)

Query:     1 MGKRQHQSDKXXXXXXXXXXXXGGKKAGPEKSD---FKRLPFDHCCVSLQPYEHPYCDKD 57
             MGKRQHQ DK            GGKK    ++D   FKRLPF+HCC+++ PYE PYCD  
Sbjct:     1 MGKRQHQKDKMYLTYTEWSELYGGKKVESLENDHVKFKRLPFEHCCITMAPYEMPYCDLQ 60

Query:    58 GNIFELEALMGYLKQYKHNPVTGKPLDVKSLIKLNFHKNAKGEYHCPVLYKVFSKHSHLV 117
             GN+FE EA++ +LK +K NP+TG+ +D KSL+KLNFH+NA  EYHCP L+K FSK+SH+V
Sbjct:    61 GNVFEYEAILKFLKTFKVNPITGQKMDSKSLVKLNFHRNANDEYHCPALFKPFSKNSHIV 120

Query:   118 AIETTGNVYSFEAVDQLNIKTKSFKDLLTDEPFQRKNIITLQDPNELSKFNLTNFHHLKN 177
             A+ TTGNVY +EA+DQLNIKTK++KDL+ D PFQRK+IIT+QDP +L K++++ F+H+K 
Sbjct:   121 AVATTGNVYCWEAIDQLNIKTKNWKDLVDDTPFQRKDIITIQDPQKLEKYDISTFYHIKK 180

Query:   178 NLRVLTDEEKEQLKDPES-RLKTVTNETRDILDTFKREYKPTEAKVE-EKVKADAFNAAH 235
             NLRVLT+EE+++ K+P S R+KT+  ET++ L+  +++Y+P E +    K  AD FNAAH
Sbjct:   181 NLRVLTEEEQQERKNPASGRIKTMNLETKETLEQLQQDYQPAEEEASTSKRTADKFNAAH 240

Query:   236 YS 237
             YS
Sbjct:   241 YS 242
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS
GO:0006457 "protein folding" evidence=IEA
GO:0071013 "catalytic step 2 spliceosome" evidence=IDA
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC
ZFIN|ZDB-GENE-040426-1096 ppil2 "peptidylprolyl isomerase (cyclophilin)-like 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NPF4 PPIL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q2T9V1 PPIL2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:2447857 Ppil2 "peptidylprolyl isomerase (cyclophilin)-like 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q13356 PPIL2 "Peptidyl-prolyl cis-trans isomerase-like 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RL00 PPIL2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RE23 PPIL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1309484 Ppil2 "peptidylprolyl isomerase (cyclophilin)-like 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
WB|WBGene00000880 cyn-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9D787PPIL2_MOUSE5, ., 2, ., 1, ., 80.43350.80550.7792yesN/A
Q4WVU5PPIL2_ASPFU5, ., 2, ., 1, ., 80.32530.83530.7271yesN/A
P0CP90PPIL2_CRYNJ5, ., 2, ., 1, ., 80.34360.85310.7504yesN/A
Q13356PPIL2_HUMAN5, ., 2, ., 1, ., 80.42270.80750.7826yesN/A
Q09928PPIL2_SCHPO5, ., 2, ., 1, ., 80.30030.78570.7674yesN/A
Q5AXT6PPIL2_EMENI5, ., 2, ., 1, ., 80.33200.82730.7189yesN/A
Q9FJX0PPIL2_ARATH5, ., 2, ., 1, ., 80.32710.88290.7478yesN/A
Q2U5W8PPIL2_ASPOR5, ., 2, ., 1, ., 80.32040.76780.6789yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.766
4th Layer5.2.1.80.824

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query504
cd01923159 cd01923, cyclophilin_RING, cyclophilin_RING: cyclo 6e-32
cd00317146 cd00317, cyclophilin, cyclophilin: cyclophilin-typ 6e-26
pfam00160144 pfam00160, Pro_isomerase, Cyclophilin type peptidy 4e-24
cd01926164 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_lik 7e-24
cd01928153 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3 7e-23
COG0652158 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase 4e-22
PTZ00060183 PTZ00060, PTZ00060, cyclophilin; Provisional 5e-20
cd01927148 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclo 9e-19
cd01922146 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCY 4e-17
PLN03149186 PLN03149, PLN03149, peptidyl-prolyl isomerase H (c 1e-16
cd01921166 cd01921, cyclophilin_RRM, cyclophilin_RRM: cycloph 2e-12
cd01925171 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeC 1e-11
PTZ00221249 PTZ00221, PTZ00221, cyclophilin; Provisional 6e-07
cd01920155 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP 2e-06
smart0050463 smart00504, Ubox, Modified RING finger domain 5e-06
cd01924176 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40 3e-04
PRK10903190 PRK10903, PRK10903, peptidyl-prolyl cis-trans isom 7e-04
>gnl|CDD|238904 cd01923, cyclophilin_RING, cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information 
 Score =  119 bits (301), Expect = 6e-32
 Identities = 47/60 (78%), Positives = 53/60 (88%)

Query: 445 KPNYTHTGRGVLSMANSGPNTNTSQFFITYRSCNHLDGKHTVFGKMVGGMDTLSAIEKVE 504
           KPN +H GRGVLSMANSGPNTN SQFFITYRSC HLDGKHTVFG++VGG++TL A+E V 
Sbjct: 75  KPNLSHDGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTVFGRVVGGLETLEAMENVP 134

This group includes the nuclear proteins, Human hCyP-60 and Caenorhabditis elegans MOG-6 which, compared to the archetypal cyclophilin Human cyclophilin A exhibit reduced peptidylprolyl cis- trans isomerase activity and lack a residue important for cyclophilin binding. Human hCyP-60 has been shown to physically interact with the proteinase inhibitor peptide eglin c and; C. elegans MOG-6 to physically interact with MEP-1, a nuclear zinc finger protein. MOG-6 has been shown to function in germline sex determination. Length = 159
>gnl|CDD|238194 cd00317, cyclophilin, cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>gnl|CDD|215759 pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD Back     alignment and domain information
>gnl|CDD|238907 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>gnl|CDD|238909 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3_like Back     alignment and domain information
>gnl|CDD|223725 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|240249 PTZ00060, PTZ00060, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|238908 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>gnl|CDD|238903 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>gnl|CDD|178694 PLN03149, PLN03149, peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>gnl|CDD|238902 cd01921, cyclophilin_RRM, cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>gnl|CDD|238906 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>gnl|CDD|140248 PTZ00221, PTZ00221, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|238901 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>gnl|CDD|128780 smart00504, Ubox, Modified RING finger domain Back     alignment and domain information
>gnl|CDD|238905 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>gnl|CDD|182824 PRK10903, PRK10903, peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 504
KOG0883|consensus 518 100.0
KOG0881|consensus164 100.0
KOG0546|consensus 372 100.0
COG0652158 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase 100.0
KOG0884|consensus161 100.0
cd01927148 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ 100.0
cd01928153 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro 100.0
cd01923159 cyclophilin_RING cyclophilin_RING: cyclophilin-typ 100.0
KOG0882|consensus558 100.0
cd01922146 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c 100.0
KOG0880|consensus217 100.0
KOG0879|consensus177 100.0
cd01921166 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type 100.0
cd01925171 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: 100.0
cd01926164 cyclophilin_ABH_like cyclophilin_ABH_like: Cycloph 100.0
PLN03149186 peptidyl-prolyl isomerase H (cyclophilin H); Provi 100.0
PTZ00060183 cyclophilin; Provisional 100.0
KOG3039|consensus303 100.0
PRK10903190 peptidyl-prolyl cis-trans isomerase A (rotamase A) 100.0
PRK10791164 peptidyl-prolyl cis-trans isomerase B (rotamase B) 100.0
PTZ00221249 cyclophilin; Provisional 100.0
cd01920155 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyc 100.0
cd01924176 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyc 100.0
KOG0885|consensus 439 100.0
KOG0111|consensus298 100.0
PF04641260 Rtf2: Rtf2 RING-finger 100.0
KOG0415|consensus 479 100.0
cd00317146 cyclophilin cyclophilin: cyclophilin-type peptidyl 100.0
PF00160155 Pro_isomerase: Cyclophilin type peptidyl-prolyl ci 99.97
KOG0865|consensus167 99.94
KOG3113|consensus293 99.88
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.05
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.85
KOG0317|consensus293 98.52
KOG0826|consensus357 98.44
KOG0823|consensus230 98.38
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.25
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 98.25
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.22
KOG0320|consensus187 98.03
KOG2164|consensus513 98.03
KOG0289|consensus506 97.94
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 97.73
KOG0978|consensus698 97.66
KOG0320|consensus187 97.58
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.51
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.38
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 97.37
TIGR00599397 rad18 DNA repair protein rad18. This family is bas 97.29
PHA02929238 N1R/p28-like protein; Provisional 97.24
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 97.2
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.14
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 97.08
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 97.0
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.84
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 96.74
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 96.61
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 96.51
PF1463444 zf-RING_5: zinc-RING finger domain 96.51
KOG3039|consensus303 96.46
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 96.11
KOG0882|consensus 558 96.06
KOG0317|consensus293 96.04
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 96.01
KOG4642|consensus284 95.98
cd0016245 RING RING-finger (Really Interesting New Gene) dom 95.94
KOG0978|consensus698 95.9
TIGR00599397 rad18 DNA repair protein rad18. This family is bas 95.8
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 95.59
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 95.55
KOG2817|consensus394 95.54
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 95.32
KOG1813|consensus313 94.98
KOG2164|consensus513 94.95
PF04641260 Rtf2: Rtf2 RING-finger 94.93
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 94.82
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 94.77
COG5432391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 94.58
cd0016245 RING RING-finger (Really Interesting New Gene) dom 94.43
KOG0826|consensus357 94.15
COG5109396 Uncharacterized conserved protein, contains RING Z 94.04
KOG2979|consensus262 93.75
PF1463444 zf-RING_5: zinc-RING finger domain 93.73
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 93.59
KOG0287|consensus442 93.44
TIGR03268503 methan_mark_3 putative methanogenesis marker prote 93.19
PHA02929238 N1R/p28-like protein; Provisional 93.07
PHA02926242 zinc finger-like protein; Provisional 92.53
KOG0823|consensus230 92.26
COG5152259 Uncharacterized conserved protein, contains RING a 92.23
KOG2879|consensus298 91.75
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 91.39
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 91.28
PRK00969 508 hypothetical protein; Provisional 91.19
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 90.83
KOG2177|consensus386 90.68
PF12903147 DUF3830: Protein of unknown function (DUF3830); In 90.36
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 90.31
PRK00969 508 hypothetical protein; Provisional 89.93
KOG3800|consensus300 89.33
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 89.31
KOG1002|consensus791 88.88
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 88.87
KOG0289|consensus 506 88.71
PHA02926242 zinc finger-like protein; Provisional 88.23
TIGR03268 503 methan_mark_3 putative methanogenesis marker prote 87.3
KOG2879|consensus298 86.44
COG5222427 Uncharacterized conserved protein, contains RING Z 85.72
KOG0297|consensus391 85.28
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 85.24
KOG2177|consensus386 84.51
COG4070512 Predicted peptidyl-prolyl cis-trans isomerase (rot 81.83
KOG0827|consensus465 81.63
KOG4628|consensus348 81.39
KOG4159|consensus398 81.24
KOG0802|consensus543 80.14
>KOG0883|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.6e-130  Score=980.02  Aligned_cols=409  Identities=53%  Similarity=0.869  Sum_probs=395.1

Q ss_pred             CCCCcCcCCceeEeHHhhhhhcCCCCCCCC-CCCccccCCccccCCCCCCCCceecCCCcEEeHHHHHHHHHhcCCCCCC
Q psy3664           1 MGKRQHQSDKLYLTYTEWTTLYGGKKAGPE-KSDFKRLPFDHCCVSLQPYEHPYCDKDGNIFELEALMGYLKQYKHNPVT   79 (504)
Q Consensus         1 Mgk~~~~~d~~~iT~~E~~~~~G~~k~~~~-~~~~~~lpf~~C~Lsl~pl~~Pv~~~~G~lf~k~~Il~~L~~~~~~Pvt   79 (504)
                      |||+|||||+||||++||+..|||++...+ +..|+||||+||+|++.||++|||+.+|.||+...|++||+++|++|+|
T Consensus         1 MGKkQHqKDkmylT~tEw~~~~Ggkk~~~~n~~~FkrLP~~hC~lt~~Pfe~PvC~~dg~vFd~~~Ivp~lkk~g~nP~t   80 (518)
T KOG0883|consen    1 MGKKQHQKDKMYLTTTEWKSIYGGKKDTGENRTQFKRLPFNHCSLTMLPFEDPVCTVDGTVFDLTAIVPWLKKHGTNPIT   80 (518)
T ss_pred             CCcccccccceEEeehhhhhhcCCCCCCcccccccccCChhhceeccccccCcccccCCcEEeeehhhHHHHHcCCCCCC
Confidence            999999999999999999999999997644 8899999999999999999999999999999999999999999999999


Q ss_pred             CCcCCCCCceeEeeeeCCCCceeeccceeeecCceeEEEEccccceecHHHHHHHhhccCCcccCCCCcCCCCCCeeEec
Q psy3664          80 GKPLDVKSLIKLNFHKNAKGEYHCPVLYKVFSKHSHLVAIETTGNVYSFEAVDQLNIKTKSFKDLLTDEPFQRKNIITLQ  159 (504)
Q Consensus        80 g~~l~~kdLi~l~f~~n~~~~~~CPvt~k~f~~~t~~v~i~~~G~V~s~~av~~l~~~~k~~~c~v~~~~f~~~DiI~lq  159 (504)
                      |++++.+|||+|+|++|++|+|+|||++|+|++++|||||+++||||||+||++|||+.++|+||++++||+|.|||+||
T Consensus        81 G~kl~~~dLIkL~F~Kns~geyhcPvlfk~FT~~sHIvAv~TTGNvy~~eai~~LNiK~knwkdLltdepFtR~DiItiQ  160 (518)
T KOG0883|consen   81 GQKLDGKDLIKLKFHKNSEGEYHCPVLFKVFTRFSHIVAVRTTGNVYSWEAIEELNIKTKNWKDLLTDEPFTRADIITIQ  160 (518)
T ss_pred             CCccccccceeeeeccCCCCcccCceeeeeecccceEEEEEecCceeeHHHHHHhCcchhhHHHhhccCCcchhceeeec
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCcchhccccccccccccccccHHHHhhccCCc-ccccccchhHHHHHHHhhhccCchhhhHHHHHhhhhhhhcccch
Q psy3664         160 DPNELSKFNLTNFHHLKNNLRVLTDEEKEQLKDPE-SRLKTVTNETRDILDTFKREYKPTEAKVEEKVKADAFNAAHYSQ  238 (504)
Q Consensus       160 dp~~~~~~~~~~f~h~k~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~  238 (504)
                      ||++++++++++|+|||+++++.+++++.++.+|. .+++++|.+++..|+||.+++++++..+                
T Consensus       161 dP~~lek~~~~~F~hvk~~lk~~~eeek~~~~dpa~~~~k~~n~e~ks~l~el~k~~~p~~~~a----------------  224 (518)
T KOG0883|consen  161 DPNNLEKFNMSDFYHVKKNLKTADEEEKKAKKDPALGYIKAMNLETKSTLPELSKEYQPKKSIA----------------  224 (518)
T ss_pred             CcchhhccchhhHHHHhcccccCcHHHHHhhcCchhhhhhhcchhhhhhhHHHhhhhccchhhh----------------
Confidence            99999999999999999999999999999999999 7899999999999999999887776322                


Q ss_pred             HHHhhccCccccccccccccccccccccccCCcchhhHHhhhhcccccccccCCCccccceecccCCCCcccccccccch
Q psy3664         239 EEKEQLKDPESRLKTVTNETRDILDTFKREYKPTEAKVEEKVKADAFNAAHYSQGEVSASFTSTAMVPVTENICAVVEED  318 (504)
Q Consensus       239 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~a~s~tst~~~~~~~~~~~~~~~~  318 (504)
                                                           +....++|++|+||||+|.+|+|||||++.|+|.++++++.++
T Consensus       225 -------------------------------------~t~~~~aD~~naahyStG~vaasfTSTam~PvT~neaaiid~d  267 (518)
T KOG0883|consen  225 -------------------------------------STMKRSADKINAAHYSTGAVAASFTSTAMTPVTKNEAAIIDED  267 (518)
T ss_pred             -------------------------------------hhccccchhhhhhhccccceeceeccceeeecccchhhhccch
Confidence                                                 0112346789999999999999999999999999999999999


Q ss_pred             hhhhhhcchhhhhhhcCCCceEEEeeeCceeEEEEeecCCChhHHHHHHHHhhccCCCCccccccceeEEEeeCC-cccc
Q psy3664         319 LVRYSRVVKKEEKEQLKDPESRLKTVTNETRDILDTFKREYKPTEAKVEEKVKADAFNAAHYSQVWLVSSRKLRD-RIQK  397 (504)
Q Consensus       319 ~~~~~~~k~k~~~~~~~~p~V~l~~~T~~G~I~IeL~~d~aP~t~~NF~~L~~~g~Y~g~~~s~~~~~fhRvi~~-~iQg  397 (504)
                      .++|.|+|++||        |+|  .|+.|+|+||||||.+|++|+||+.||++|||+|+.       |||.|++ ||||
T Consensus       268 ~~ry~rvKkkgy--------vrl--~Tn~G~lNlELhcd~~P~aceNFI~lc~~gYYnnt~-------FHRsIrnFmiQG  330 (518)
T KOG0883|consen  268 DVRYTRVKKKGY--------VRL--VTNHGPLNLELHCDYAPRACENFITLCKNGYYNNTI-------FHRSIRNFMIQG  330 (518)
T ss_pred             hhhhccccccce--------EEE--eccCCceeeEeecCcchHHHHHHHHHHhcccccchH-------HHHHHHHHeeeC
Confidence            999999999999        999  999999999999999999999999999999999999       9999999 9999


Q ss_pred             cCCCCCCCCCcccccCccccccccchhhhccccccCCCCCccccCCCCCCCCCCCCcEEEEecCCCCCCCccEEEEcCCC
Q psy3664         398 VDSKLSPMKHETFWTHSRENTNQLKPKLKRRSKQTHSMQPTILKKNTKPNYTHTGRGVLSMANSGPNTNTSQFFITYRSC  477 (504)
Q Consensus       398 GDp~~~g~gg~s~~g~~~~~~~~~~p~~~~~~~~~~~~~~~~f~de~~~~l~h~~rG~lsmansgpns~~SQFfItl~~~  477 (504)
                      |||+|+|.||+||||++                         |+||+.++|.|+.||+|||||+|||+|||||||++++|
T Consensus       331 GDPTGTG~GGeSiWgKp-------------------------FkDEf~~~l~H~gRGvlSMANsGpnTNgSQFFItyrsc  385 (518)
T KOG0883|consen  331 GDPTGTGRGGESIWGKP-------------------------FKDEFCSNLSHDGRGVLSMANSGPNTNGSQFFITYRSC  385 (518)
T ss_pred             CCCCCCCCCCccccCCc-------------------------cccccCCCCCcCCcceEeeccCCCCCCCceEEEEecch
Confidence            99999999999999999                         99999999999999999999999999999999999999


Q ss_pred             CCCCCCCcEEEEEEccHHHHHHHhhCC
Q psy3664         478 NHLDGKHTVFGKMVGGMDTLSAIEKVE  504 (504)
Q Consensus       478 ~~LD~k~tvFG~Vv~GmdvL~kI~~~~  504 (504)
                      .|||++|||||+||+|+|+|.+||+||
T Consensus       386 khLd~KHTIFGrvVGGldtL~amEnve  412 (518)
T KOG0883|consen  386 KHLDNKHTIFGRVVGGLDTLTAMENVE  412 (518)
T ss_pred             hhccccceeeeeeeccHHHHHHHhcCC
Confidence            999999999999999999999999986

>KOG0881|consensus Back     alignment and domain information
>KOG0546|consensus Back     alignment and domain information
>COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0884|consensus Back     alignment and domain information
>cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like Back     alignment and domain information
>cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>KOG0880|consensus Back     alignment and domain information
>KOG0879|consensus Back     alignment and domain information
>cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>cd01925 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>cd01926 cyclophilin_ABH_like cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>PLN03149 peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>PTZ00060 cyclophilin; Provisional Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>PTZ00221 cyclophilin; Provisional Back     alignment and domain information
>cd01920 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>cd01924 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>KOG0885|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>cd00317 cyclophilin cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>PF00160 Pro_isomerase: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD; InterPro: IPR002130 Cyclophilin [] is the major high-affinity binding protein in vertebrates for the immunosuppressive drug cyclosporin A (CSA), but is also found in other organisms Back     alignment and domain information
>KOG0865|consensus Back     alignment and domain information
>KOG3113|consensus Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>KOG0826|consensus Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG2817|consensus Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1813|consensus Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG0826|consensus Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2979|consensus Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287|consensus Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG2879|consensus Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG2177|consensus Back     alignment and domain information
>PF12903 DUF3830: Protein of unknown function (DUF3830); InterPro: IPR024532 This is a family of bacterial and archaeal proteins Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>KOG3800|consensus Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>KOG2879|consensus Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0297|consensus Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG2177|consensus Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>KOG4628|consensus Back     alignment and domain information
>KOG4159|consensus Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query504
1zkc_A197 Crystal Structure Of The Cyclophiln_ring Domain Of 5e-22
3bo7_A201 Crystal Structure Of Toxoplasma Gondii Peptidyl-Pro 5e-15
1xyh_A161 Crystal Structure Of Recombinant Human Cyclophilin 3e-13
2oju_A167 X-Ray Structure Of Complex Of Human Cyclophilin J W 5e-13
2ck1_A172 The Structure Of Oxidised Cyclophilin A From S. Man 7e-13
2plu_A186 Crystal Structure Of Cryptosporidium Parvum Cycloph 7e-13
1zmf_A165 C Domain Of Human Cyclophilin-33(Hcyp33) Length = 1 8e-13
4dgd_A165 Trimcyp Cyclophilin Domain From Macaca Mulatta: H70 1e-12
1qng_A170 Plasmodium Falciparum Cyclophilin Complexed With Cy 1e-12
1m9e_A164 X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- 1e-12
3r49_A166 Human Cyclophilin D Complexed With Quinolin-8-Amine 1e-12
2z6w_A165 Crystal Structure Of Human Cyclophilin D In Complex 1e-12
3qyu_A164 Crystal Structure Of Human Cyclophilin D At 1.54 A 1e-12
2rma_A165 Crystal Structures Of Cyclophilin A Complexed With 1e-12
2bit_X165 Crystal Structure Of Human Cyclophilin D At 1.7 A R 2e-12
2wlw_A165 Structure Of The N-Terminal Capsid Domain Of Hiv-2 2e-12
2r99_A173 Crystal Structure Of Cyclophilin Abh-Like Domain Of 2e-12
1bck_A165 Human Cyclophilin A Complexed With 2-Thr Cyclospori 2e-12
5cyh_A164 Cyclophilin A Complexed With Dipeptide Gly-Pro Leng 2e-12
3k0r_A165 Cryogenic Structure Of Cypa Mutant Arg55lys Length 2e-12
1dyw_A173 Biochemical And Structural Characterization Of A Di 2e-12
1qoi_A177 U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 2e-12
1ihg_A 370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 2e-12
3k0o_A165 Room Temperature Structure Of Cypa Mutant Ser99thr 3e-12
2hqj_A183 Cyclophilin From Leishmania Major Length = 183 3e-12
2x83_B163 Evolutionary Basis Of Hiv Restriction By The Antire 5e-12
2cfe_A162 The 1.5 A Crystal Structure Of The Malassezia Sympo 5e-12
2x2c_K165 Acetyl-Cypa:cyclosporine Complex Length = 165 6e-12
1qnh_A170 Plasmodium Falciparum Cyclophilin (Double Mutant) C 6e-12
2x2a_A165 Free Acetyl-Cypa Trigonal Form Length = 165 6e-12
2alf_A164 Crystal Structure Of Human Cypa Mutant K131a Length 6e-12
2xgy_B173 Complex Of Rabbit Endogenous Lentivirus (Relik)caps 6e-12
3rdd_A184 Human Cyclophilin A Complexed With An Inhibitor Len 7e-12
2b71_A196 Plasmodium Yoelii Cyclophilin-Like Protein Length = 7e-12
1ist_A162 Crystal Structure Of Yeast Cyclophilin A, Cpr1 Leng 7e-12
3uch_A174 Crystal Structure Of A Hypotherical Peptidyl-Prolyl 1e-11
2k7n_A203 Solution Structure Of The Ppil1 Bound To A Fragment 1e-11
4i9y_A167 Structure Of The C-terminal Domain Of Nup358 Length 2e-11
1xwn_A174 Solution Structure Of Cyclophilin Like 1(Ppil1) And 2e-11
2x25_B169 Free Acetyl-Cypa Orthorhombic Form Length = 169 3e-11
2haq_A172 Crystal Structure Of Cyclophilin A From Leishmania 3e-11
2x7k_A166 The Crystal Structure Of Ppil1 In Complex With Cycl 4e-11
1h0p_A182 Cyclophilin_5 From C. Elegans Length = 182 5e-11
3bt8_A172 Crystal Structure Of Mutant Cyclophilin (R147a) Fro 6e-11
2esl_A190 Human Cyclophilin C In Complex With Cyclosporin A L 8e-11
1z81_A229 Crystal Structure Of Cyclophilin From Plasmodium Yo 1e-10
2rmc_A182 Crystal Structure Of Murine Cyclophilin C Complexed 1e-10
1aws_A164 Secypa Complexed With Hagpia (Pseudo-Symmetric Mono 2e-10
3pmp_A164 Crystal Structure Of Cyclophilin A From Moniliophth 3e-10
1xo7_A166 Crystal Structure Of Cyclophilin From Trypanosoma C 3e-10
3o7t_A164 Crystal Structure Of Cyclophilin A From Moniliophth 4e-10
2poe_A185 Crystal Structure Of Cryptosporidium Parvum Cycloph 7e-10
4frv_A185 Crystal Structure Of Mutated Cyclophilin B That Cau 2e-09
4fru_A185 Crystal Structure Of Horse Wild-Type Cyclophilin B 2e-09
3ich_A188 Crystal Structure Of Cyclophilin B At 1.2 A Resolut 2e-09
1cyn_A178 Cyclophilin B Complexed With [d-(Cholinylester)ser8 2e-09
3k2c_A193 Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isom 3e-09
2c3b_A172 The Crystal Structure Of Aspergillus Fumigatus Cycl 4e-09
2fu0_A160 Plasmodium Falciparum Cyclophilin Pfe0505w Putative 5e-09
1c5f_A177 Crystal Structure Of The Cyclophilin-Like Domain Fr 3e-08
2a2n_A176 Crystal Structure Of The Peptidylprolyl Isomerase D 7e-08
2wfi_A179 Atomic Resolution Crystal Structure Of The Ppiase D 7e-08
2wfj_A179 Atomic Resolution Crystal Structure Of The Ppiase D 7e-08
2gw2_A198 Crystal Structure Of The Peptidyl-Prolyl Isomerase 8e-08
2he9_A192 Structure Of The Peptidylprolyl Isomerase Domain Of 1e-07
1w74_A191 X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomer 2e-06
2hq6_A185 Structure Of The Cyclophilin_cecyp16-like Domain Of 1e-05
>pdb|1ZKC|A Chain A, Crystal Structure Of The Cyclophiln_ring Domain Of Human Peptidylprolyl Isomerase (Cyclophilin)-Like 2 Isoform B Length = 197 Back     alignment and structure 
Iteration: 1

 Score =  102 bits (254), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 54/65 (83%)
Query: 440 LKKNTKPNYTHTGRGVLSMANSGPNTNTSQFFITYRSCNHLDGKHTVFGKMVGGMDTLSA 499
            K   +PN +HTGRG+LSMANSGPN+N SQFFIT+RSC +LD KHT+FG++VGG D L+A
Sbjct: 90  FKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTA 149
Query: 500 IEKVE 504
           +E VE
Sbjct: 150 MENVE 154
>pdb|3BO7|A Chain A, Crystal Structure Of Toxoplasma Gondii Peptidyl-Prolyl Cis-Trans Isomerase, 541.M00136 Length = 201 Back     alignment and structure
>pdb|1XYH|A Chain A, Crystal Structure Of Recombinant Human Cyclophilin J Length = 161 Back     alignment and structure
>pdb|2OJU|A Chain A, X-Ray Structure Of Complex Of Human Cyclophilin J With Cyclosporin A Length = 167 Back     alignment and structure
>pdb|2CK1|A Chain A, The Structure Of Oxidised Cyclophilin A From S. Mansoni Length = 172 Back     alignment and structure
>pdb|2PLU|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_4120 Length = 186 Back     alignment and structure
>pdb|1ZMF|A Chain A, C Domain Of Human Cyclophilin-33(Hcyp33) Length = 165 Back     alignment and structure
>pdb|4DGD|A Chain A, Trimcyp Cyclophilin Domain From Macaca Mulatta: H70c Mutant Length = 165 Back     alignment and structure
>pdb|1QNG|A Chain A, Plasmodium Falciparum Cyclophilin Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|1M9E|A Chain A, X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- Terminal Domain (1-146) M-Type H87a Complex. Length = 164 Back     alignment and structure
>pdb|3R49|A Chain A, Human Cyclophilin D Complexed With Quinolin-8-Amine Length = 166 Back     alignment and structure
>pdb|2Z6W|A Chain A, Crystal Structure Of Human Cyclophilin D In Complex With Cyclosporin A Length = 165 Back     alignment and structure
>pdb|3QYU|A Chain A, Crystal Structure Of Human Cyclophilin D At 1.54 A Resolution At Room Temperature Length = 164 Back     alignment and structure
>pdb|2RMA|A Chain A, Crystal Structures Of Cyclophilin A Complexed With Cyclosporin A And N-Methyl-4-[(E)-2-Butenyl]-4,4-Dimethylthreonine Cyclosporin A Length = 165 Back     alignment and structure
>pdb|2BIT|X Chain X, Crystal Structure Of Human Cyclophilin D At 1.7 A Resolution Length = 165 Back     alignment and structure
>pdb|2WLW|A Chain A, Structure Of The N-Terminal Capsid Domain Of Hiv-2 Length = 165 Back     alignment and structure
>pdb|2R99|A Chain A, Crystal Structure Of Cyclophilin Abh-Like Domain Of Human Peptidylprolyl Isomerase E Isoform 1 Length = 173 Back     alignment and structure
>pdb|1BCK|A Chain A, Human Cyclophilin A Complexed With 2-Thr Cyclosporin Length = 165 Back     alignment and structure
>pdb|5CYH|A Chain A, Cyclophilin A Complexed With Dipeptide Gly-Pro Length = 164 Back     alignment and structure
>pdb|3K0R|A Chain A, Cryogenic Structure Of Cypa Mutant Arg55lys Length = 165 Back     alignment and structure
>pdb|1DYW|A Chain A, Biochemical And Structural Characterization Of A Divergent Loop Cyclophilin From Caenorhabditis Elegans Length = 173 Back     alignment and structure
>pdb|1QOI|A Chain A, U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 177 Back     alignment and structure
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure
>pdb|3K0O|A Chain A, Room Temperature Structure Of Cypa Mutant Ser99thr Length = 165 Back     alignment and structure
>pdb|2HQJ|A Chain A, Cyclophilin From Leishmania Major Length = 183 Back     alignment and structure
>pdb|2X83|B Chain B, Evolutionary Basis Of Hiv Restriction By The Antiretroviral Trimcyp Length = 163 Back     alignment and structure
>pdb|2CFE|A Chain A, The 1.5 A Crystal Structure Of The Malassezia Sympodialis Mala S 6 Allergen, A Member Of The Cyclophilin Pan- Allergen Family Length = 162 Back     alignment and structure
>pdb|2X2C|K Chain K, Acetyl-Cypa:cyclosporine Complex Length = 165 Back     alignment and structure
>pdb|1QNH|A Chain A, Plasmodium Falciparum Cyclophilin (Double Mutant) Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|2X2A|A Chain A, Free Acetyl-Cypa Trigonal Form Length = 165 Back     alignment and structure
>pdb|2ALF|A Chain A, Crystal Structure Of Human Cypa Mutant K131a Length = 164 Back     alignment and structure
>pdb|2XGY|B Chain B, Complex Of Rabbit Endogenous Lentivirus (Relik)capsid With Cyclophilin A Length = 173 Back     alignment and structure
>pdb|3RDD|A Chain A, Human Cyclophilin A Complexed With An Inhibitor Length = 184 Back     alignment and structure
>pdb|2B71|A Chain A, Plasmodium Yoelii Cyclophilin-Like Protein Length = 196 Back     alignment and structure
>pdb|1IST|A Chain A, Crystal Structure Of Yeast Cyclophilin A, Cpr1 Length = 162 Back     alignment and structure
>pdb|3UCH|A Chain A, Crystal Structure Of A Hypotherical Peptidyl-Prolyl Cis-Trans Isomerase E (Ppie) From Homo Sapiens At 2.50 A Resolution Length = 174 Back     alignment and structure
>pdb|2K7N|A Chain A, Solution Structure Of The Ppil1 Bound To A Fragment Of Skip Length = 203 Back     alignment and structure
>pdb|4I9Y|A Chain A, Structure Of The C-terminal Domain Of Nup358 Length = 167 Back     alignment and structure
>pdb|1XWN|A Chain A, Solution Structure Of Cyclophilin Like 1(Ppil1) And Insights Into Its Interaction With Skip Length = 174 Back     alignment and structure
>pdb|2X25|B Chain B, Free Acetyl-Cypa Orthorhombic Form Length = 169 Back     alignment and structure
>pdb|2HAQ|A Chain A, Crystal Structure Of Cyclophilin A From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|2X7K|A Chain A, The Crystal Structure Of Ppil1 In Complex With Cyclosporine A Suggests A Binding Mode For Skip Length = 166 Back     alignment and structure
>pdb|1H0P|A Chain A, Cyclophilin_5 From C. Elegans Length = 182 Back     alignment and structure
>pdb|3BT8|A Chain A, Crystal Structure Of Mutant Cyclophilin (R147a) From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|2ESL|A Chain A, Human Cyclophilin C In Complex With Cyclosporin A Length = 190 Back     alignment and structure
>pdb|1Z81|A Chain A, Crystal Structure Of Cyclophilin From Plasmodium Yoelii Length = 229 Back     alignment and structure
>pdb|2RMC|A Chain A, Crystal Structure Of Murine Cyclophilin C Complexed With Immunosuppressive Drug Cyclosporin A Length = 182 Back     alignment and structure
>pdb|1AWS|A Chain A, Secypa Complexed With Hagpia (Pseudo-Symmetric Monomer) Length = 164 Back     alignment and structure
>pdb|3PMP|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa In Complex With Cyclosporin A Length = 164 Back     alignment and structure
>pdb|1XO7|A Chain A, Crystal Structure Of Cyclophilin From Trypanosoma Cruzi Length = 166 Back     alignment and structure
>pdb|3O7T|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa Length = 164 Back     alignment and structure
>pdb|2POE|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_1660 Length = 185 Back     alignment and structure
>pdb|4FRV|A Chain A, Crystal Structure Of Mutated Cyclophilin B That Causes Hyperelastosis Cutis In The American Quarter Horse Length = 185 Back     alignment and structure
>pdb|4FRU|A Chain A, Crystal Structure Of Horse Wild-Type Cyclophilin B Length = 185 Back     alignment and structure
>pdb|3ICH|A Chain A, Crystal Structure Of Cyclophilin B At 1.2 A Resolution Length = 188 Back     alignment and structure
>pdb|1CYN|A Chain A, Cyclophilin B Complexed With [d-(Cholinylester)ser8]-Cyclosporin Length = 178 Back     alignment and structure
>pdb|3K2C|A Chain A, Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Encephalitozoon Cuniculi At 1.9 A Resolution Length = 193 Back     alignment and structure
>pdb|2C3B|A Chain A, The Crystal Structure Of Aspergillus Fumigatus Cyclophilin Reveals 3d Domain Swapping Of A Central Element Length = 172 Back     alignment and structure
>pdb|2FU0|A Chain A, Plasmodium Falciparum Cyclophilin Pfe0505w Putative Cyclosporin- Binding Domain Length = 160 Back     alignment and structure
>pdb|1C5F|A Chain A, Crystal Structure Of The Cyclophilin-Like Domain From Brugia Malayi Complexed With Cyclosporin A Length = 177 Back     alignment and structure
>pdb|2A2N|A Chain A, Crystal Structure Of The Peptidylprolyl Isomerase Domain Of Human Ppwd1 Length = 176 Back     alignment and structure
>pdb|2WFI|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G Length = 179 Back     alignment and structure
>pdb|2WFJ|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G In Complex With Cyclosporin A Length = 179 Back     alignment and structure
>pdb|2GW2|A Chain A, Crystal Structure Of The Peptidyl-Prolyl Isomerase Domain Of Human Cyclophilin G Length = 198 Back     alignment and structure
>pdb|2HE9|A Chain A, Structure Of The Peptidylprolyl Isomerase Domain Of The Human Nk-Tumour Recognition Protein Length = 192 Back     alignment and structure
>pdb|1W74|A Chain A, X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomerase A, Ppia, Rv0009, From Mycobacterium Tuberculosis. Length = 191 Back     alignment and structure
>pdb|2HQ6|A Chain A, Structure Of The Cyclophilin_cecyp16-like Domain Of The Serologically Defined Colon Cancer Antigen 10 From Homo Sapiens Length = 185 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query504
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 1e-32
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 3e-32
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 3e-32
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 6e-32
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 1e-31
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 2e-31
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 2e-31
2b71_A196 Cyclophilin-like protein; structural genomics, str 3e-31
2hq6_A185 Serologically defined colon cancer antigen 10; pro 2e-29
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 7e-29
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 4e-28
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 3e-27
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 3e-27
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 3e-27
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 6e-27
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 7e-27
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 7e-27
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 1e-26
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 2e-26
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 2e-26
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 2e-26
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 3e-26
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 4e-26
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 5e-26
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 7e-26
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 6e-25
1z81_A229 Cyclophilin; structural genomics, structural genom 2e-24
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 2e-24
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 5e-24
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 3e-23
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 4e-23
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 3e-18
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 8e-17
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 2e-16
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 3e-16
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 4e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 4e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 4e-04
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Length = 166 Back     alignment and structure
 Score =  121 bits (305), Expect = 1e-32
 Identities = 28/60 (46%), Positives = 41/60 (68%)

Query: 445 KPNYTHTGRGVLSMANSGPNTNTSQFFITYRSCNHLDGKHTVFGKMVGGMDTLSAIEKVE 504
            P+   TG G+L+MAN+GP+TN SQFF+T      LDGKHT+FG++  G+  ++ +  VE
Sbjct: 87  HPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVE 146
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Length = 201 Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Length = 161 Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Length = 203 Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 197 Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 176 Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Length = 160 Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Length = 196 Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Length = 185 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Length = 185 Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Length = 191 Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Length = 177 Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Length = 179 Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Length = 177 Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Length = 170 Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Length = 173 Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Length = 192 Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Length = 186 Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Length = 165 Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Length = 172 Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Length = 173 Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} PDB: 3o7t_A Length = 164 Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Length = 188 Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Length = 184 Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Length = 193 Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Length = 172 Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Length = 229 Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 232 Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Length = 172 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Length = 234 Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Length = 369 Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} PDB: 3t1u_A* Length = 167 Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Length = 164 Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Length = 166 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query504
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 100.0
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 100.0
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 100.0
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 100.0
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 100.0
2b71_A196 Cyclophilin-like protein; structural genomics, str 100.0
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 100.0
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 100.0
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 100.0
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 100.0
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 100.0
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 100.0
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 100.0
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 100.0
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 100.0
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 100.0
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 100.0
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 100.0
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 100.0
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 100.0
2hq6_A185 Serologically defined colon cancer antigen 10; pro 100.0
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 100.0
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 100.0
4fru_A185 Cyclophilin B, peptidyl-prolyl CIS-trans isomerase 100.0
1z81_A229 Cyclophilin; structural genomics, structural genom 100.0
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 100.0
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 100.0
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 100.0
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 100.0
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 100.0
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 100.0
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 100.0
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 100.0
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 99.42
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.39
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.01
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.99
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.96
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.81
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.76
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.66
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.59
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.32
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.24
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.21
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.2
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.19
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.13
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.12
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.1
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.09
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.08
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.07
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.05
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.04
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.04
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.03
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.03
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.03
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.0
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.0
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 97.98
1z6u_A150 NP95-like ring finger protein isoform B; structura 97.98
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.94
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 97.93
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 97.92
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 97.88
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 97.85
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 97.8
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 97.78
2ect_A78 Ring finger protein 126; metal binding protein, st 97.77
2ysj_A63 Tripartite motif-containing protein 31; ring-type 97.7
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 97.69
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 97.63
2ecm_A55 Ring finger and CHY zinc finger domain- containing 97.62
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 97.62
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 97.62
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 97.61
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 97.59
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 97.56
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 97.54
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 97.53
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.51
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 97.5
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 97.5
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 97.5
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 97.48
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 97.47
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 97.44
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 97.44
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 97.42
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 97.41
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 97.38
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 97.35
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 97.35
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 97.34
2ecw_A85 Tripartite motif-containing protein 30; metal bind 97.34
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.33
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 97.29
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 97.29
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 97.28
2f42_A179 STIP1 homology and U-box containing protein 1; cha 97.28
2ysl_A73 Tripartite motif-containing protein 31; ring-type 97.25
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.22
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 97.21
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 97.15
2ect_A78 Ring finger protein 126; metal binding protein, st 97.1
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.03
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.03
2ecm_A55 Ring finger and CHY zinc finger domain- containing 97.0
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 96.97
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 96.95
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 96.94
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 96.92
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 96.9
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 96.82
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 96.78
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 96.72
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 96.71
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 96.68
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 96.68
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 96.64
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 96.6
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 96.57
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 96.56
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 96.55
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 96.49
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 96.48
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 96.46
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 96.43
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 96.41
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 96.35
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 96.34
1z6u_A150 NP95-like ring finger protein isoform B; structura 96.27
2ysj_A63 Tripartite motif-containing protein 31; ring-type 96.2
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 96.11
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 96.05
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 96.0
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 95.97
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 95.92
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 95.84
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 95.78
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 95.77
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.67
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 95.54
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 95.44
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 95.35
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 95.31
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 95.24
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 95.21
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 95.07
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 95.03
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 94.9
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 94.68
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 94.64
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 94.51
2ea5_A68 Cell growth regulator with ring finger domain prot 94.21
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 94.21
2ea5_A68 Cell growth regulator with ring finger domain prot 93.94
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 93.24
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 93.23
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 92.86
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 92.34
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 91.78
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 91.45
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 89.85
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 89.73
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 89.57
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 88.66
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 88.4
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 88.26
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 88.08
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 85.75
3kop_A188 Uncharacterized protein; protein with A cyclophili 85.66
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 85.57
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 85.46
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 85.29
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 82.57
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 80.54
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Back     alignment and structure
Probab=100.00  E-value=9.2e-43  Score=322.85  Aligned_cols=135  Identities=31%  Similarity=0.397  Sum_probs=129.5

Q ss_pred             CCceEEEeeeCceeEEEEeecCCChhHHHHHHHHhhccCCCCccccccceeEEEeeCC-cccccCCCCCCCCCcccccCc
Q psy3664         336 DPESRLKTVTNETRDILDTFKREYKPTEAKVEEKVKADAFNAAHYSQVWLVSSRKLRD-RIQKVDSKLSPMKHETFWTHS  414 (504)
Q Consensus       336 ~p~V~l~~~T~~G~I~IeL~~d~aP~t~~NF~~L~~~g~Y~g~~~s~~~~~fhRvi~~-~iQgGDp~~~g~gg~s~~g~~  414 (504)
                      ++.|.|  +|+.|+|+||||++.||+||+||+.||+.|||+|+.       |||++|+ |||||||.++|.|++++||.+
T Consensus         5 ~~~v~~--~T~~G~i~ieL~~~~aP~t~~NF~~L~~~g~Y~g~~-------fhRvi~~f~iQgGd~~~~g~gg~si~g~~   75 (160)
T 2fu0_A            5 PKSAII--YTTMGDIHISLFYKECKKTVQNFSVHSINGYYNNCI-------FHRVIKHFMVQTGDPSGDGTGGESIWGNE   75 (160)
T ss_dssp             CCEEEE--EETTEEEEEEECTTTCHHHHHHHHHHHHTTTTTTCB-------CCEEETTTEEEECCTTSSSSCCCCTTSSC
T ss_pred             CCEEEE--EecCccEEEEEeCCCChHHHHHHHHHhccCccCCCE-------EEEEECCCEEEeCCcCCCCCCCCcccCCC
Confidence            345888  999999999999999999999999999999999999       9999999 999999999999999999988


Q ss_pred             cccccccchhhhccccccCCCCCccccCCCCCCCCCCCCcEEEEecCCCCCCCccEEEEcCCCCCCCCCCcEEEEEEccH
Q psy3664         415 RENTNQLKPKLKRRSKQTHSMQPTILKKNTKPNYTHTGRGVLSMANSGPNTNTSQFFITYRSCNHLDGKHTVFGKMVGGM  494 (504)
Q Consensus       415 ~~~~~~~~p~~~~~~~~~~~~~~~~f~de~~~~l~h~~rG~lsmansgpns~~SQFfItl~~~~~LD~k~tvFG~Vv~Gm  494 (504)
                                               |+||+.+.++|+++|+|||||+|||+++|||||+++++++||++|+|||+|++||
T Consensus        76 -------------------------~~dE~~~~l~h~~~G~lsmA~~gp~s~~SQFfI~~~~~~~Ldg~~tvFG~Vv~G~  130 (160)
T 2fu0_A           76 -------------------------FEDEFFDHLNHSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFGKVTQGS  130 (160)
T ss_dssp             -------------------------BCCCCBTTBCSSSSSEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECH
T ss_pred             -------------------------ccccccCCcccCCceEEEEecCCCCCcccEEEEECCCCCccCCCcEEEEEEEcCH
Confidence                                     9999977899999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhCC
Q psy3664         495 DTLSAIEKVE  504 (504)
Q Consensus       495 dvL~kI~~~~  504 (504)
                      |||++|++++
T Consensus       131 dvv~~I~~~~  140 (160)
T 2fu0_A          131 KIVLDIEKVR  140 (160)
T ss_dssp             HHHHHHHTSC
T ss_pred             HHHHHHHhCC
Confidence            9999999874
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} SCOP: b.62.1.1 PDB: 3o7t_A Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Back     alignment and structure
>4fru_A Cyclophilin B, peptidyl-prolyl CIS-trans isomerase; cyclophilin-type ppiase, peptidyl-prolyl CIS-trans isomerase chaperone, foldase; HET: ME2 PEG; 1.10A {Equus caballus} PDB: 4frv_A* 3ich_A 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} SCOP: b.62.1.1 PDB: 3t1u_A* Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3kop_A Uncharacterized protein; protein with A cyclophilin-like fold, structural genomics, J center for structural genomics, JCSG; 1.90A {Arthrobacter SP} Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 504
d2ok3a1159 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B 3e-17
d2cfea1162 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 1e-16
d1qnga_170 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium 2e-16
d2c3ba1171 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Asper 5e-16
d1xwna1166 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isome 8e-16
d1zkca1178 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans iso 3e-15
d2b71a1169 b.62.1.1 (A:23-191) Cyclophilin-like protein PY006 1e-14
d1qoia_173 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Hom 3e-14
d2igva1172 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caeno 3e-14
d1z81a1186 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plas 8e-14
d1xo7a_166 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosom 7e-13
d1ihga2195 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain 9e-13
d2r99a1161 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl 2e-12
d2a2na1164 b.62.1.1 (A:483-646) Peptidylprolyl isomerase doma 3e-12
d1w74a_171 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 5e-12
d2z6wa1164 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl c 3e-11
d2fu0a1155 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w { 3e-11
d1a33a_174 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode ( 4e-11
d2rmca_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus 2e-10
d1h0pa_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabd 5e-09
d1lopa_164 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 6e-09
d1v9ta_166 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 5e-08
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 5e-05
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure

class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Cyclophilin-like protein PPIL3B
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 76.8 bits (188), Expect = 3e-17
 Identities = 35/101 (34%), Positives = 52/101 (51%)

Query: 404 PMKHETFWTHSRENTNQLKPKLKRRSKQTHSMQPTILKKNTKPNYTHTGRGVLSMANSGP 463
              +   +  + +             +  +S+     +        H  RGV+SMAN+GP
Sbjct: 35  NYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGP 94

Query: 464 NTNTSQFFITYRSCNHLDGKHTVFGKMVGGMDTLSAIEKVE 504
           NTN SQFFITY    HLD K+TVFGK++ G++TL  +EK+ 
Sbjct: 95  NTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLP 135
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Length = 162 Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Length = 170 Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Length = 171 Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Length = 169 Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Length = 172 Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Length = 186 Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Length = 166 Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 195 Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Length = 155 Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Length = 174 Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Length = 182 Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Length = 182 Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 164 Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query504
d2b71a1169 Cyclophilin-like protein PY00693 {Plasmodium yoeli 100.0
d1xwna1166 Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 100.0
d2ok3a1159 Cyclophilin-like protein PPIL3B {Human (Homo sapie 100.0
d1zkca1178 Peptidyl-prolyl cis-trans isomerase-like 2, Cyclop 100.0
d2fu0a1155 Putative cyclophilin PFE0505w {Plasmodium falcipar 100.0
d2r99a1161 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d2igva1172 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d2z6wa1164 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d2a2na1164 Peptidylprolyl isomerase domain and WD repeat-cont 100.0
d1v9ta_166 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d1qnga_170 Cyclophilin (eukaryotic) {Plasmodium falciparum [T 100.0
d1w74a_171 Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycob 100.0
d1qoia_173 Cyclophilin (eukaryotic) {Human (Homo sapiens), U4 100.0
d2cfea1162 Cyclophilin-like allergen Mal s 6 {Malassezia symp 100.0
d1lopa_164 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d1xo7a_166 Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId 100.0
d1ihga2195 Cyclophilin 40 isomerase domain {Cow (Bos taurus) 100.0
d1z81a1186 Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId 99.98
d2c3ba1171 Cyclophilin (eukaryotic) {Aspergillus fumigatus [T 99.98
d1h0pa_182 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 99.98
d2rmca_182 Cyclophilin (eukaryotic) {Mouse (Mus musculus), va 99.98
d1a33a_174 Cyclophilin (eukaryotic) {Nematode (Brugia malayi) 99.97
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.35
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.77
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.66
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.63
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.45
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.28
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.23
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.22
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 97.98
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 97.84
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 97.56
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 97.45
d2c2la280 STIP1 homology and U box-containing protein 1, STU 97.33
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 97.31
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 97.21
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 97.2
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 97.14
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 97.11
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 96.92
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 96.89
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 96.89
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 96.8
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 96.5
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 96.49
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 96.39
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 95.53
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 95.5
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 95.31
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 94.74
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 93.52
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 92.66
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 91.62
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 91.08
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 90.89
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Cyclophilin-like protein PY00693
species: Plasmodium yoelii [TaxId: 5861]

Probab=100.00  E-value=1.1e-37  Score=288.97  Aligned_cols=145  Identities=26%  Similarity=0.381  Sum_probs=133.1

Q ss_pred             hhhhhhhcch---hhhhhhcCCCceEEEeeeCceeEEEEeecCCChhHHHHHHHHhhccCCCCccccccceeEEEeeCC-
Q psy3664         318 DLVRYSRVVK---KEEKEQLKDPESRLKTVTNETRDILDTFKREYKPTEAKVEEKVKADAFNAAHYSQVWLVSSRKLRD-  393 (504)
Q Consensus       318 ~~~~~~~~k~---k~~~~~~~~p~V~l~~~T~~G~I~IeL~~d~aP~t~~NF~~L~~~g~Y~g~~~s~~~~~fhRvi~~-  393 (504)
                      +.+.|.+++.   ++|        |.|  +|+.|+|+||||++.||++|+||+.||+.|||+|+.       |||++++ 
T Consensus         3 ~~~~~~~~~~~~~~~~--------V~l--~T~~G~i~IeL~~d~aP~tv~nF~~L~~~g~Y~~~~-------f~rv~~~~   65 (169)
T d2b71a1           3 EKIAYYKMKGHTERGY--------ITI--YTNLGDFEVELYWYHSPKTCLNFYTLCEMGFYDNTI-------FHRVIPNF   65 (169)
T ss_dssp             HHHHHHHHHHHHHSCE--------EEE--EETTEEEEEEECTTTSHHHHHHHHHHHHTTTTTTEE-------EEEEETTT
T ss_pred             cchhhHhhhccccccE--------EEE--EeCceeEEEEEeCCCCcHHHHHHHHHhhCCccceee-------ecccccee
Confidence            4455555543   667        999  999999999999999999999999999999999999       9999999 


Q ss_pred             cccccCCCCCCCCCcccccCccccccccchhhhccccccCCCCCccccCCCCCCCCCCCCcEEEEecCCCCCCCccEEEE
Q psy3664         394 RIQKVDSKLSPMKHETFWTHSRENTNQLKPKLKRRSKQTHSMQPTILKKNTKPNYTHTGRGVLSMANSGPNTNTSQFFIT  473 (504)
Q Consensus       394 ~iQgGDp~~~g~gg~s~~g~~~~~~~~~~p~~~~~~~~~~~~~~~~f~de~~~~l~h~~rG~lsmansgpns~~SQFfIt  473 (504)
                      ++||||+.+.+.++.++++..                         +++|..+.++|.++|+|+|++++|++++|||||+
T Consensus        66 ~iq~g~~~~~~~~~~~~~~~~-------------------------~~~e~~~~l~h~~~g~ls~~~~~p~s~~sqFfIt  120 (169)
T d2b71a1          66 VIQGGDPTGTGKGGKSIYGEY-------------------------FEDEINKELKHTGAGILSMSNNGPNTNSSQFFIT  120 (169)
T ss_dssp             EEEEEETTSSSSCCCBTTBSC-------------------------BCCCCCTTCCCCSTTEEEECCSSTTCBSSCEEEE
T ss_pred             eEeccccccccCCCccccccc-------------------------cccccccccCCCCcEEEEhhhCCCCCCCCEEEEe
Confidence            999999998888888877776                         8888878899999999999999999999999999


Q ss_pred             cCCCCCCCCCCcEEEEEEccHHHHHHHhhCC
Q psy3664         474 YRSCNHLDGKHTVFGKMVGGMDTLSAIEKVE  504 (504)
Q Consensus       474 l~~~~~LD~k~tvFG~Vv~GmdvL~kI~~~~  504 (504)
                      +++.++||++|+|||+|++|||||++|++++
T Consensus       121 ~~~~~~ld~~~tvFG~Vv~G~dvl~~I~~~~  151 (169)
T d2b71a1         121 LAPLPHLDGKHTIFARVSKNMTCIENIASVQ  151 (169)
T ss_dssp             SSCCGGGTTTSCEEEEEEECHHHHHHHHTSC
T ss_pred             cCCcchhhhhcceeeEEeccHHHHHHHHhCC
Confidence            9999999999999999999999999999875
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure