Psyllid ID: psy3674

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300------
MVRKEFSFISKTTRHIETVVNGMDDDKNKLVNRKEHKKSSSASIVSDLDAEEHSQQDDADFFNSICNDILQLLEGEIDEIGSEHDENAPVCRICHGSHENLKALCECRGTMGLVHAECLTQWLSESGRSCCEICNFKYKFKRTLKRPLWETMAGWLYKVVENSQVFIILSWLMAITPIVLLAAALTNNFPFNHNDRKTHQQLQCGFDVRYAMIRKDSCPISITPIYEGYAMIRKDSCPISITPIYEGKYFKNMRTQVLSQLVWYYDMLFMIVRAYFENWHFYYIRDHDIEIIFPERPEITDGPSHK
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccHHHHHHHHHHHHHHHcccccccccccEEEEEEEccccHHHHHHHHHHEEEEcHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHcccccEEEEcEEEEEccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccccccccc
cccEEEEEcccccccccccccccccccHHHcccccccccccccccHHHHHccccccccccEEEEcccccccccccccccccccccccccEEEEEccccccccccccccccHHHHHHHHHHHHHHcccccEEEEEEEEEEEEEcccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccEEEEEccccccccccccc
MVRKEFSFISKTTRHIETVVngmdddknklvnrkehkksssasivsdldaeehsqqddaDFFNSICNDILQLLEGEideigsehdenapvcrichgshENLKALCECRGTMGLVHAECLTQWlsesgrscceiCNFKYKFKRTLKRPLWETMAGWLYKVVENSQVFIILSWLMAITPIVLLAAALtnnfpfnhndrkthqqlQCGFDVRYAMirkdscpisitpiyegyamirkdscpisitpiyegkyfknMRTQVLSQLVWYYDMLFMIVRAYFENwhfyyirdhdieiifperpeitdgpshk
mvrkefsfiskttrhietvvngmdddknklvnrkehkksssasivsdlDAEEHSQQDDADFFNSICNDILQLLEGEIDEIGSEHDENAPVCRICHGSHENLKALCECRGTMGLVHAECLTQWLSESGRSCCEICNFKYKFKRTLKRPLWETMAGWLYKVVENSQVFIILSWLMAITPIVLLAAALTNNFPFNHNDRKTHQQLQCGFDVRYAMIRKDSCPISITPIYEGYAMIRKDSCPISITPIYEGKYFKNMRTQVLSQLVWYYDMLFMIVRAYFENWHFYYIRDHDIEIIFperpeitdgpshk
MVRKEFSFISKTTRHIETVVNGMDDDKNKLVNRKEHKKSSSASIVSDLDAEEHSQQDDADFFNSICNDILQLLEGEIDEIGSEHDENAPVCRICHGSHENLKALCECRGTMGLVHAECLTQWLSESGRSCCEICNFKYKFKRTLKRPLWETMAGWLYKVVENSQVFIILSWLMAITPIVLLAAALTNNFPFNHNDRKTHQQLQCGFDVRYAMIRKDSCPISITPIYEGYAMIRKDSCPISITPIYEGKYFKNMRTQVLSQLVWYYDMLFMIVRAYFENWHFYYIRDHDIEIIFPERPEITDGPSHK
***********************************************************DFFNSICNDILQLLEGEIDEIGSEHDENAPVCRICHGSHENLKALCECRGTMGLVHAECLTQWLSESGRSCCEICNFKYKFKRTLKRPLWETMAGWLYKVVENSQVFIILSWLMAITPIVLLAAALTNNFPFNHNDRKTHQQLQCGFDVRYAMIRKDSCPISITPIYEGYAMIRKDSCPISITPIYEGKYFKNMRTQVLSQLVWYYDMLFMIVRAYFENWHFYYIRDHDIEIIFP************
*******************************************************************************************RICHGSHENLKALCECRGTMGLVHAECLTQWLSESGRSCCEICNFKYKFKRTLKRPLWETMAGWLYKVVENSQVFIILSWLMAITPIVLLAAALTNNFPFNHNDRKTHQQLQCGFDVRYAMIRKDSCPISITPIYEGYAMIRKDSCPISITPIYEGKYFKNMRTQVLSQLVWYYDMLFMIVRAYFENWHFYYIRDHDIEI***************
MVRKEFSFISKTTRHIETVVNGMDDDKNKLVN***********************QDDADFFNSICNDILQLLEGEIDEIGSEHDENAPVCRICHGSHENLKALCECRGTMGLVHAECLTQWLSESGRSCCEICNFKYKFKRTLKRPLWETMAGWLYKVVENSQVFIILSWLMAITPIVLLAAALTNNFPFNHNDRKTHQQLQCGFDVRYAMIRKDSCPISITPIYEGYAMIRKDSCPISITPIYEGKYFKNMRTQVLSQLVWYYDMLFMIVRAYFENWHFYYIRDHDIEIIFPERPE********
**RKEFSFISKT**********************************************ADF**SICNDILQLLEGEIDEIGSEHDENAPVCRICHGSHENLKALCECRGTMGLVHAECLTQWLSESGRSCCEICNFKYKFKRTLKRPLWETMAGWLYKVVENSQVFIILSWLMAITPIVLLAAALTNNFPFNHNDRKTHQQLQCGFDVRYAMIRKDSCPISITPIYEGYAMIRKDSCPISITPIYEGKYFKNMRTQVLSQLVWYYDMLFMIVRAYFENWHFYYIRDHDIEIIFPERP*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVRKEFSFISKTTRHIETVVNGMDDDKNKLVNRKEHKKSSSASIVSDLDAEEHSQQDDADFFNSICNDILQLLEGEIDEIGSEHDENAPVCRICHGSHENLKALCECRGTMGLVHAECLTQWLSESGRSCCEICNFKYKFKRTLKRPLWETMAGWLYKVVENSQVFIILSWLMAITPIVLLAAALTNNFPFNHNDRKTHQQLQCGFDVRYAMIRKDSCPISITPIYEGYAMIRKDSCPISITPIYEGKYFKNMRTQVLSQLVWYYDMLFMIVRAYFENWHFYYIRDHDIEIIFPERPEITDGPSHK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query306 2.2.26 [Sep-21-2011]
Q68FA7251 E3 ubiquitin-protein liga yes N/A 0.385 0.470 0.335 4e-12
Q86UD3253 E3 ubiquitin-protein liga yes N/A 0.490 0.592 0.304 5e-12
Q28EX7246 E3 ubiquitin-protein liga no N/A 0.428 0.532 0.328 6e-12
Q5PQ35246 E3 ubiquitin-protein liga N/A N/A 0.428 0.532 0.328 6e-12
Q5XIE5253 E3 ubiquitin-protein liga yes N/A 0.490 0.592 0.304 6e-12
Q8BRX9218 E3 ubiquitin-protein liga yes N/A 0.490 0.688 0.304 7e-12
A0JN69253 E3 ubiquitin-protein liga yes N/A 0.385 0.466 0.348 1e-11
Q0IH10252 E3 ubiquitin-protein liga N/A N/A 0.359 0.436 0.355 2e-11
Q1LVZ2249 E3 ubiquitin-protein liga no N/A 0.415 0.510 0.316 8e-11
Q99M02246 E3 ubiquitin-protein liga no N/A 0.349 0.434 0.344 8e-09
>sp|Q68FA7|MARH3_XENTR E3 ubiquitin-protein ligase MARCH3 OS=Xenopus tropicalis GN=march3 PE=2 SV=1 Back     alignment and function desciption
 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 66/128 (51%), Gaps = 10/128 (7%)

Query: 71  QLLEGEIDEIGSEHDENAPVCRICH--GSHENLKALCECRGTMGLVHAECLTQWLSESGR 128
           QLL   +  + ++   + P+CRICH   + E+L + CEC GT+G +H  CL  WLS S  
Sbjct: 49  QLLSTVVRTLTTQSFNDRPMCRICHEGSTQEDLLSPCECTGTLGTIHRSCLEHWLSSSNT 108

Query: 129 SCCEICNFKYKFKRTLKRPLWETMAGWLYKVV---ENSQVFIILSWLMAITPIVLLAAAL 185
           S CE+C+F++  +R   RPL E    WL       E   +F  +   + ITP+  ++  L
Sbjct: 109 SYCELCHFRFSVERK-PRPLVE----WLRNPGPQHEKRTLFGDMVCFLFITPLATISGWL 163

Query: 186 TNNFPFNH 193
                 +H
Sbjct: 164 CLRGAVDH 171
E3 ubiquitin-protein ligase which may be involved in endosomal trafficking. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
Xenopus tropicalis (taxid: 8364)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q86UD3|MARH3_HUMAN E3 ubiquitin-protein ligase MARCH3 OS=Homo sapiens GN=MARCH3 PE=2 SV=1 Back     alignment and function description
>sp|Q28EX7|MARH2_XENTR E3 ubiquitin-protein ligase MARCH2 OS=Xenopus tropicalis GN=march2 PE=2 SV=1 Back     alignment and function description
>sp|Q5PQ35|MARH2_XENLA E3 ubiquitin-protein ligase MARCH2 OS=Xenopus laevis GN=march2 PE=2 SV=1 Back     alignment and function description
>sp|Q5XIE5|MARH3_RAT E3 ubiquitin-protein ligase MARCH3 OS=Rattus norvegicus GN=March3 PE=1 SV=1 Back     alignment and function description
>sp|Q8BRX9|MARH3_MOUSE E3 ubiquitin-protein ligase MARCH3 OS=Mus musculus GN=March3 PE=2 SV=1 Back     alignment and function description
>sp|A0JN69|MARH3_BOVIN E3 ubiquitin-protein ligase MARCH3 OS=Bos taurus GN=MARCH3 PE=2 SV=1 Back     alignment and function description
>sp|Q0IH10|MARH3_XENLA E3 ubiquitin-protein ligase MARCH3 OS=Xenopus laevis GN=march3 PE=2 SV=1 Back     alignment and function description
>sp|Q1LVZ2|MARH2_DANRE E3 ubiquitin-protein ligase MARCH2 OS=Danio rerio GN=march2 PE=2 SV=1 Back     alignment and function description
>sp|Q99M02|MARH2_MOUSE E3 ubiquitin-protein ligase MARCH2 OS=Mus musculus GN=March2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query306
357623418385 hypothetical protein KGM_21401 [Danaus p 0.480 0.381 0.354 6e-14
380024263314 PREDICTED: E3 ubiquitin-protein ligase M 0.535 0.522 0.292 2e-13
328778009314 PREDICTED: e3 ubiquitin-protein ligase M 0.535 0.522 0.292 2e-13
307182746311 E3 ubiquitin-protein ligase MARCH3 [Camp 0.467 0.459 0.274 5e-13
383866330298 PREDICTED: E3 ubiquitin-protein ligase M 0.267 0.275 0.402 7e-13
322794765309 hypothetical protein SINV_03635 [Solenop 0.313 0.310 0.328 1e-12
307193496226 E3 ubiquitin-protein ligase MARCH3 [Harp 0.267 0.362 0.402 2e-12
242021543358 membrane associated RING finger 1,8, put 0.826 0.706 0.242 7e-12
345488435310 PREDICTED: E3 ubiquitin-protein ligase M 0.467 0.461 0.263 2e-11
350405216311 PREDICTED: E3 ubiquitin-protein ligase M 0.267 0.263 0.390 2e-11
>gi|357623418|gb|EHJ74578.1| hypothetical protein KGM_21401 [Danaus plexippus] Back     alignment and taxonomy information
 Score = 84.3 bits (207), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 86/161 (53%), Gaps = 14/161 (8%)

Query: 34  KEHKKSSSASIVSDLDAEEHSQQDDADFFNSICNDILQLLEG-EIDEIGSEHDENAPVCR 92
           K  KK S     ++ D E  S+Q        +  +++ + E  E DE  S H     +CR
Sbjct: 165 KNPKKRSIGINSTNFDIETQSRQS---LQVEVLKEVIDVGENTEEDEKFSNHSLE-DMCR 220

Query: 93  ICH------GSHENLKALCECRGTMGLVHAECLTQWLSESGRSCCEICNFKYKFKRTLKR 146
           ICH      G   NL + C CRGT+G VH +CL +WL+ESG++ CE+C  KY  +R  K 
Sbjct: 221 ICHSGEGVSGELGNLISACSCRGTIGRVHIKCLERWLTESGKTRCELCGTKYVTRRVHKF 280

Query: 147 PLWETMAGWLYKVVENSQVFII-LSWLMAITPIVLLAAALT 186
            + + +A W+  +  NS+  I+    +M +TPI ++AA LT
Sbjct: 281 GVLKALAMWI--LSHNSKHMIVDFFGIMIMTPIAVVAAGLT 319

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380024263|ref|XP_003695923.1| PREDICTED: E3 ubiquitin-protein ligase MARCH2-like [Apis florea] Back     alignment and taxonomy information
>gi|328778009|ref|XP_393326.3| PREDICTED: e3 ubiquitin-protein ligase MARCH2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|307182746|gb|EFN69870.1| E3 ubiquitin-protein ligase MARCH3 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383866330|ref|XP_003708623.1| PREDICTED: E3 ubiquitin-protein ligase MARCH3-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|322794765|gb|EFZ17712.1| hypothetical protein SINV_03635 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307193496|gb|EFN76273.1| E3 ubiquitin-protein ligase MARCH3 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242021543|ref|XP_002431204.1| membrane associated RING finger 1,8, putative [Pediculus humanus corporis] gi|212516453|gb|EEB18466.1| membrane associated RING finger 1,8, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|345488435|ref|XP_003425907.1| PREDICTED: E3 ubiquitin-protein ligase MARCH3-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350405216|ref|XP_003487362.1| PREDICTED: E3 ubiquitin-protein ligase MARCH3-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query306
UNIPROTKB|Q68FA7251 march3 "E3 ubiquitin-protein l 0.359 0.438 0.366 2.3e-14
UNIPROTKB|Q28EX7246 march2 "E3 ubiquitin-protein l 0.352 0.439 0.366 3e-14
UNIPROTKB|Q5PQ35246 march2 "E3 ubiquitin-protein l 0.352 0.439 0.366 3e-14
UNIPROTKB|E1C6Q0246 MARCH2 "Uncharacterized protei 0.352 0.439 0.366 3.9e-14
UNIPROTKB|B9EJE7138 MARCH3 "Membrane-associated ri 0.271 0.601 0.420 5.1e-14
MGI|MGI:2443667218 March3 "membrane-associated ri 0.359 0.504 0.363 5.1e-14
UNIPROTKB|A0JN69253 MARCH3 "E3 ubiquitin-protein l 0.359 0.434 0.363 2e-13
UNIPROTKB|E2R088253 MARCH3 "Uncharacterized protei 0.359 0.434 0.363 2e-13
UNIPROTKB|Q86UD3253 MARCH3 "E3 ubiquitin-protein l 0.359 0.434 0.363 2e-13
UNIPROTKB|F1RKL9253 MARCH3 "Uncharacterized protei 0.359 0.434 0.363 2e-13
UNIPROTKB|Q68FA7 march3 "E3 ubiquitin-protein ligase MARCH3" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
 Score = 186 (70.5 bits), Expect = 2.3e-14, P = 2.3e-14
 Identities = 44/120 (36%), Positives = 65/120 (54%)

Query:    71 QLLEGEIDEIGSEHDENAPVCRICH-GS-HENLKALCECRGTMGLVHAECLTQWLSESGR 128
             QLL   +  + ++   + P+CRICH GS  E+L + CEC GT+G +H  CL  WLS S  
Sbjct:    49 QLLSTVVRTLTTQSFNDRPMCRICHEGSTQEDLLSPCECTGTLGTIHRSCLEHWLSSSNT 108

Query:   129 SCCEICNFKYKFKRTLKRPLWETMAGWLYKVV---ENSQVFIILSWLMAITPIVLLAAAL 185
             S CE+C+F++  +R   RPL E    WL       E   +F  +   + ITP+  ++  L
Sbjct:   109 SYCELCHFRFSVERK-PRPLVE----WLRNPGPQHEKRTLFGDMVCFLFITPLATISGWL 163
GO:0005764 "lysosome" evidence=ISS
GO:0005768 "endosome" evidence=ISS
UNIPROTKB|Q28EX7 march2 "E3 ubiquitin-protein ligase MARCH2" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q5PQ35 march2 "E3 ubiquitin-protein ligase MARCH2" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|E1C6Q0 MARCH2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|B9EJE7 MARCH3 "Membrane-associated ring finger (C3HC4) 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2443667 March3 "membrane-associated ring finger (C3HC4) 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|A0JN69 MARCH3 "E3 ubiquitin-protein ligase MARCH3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R088 MARCH3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q86UD3 MARCH3 "E3 ubiquitin-protein ligase MARCH3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RKL9 MARCH3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
smart0074449 smart00744, RINGv, The RING-variant domain is a C4 3e-13
pfam1290647 pfam12906, RINGv, RING-variant domain 8e-13
COG5183 1175 COG5183, SSM4, Protein involved in mRNA turnover a 5e-11
PHA02825162 PHA02825, PHA02825, LAP/PHD finger-like protein; P 2e-08
PHA02862156 PHA02862, PHA02862, 5L protein; Provisional 3e-04
>gnl|CDD|128983 smart00744, RINGv, The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information 
 Score = 62.7 bits (153), Expect = 3e-13
 Identities = 22/49 (44%), Positives = 31/49 (63%), Gaps = 3/49 (6%)

Query: 90  VCRICHG---SHENLKALCECRGTMGLVHAECLTQWLSESGRSCCEICN 135
           +CRICH      + L + C C+G++  VH ECL +W++ESG   CEIC 
Sbjct: 1   ICRICHDEGDEGDPLVSPCRCKGSLKYVHQECLERWINESGNKTCEICK 49

Some of these proteins have been shown both in vivo and in vitro to have ubiquitin E3 ligase activity. The RING-variant domain is reminiscent of both the RING and the PHD domains and may represent an evolutionary intermediate. To describe this domain the term PHD/LAP domain has been used in the past. Extended description: The RING-variant (RINGv) domain contains a C4HC3 zinc-finger-like motif similar to the PHD domain, while some of the spacing between the Cys/His residues follow a pattern somewhat closer to that found in the RING domain. The RINGv domain, similar to the RING, PHD and LIM domains, is thought to bind two zinc ions co-ordinated by the highly conserved Cys and His residues. RING variant domain: C-x (2) -C-x(10-45)-C-x (1) -C-x (7) -H-x(2)-C-x(11-25)-C-x(2)-C As opposed to a PHD: C-x(1-2) -C-x (7-13)-C-x(2-4)-C-x(4-5)-H-x(2)-C-x(10-21)-C-x(2)-C Classical RING domain: C-x (2) -C-x (9-39)-C-x(1-3)-H-x(2-3)-C-x(2)-C-x(4-48) -C-x(2)-C. Length = 49
>gnl|CDD|221845 pfam12906, RINGv, RING-variant domain Back     alignment and domain information
>gnl|CDD|227510 COG5183, SSM4, Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|177491 PHA02825, PHA02825, LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165197 PHA02862, PHA02862, 5L protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 306
PHA02862156 5L protein; Provisional 99.82
PHA02825162 LAP/PHD finger-like protein; Provisional 99.78
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 99.63
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 99.59
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 99.57
KOG3053|consensus293 99.52
KOG1609|consensus323 99.47
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 96.22
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 95.7
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 95.35
PHA02929238 N1R/p28-like protein; Provisional 95.3
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 95.05
KOG4628|consensus348 94.76
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 94.06
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 93.39
COG52191525 Uncharacterized conserved protein, contains RING Z 92.72
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 92.65
smart0050463 Ubox Modified RING finger domain. Modified RING fi 91.82
cd0016245 RING RING-finger (Really Interesting New Gene) dom 91.53
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 90.51
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 90.38
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 90.35
KOG0823|consensus230 89.33
PHA02926242 zinc finger-like protein; Provisional 88.65
KOG0802|consensus543 88.49
KOG1493|consensus84 86.92
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 84.6
KOG1734|consensus328 82.94
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 80.99
KOG1785|consensus563 80.47
KOG0828|consensus636 80.11
>PHA02862 5L protein; Provisional Back     alignment and domain information 
Probab=99.82  E-value=5e-21  Score=166.05  Aligned_cols=87  Identities=21%  Similarity=0.601  Sum_probs=74.0

Q ss_pred             CCeeeEeccCCCCccccccccCCCccccHHHHHHHHHhcCCcccCCCCceeeeeeeccchhhhhhhhhhh------cccc
Q psy3674          88 APVCRICHGSHENLKALCECRGTMGLVHAECLTQWLSESGRSCCEICNFKYKFKRTLKRPLWETMAGWLY------KVVE  161 (306)
Q Consensus        88 ~~~CRIC~ge~~~LIsPC~CkGSl~~VH~~CL~~Wl~~s~~~~CELCk~~Y~~~~~~k~~i~~si~~W~~------~vl~  161 (306)
                      .++||||++++++.++||+|+||+++||++||++|++.+++..||+|+++|.+++.+|     ++..|.-      .+++
T Consensus         2 ~diCWIC~~~~~e~~~PC~C~GS~K~VHq~CL~~WIn~S~k~~CeLCkteY~Ik~~yK-----pf~kW~~~f~d~k~~l~   76 (156)
T PHA02862          2 SDICWICNDVCDERNNFCGCNEEYKVVHIKCMQLWINYSKKKECNLCKTKYNIKKTYV-----SFKKWNWCFNDKKTTLS   76 (156)
T ss_pred             CCEEEEecCcCCCCcccccccCcchhHHHHHHHHHHhcCCCcCccCCCCeEEEEEccc-----cHHHhhccCCCCCCchh
Confidence            5799999976666689999999999999999999999999999999999999988765     7777852      3466


Q ss_pred             hhhhhhhhHHHHHHHHHH
Q psy3674         162 NSQVFIILSWLMAITPIV  179 (306)
Q Consensus       162 ~R~~~~dl~~llf~TpLv  179 (306)
                      ++..+++.++|+|+||-.
T Consensus        77 ki~fI~~~v~fi~it~s~   94 (156)
T PHA02862         77 KIFFILFALVFIFLTISL   94 (156)
T ss_pred             eeeeHhhhhhheeeeccc
Confidence            777888888888888743

>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG3053|consensus Back     alignment and domain information
>KOG1609|consensus Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG4628|consensus Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>KOG1493|consensus Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG1734|consensus Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG1785|consensus Back     alignment and domain information
>KOG0828|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
2d8s_A80 Solution Structure Of The Ring Domain Of The Human 2e-06
1vyx_A60 Solution Structure Of The Kshv K3 N-Terminal Domain 2e-05
>pdb|2D8S|A Chain A, Solution Structure Of The Ring Domain Of The Human Cellular Modulator Of Immune Recognition Protein Length = 80 Back     alignment and structure 
Iteration: 1

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 3/61 (4%)
Query: 90  VCRICHGSHENLKAL---CECRGTMGLVHAECLTQWLSESGRSCCEICNFKYKFKRTLKR 146
           +CRICH   ++   L   C C G++  VH  CL QW+  S   CCE+C +++  +  L  
Sbjct: 17  ICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLSG 76
Query: 147 P 147
           P
Sbjct: 77  P 77
>pdb|1VYX|A Chain A, Solution Structure Of The Kshv K3 N-Terminal Domain Length = 60 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 5e-22
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 4e-20
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 1e-04
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
 Score = 86.9 bits (215), Expect = 5e-22
 Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 3/70 (4%)

Query: 81  GSEHDENAPVCRICHG---SHENLKALCECRGTMGLVHAECLTQWLSESGRSCCEICNFK 137
            S    +  +CRICH        L   C C G++  VH  CL QW+  S   CCE+C ++
Sbjct: 8   TSITPSSQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYE 67

Query: 138 YKFKRTLKRP 147
           +  +  L  P
Sbjct: 68  FIMETKLSGP 77
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query306
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 99.76
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.63
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 97.31
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.18
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 97.1
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 97.05
2ect_A78 Ring finger protein 126; metal binding protein, st 97.01
2ecw_A85 Tripartite motif-containing protein 30; metal bind 96.98
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 96.92
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 96.9
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 96.9
2ecm_A55 Ring finger and CHY zinc finger domain- containing 96.86
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 96.84
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 96.82
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 96.78
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 96.76
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 96.74
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 96.73
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 96.71
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 96.69
2ysl_A73 Tripartite motif-containing protein 31; ring-type 96.52
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 96.34
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 96.32
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 96.27
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 96.27
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 96.22
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 96.2
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 96.14
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 96.13
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 96.12
2ysj_A63 Tripartite motif-containing protein 31; ring-type 95.95
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 95.86
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 95.79
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 95.71
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 95.38
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 94.73
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 94.7
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 94.56
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 94.35
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 94.26
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 94.04
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 93.96
1z6u_A150 NP95-like ring finger protein isoform B; structura 93.66
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 93.46
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 93.06
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 92.84
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 92.82
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 92.55
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 92.18
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 92.05
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 90.63
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 89.8
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 89.56
3nw0_A238 Non-structural maintenance of chromosomes element 89.06
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 86.85
2ea5_A68 Cell growth regulator with ring finger domain prot 86.44
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 85.93
2f42_A179 STIP1 homology and U-box containing protein 1; cha 84.94
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 83.13
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 81.0
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 80.69
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
Probab=99.76  E-value=2.9e-19  Score=131.80  Aligned_cols=57  Identities=37%  Similarity=0.871  Sum_probs=51.8

Q ss_pred             CCCCCeeeEec-cCCCCccccccccCCCccccHHHHHHHHHhcCCcccCCCCceeeee
Q psy3674          85 DENAPVCRICH-GSHENLKALCECRGTMGLVHAECLTQWLSESGRSCCEICNFKYKFK  141 (306)
Q Consensus        85 s~~~~~CRIC~-ge~~~LIsPC~CkGSl~~VH~~CL~~Wl~~s~~~~CELCk~~Y~~~  141 (306)
                      +++++.||||+ +++++|+.||+|+||+++||+.||.+|+..+++..||+|+++|+++
T Consensus         3 ~~~~~~CrIC~~~~~~~l~~PC~C~gs~~~~H~~Cl~~W~~~~~~~~C~~C~~~~~~r   60 (60)
T 1vyx_A            3 DEDVPVCWICNEELGNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNTR   60 (60)
T ss_dssp             TCSCCEETTTTEECSCCCCCSCCCSSGGGSCCHHHHHHHHHHHTCSBCTTTCCBCCCC
T ss_pred             CCCCCEeEEeecCCCCceecCcCCCCchhhhHHHHHHHHHHhCCCCccCCCCCeeecC
Confidence            34778999999 5567899999999999999999999999999999999999999864
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 306
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 3e-09
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

 Score = 50.2 bits (119), Expect = 3e-09
 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 85  DENAPVCRICHGSHENLKALC-ECRGTMGLVHAECLTQWLSESGRSCCEICNFKYKFK 141
           DE+ PVC IC+    N +     C G +  VH  CL+ WL+ S  + C+IC   Y  +
Sbjct: 3   DEDVPVCWICNEELGNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNTR 60

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query306
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.49
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 97.25
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 96.95
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 96.91
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 96.88
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 96.84
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 96.58
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 96.21
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 95.17
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 92.97
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 92.79
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 90.0
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 88.47
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 88.0
d2c2la280 STIP1 homology and U box-containing protein 1, STU 85.51
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

Probab=99.49  E-value=5.6e-15  Score=105.92  Aligned_cols=57  Identities=37%  Similarity=0.871  Sum_probs=51.7

Q ss_pred             CCCCCeeeEec-cCCCCccccccccCCCccccHHHHHHHHHhcCCcccCCCCceeeee
Q psy3674          85 DENAPVCRICH-GSHENLKALCECRGTMGLVHAECLTQWLSESGRSCCEICNFKYKFK  141 (306)
Q Consensus        85 s~~~~~CRIC~-ge~~~LIsPC~CkGSl~~VH~~CL~~Wl~~s~~~~CELCk~~Y~~~  141 (306)
                      +++.++|+||+ +.+++++.||.|+|+.+++|+.||.+|+..+++..|++|+.+|+++
T Consensus         3 ded~~~C~IC~~~~~~~~~~~c~c~~c~h~~H~~Cl~~W~~~~~~~~CP~Cr~~~~~k   60 (60)
T d1vyxa_           3 DEDVPVCWICNEELGNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNTR   60 (60)
T ss_dssp             TCSCCEETTTTEECSCCCCCSCCCSSGGGSCCHHHHHHHHHHHTCSBCTTTCCBCCCC
T ss_pred             CCCCCCCccCCccCCCceeEecccCCCCCEEcHHHHHHHHhhCCCCCCcccCCeeecC
Confidence            45778999999 4567889999999999999999999999999999999999999864
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure