Psyllid ID: psy3715
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 179 | 2.2.26 [Sep-21-2011] | |||||||
| P08879 | 153 | Nucleoside diphosphate ki | no | N/A | 0.251 | 0.294 | 0.777 | 2e-14 | |
| Q6XI71 | 150 | Nucleoside diphosphate ki | N/A | N/A | 0.229 | 0.273 | 0.804 | 1e-13 | |
| P70011 | 154 | Nucleoside diphosphate ki | N/A | N/A | 0.251 | 0.292 | 0.755 | 7e-13 | |
| P70010 | 154 | Nucleoside diphosphate ki | N/A | N/A | 0.251 | 0.292 | 0.755 | 1e-12 | |
| O57535 | 153 | Nucleoside diphosphate ki | yes | N/A | 0.251 | 0.294 | 0.777 | 4e-12 | |
| Q90380 | 153 | Nucleoside diphosphate ki | N/A | N/A | 0.251 | 0.294 | 0.755 | 1e-11 | |
| Q50KA8 | 152 | Nucleoside diphosphate ki | yes | N/A | 0.229 | 0.269 | 0.756 | 1e-11 | |
| Q3T0Q4 | 152 | Nucleoside diphosphate ki | yes | N/A | 0.223 | 0.263 | 0.8 | 2e-11 | |
| Q5RFH3 | 152 | Nucleoside diphosphate ki | yes | N/A | 0.223 | 0.263 | 0.8 | 2e-11 | |
| Q01768 | 152 | Nucleoside diphosphate ki | yes | N/A | 0.223 | 0.263 | 0.8 | 2e-11 |
| >sp|P08879|NDKA_DROME Nucleoside diphosphate kinase OS=Drosophila melanogaster GN=awd PE=1 SV=3 | Back alignment and function desciption |
|---|
Score = 78.6 bits (192), Expect = 2e-14, Method: Compositional matrix adjust.
Identities = 35/45 (77%), Positives = 39/45 (86%)
Query: 17 MAEPKERTFLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWVS 61
MA KERTF+M+KPDGVQRGLVG II+RFE KGFKLVA+KF W S
Sbjct: 1 MAANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWAS 45
|
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Drosophila melanogaster (taxid: 7227) EC: 2EC: .EC: 7EC: .EC: 4EC: .EC: 6 |
| >sp|Q6XI71|NDKA_DROYA Nucleoside diphosphate kinase (Fragment) OS=Drosophila yakuba GN=awd PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P70011|NDKA2_XENLA Nucleoside diphosphate kinase A2 OS=Xenopus laevis PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P70010|NDKA1_XENLA Nucleoside diphosphate kinase A1 OS=Xenopus laevis PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O57535|NDK_CHICK Nucleoside diphosphate kinase OS=Gallus gallus PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q90380|NDK_COLLI Nucleoside diphosphate kinase OS=Columba livia PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q50KA8|NDKB_CANFA Nucleoside diphosphate kinase B OS=Canis familiaris GN=NME2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q3T0Q4|NDKB_BOVIN Nucleoside diphosphate kinase B OS=Bos taurus GN=NME2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q5RFH3|NDKB_PONAB Nucleoside diphosphate kinase B OS=Pongo abelii GN=NME2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q01768|NDKB_MOUSE Nucleoside diphosphate kinase B OS=Mus musculus GN=Nme2 PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 179 | ||||||
| 170036973 | 195 | nucleoside diphosphate kinase [Culex qui | 0.664 | 0.610 | 0.423 | 1e-23 | |
| 296476553 | 224 | TPA: NME1-NME2 protein-like [Bos taurus] | 0.860 | 0.687 | 0.403 | 3e-23 | |
| 426237703 | 267 | PREDICTED: nucleoside diphosphate kinase | 0.877 | 0.588 | 0.409 | 3e-21 | |
| 440910475 | 268 | Nucleoside diphosphate kinase B, partial | 0.877 | 0.585 | 0.409 | 3e-21 | |
| 344285831 | 267 | PREDICTED: nucleoside diphosphate kinase | 0.877 | 0.588 | 0.393 | 3e-20 | |
| 449283075 | 269 | Nucleoside diphosphate kinase [Columba l | 0.865 | 0.576 | 0.373 | 5e-20 | |
| 395531936 | 267 | PREDICTED: nucleoside diphosphate kinase | 0.877 | 0.588 | 0.382 | 9e-20 | |
| 301781232 | 270 | PREDICTED: LOW QUALITY PROTEIN: nucleosi | 0.877 | 0.581 | 0.387 | 1e-19 | |
| 402899660 | 267 | PREDICTED: nucleoside diphosphate kinase | 0.877 | 0.588 | 0.393 | 2e-19 | |
| 441641306 | 311 | PREDICTED: nucleoside diphosphate kinase | 0.877 | 0.504 | 0.393 | 2e-19 |
| >gi|170036973|ref|XP_001846335.1| nucleoside diphosphate kinase [Culex quinquefasciatus] gi|167879963|gb|EDS43346.1| nucleoside diphosphate kinase [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
Score = 114 bits (286), Expect = 1e-23, Method: Compositional matrix adjust.
Identities = 69/163 (42%), Positives = 87/163 (53%), Gaps = 44/163 (26%)
Query: 17 MAEPKERTFLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWVSFCVSFLEKKSACCRM 76
MA KERTF+M+KPDGVQRGLVG IIKRFE KGFKLVAMKF+W + K M
Sbjct: 1 MAANKERTFIMVKPDGVQRGLVGKIIKRFEAKGFKLVAMKFMWAA-------NKGRTFNM 53
Query: 77 VSSVPAYE-ISGKLLVGITYSTVLGHLNLETSECPLFHIDYELFPAERQFYCLNNYLTTC 135
V + + GK+L ++F L
Sbjct: 54 VKTDGVQRGLVGKML--------------------------------KRFETKGFQLVGL 81
Query: 136 KLLTEMGIPSEELLKQHYSDLATKPFFPGLVKYMSSGPVVPMV 178
K++ +ELL++HY+DL+ +PFFPGLV YM+SGPVVPMV
Sbjct: 82 KVM----WAEKELLEKHYADLSARPFFPGLVNYMNSGPVVPMV 120
|
Source: Culex quinquefasciatus Species: Culex quinquefasciatus Genus: Culex Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|296476553|tpg|DAA18668.1| TPA: NME1-NME2 protein-like [Bos taurus] | Back alignment and taxonomy information |
|---|
| >gi|426237703|ref|XP_004012797.1| PREDICTED: nucleoside diphosphate kinase A 1 isoform 1 [Ovis aries] | Back alignment and taxonomy information |
|---|
| >gi|440910475|gb|ELR60269.1| Nucleoside diphosphate kinase B, partial [Bos grunniens mutus] | Back alignment and taxonomy information |
|---|
| >gi|344285831|ref|XP_003414663.1| PREDICTED: nucleoside diphosphate kinase B-like isoform 2 [Loxodonta africana] | Back alignment and taxonomy information |
|---|
| >gi|449283075|gb|EMC89778.1| Nucleoside diphosphate kinase [Columba livia] | Back alignment and taxonomy information |
|---|
| >gi|395531936|ref|XP_003768029.1| PREDICTED: nucleoside diphosphate kinase B [Sarcophilus harrisii] | Back alignment and taxonomy information |
|---|
| >gi|301781232|ref|XP_002926027.1| PREDICTED: LOW QUALITY PROTEIN: nucleoside diphosphate kinase B-like [Ailuropoda melanoleuca] | Back alignment and taxonomy information |
|---|
| >gi|402899660|ref|XP_003912807.1| PREDICTED: nucleoside diphosphate kinase B-like isoform 4 [Papio anubis] gi|402899662|ref|XP_003912808.1| PREDICTED: nucleoside diphosphate kinase B-like isoform 5 [Papio anubis] | Back alignment and taxonomy information |
|---|
| >gi|441641306|ref|XP_003272317.2| PREDICTED: nucleoside diphosphate kinase 2, chloroplastic-like isoform 3 [Nomascus leucogenys] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 179 | ||||||
| UNIPROTKB|O57535 | 153 | O57535 "Nucleoside diphosphate | 0.251 | 0.294 | 0.777 | 5.1e-26 | |
| UNIPROTKB|F1MPL4 | 114 | NME2 "Nucleoside diphosphate k | 0.223 | 0.350 | 0.8 | 5.1e-26 | |
| UNIPROTKB|Q3T0Q4 | 152 | NME2 "Nucleoside diphosphate k | 0.223 | 0.263 | 0.8 | 5.1e-26 | |
| UNIPROTKB|Q2EN76 | 152 | NME2 "Nucleoside diphosphate k | 0.223 | 0.263 | 0.75 | 1.7e-25 | |
| UNIPROTKB|P22392 | 152 | NME2 "Nucleoside diphosphate k | 0.223 | 0.263 | 0.8 | 3.5e-25 | |
| MGI|MGI:97356 | 152 | Nme2 "NME/NM23 nucleoside diph | 0.223 | 0.263 | 0.8 | 3.5e-25 | |
| RGD|619877 | 152 | Nme2 "NME/NM23 nucleoside diph | 0.223 | 0.263 | 0.8 | 3.5e-25 | |
| ZFIN|ZDB-GENE-030131-7656 | 170 | nme2a "non-metastatic cells 2a | 0.234 | 0.247 | 0.761 | 4.4e-25 | |
| UNIPROTKB|J3KPD9 | 197 | NME2 "Nucleoside diphosphate k | 0.279 | 0.253 | 0.686 | 5.6e-25 | |
| UNIPROTKB|Q50KA8 | 152 | NME2 "Nucleoside diphosphate k | 0.229 | 0.269 | 0.756 | 7.1e-25 |
| UNIPROTKB|O57535 O57535 "Nucleoside diphosphate kinase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 169 (64.5 bits), Expect = 5.1e-26, Sum P(2) = 5.1e-26
Identities = 35/45 (77%), Positives = 37/45 (82%)
Query: 17 MAEPKERTFLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWVS 61
MA ERTF+ IKPDGVQRGLVG IIKRFE KGF+LVAMKFV S
Sbjct: 1 MAANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFVHAS 45
|
|
| UNIPROTKB|F1MPL4 NME2 "Nucleoside diphosphate kinase B" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3T0Q4 NME2 "Nucleoside diphosphate kinase B" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2EN76 NME2 "Nucleoside diphosphate kinase B" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P22392 NME2 "Nucleoside diphosphate kinase B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:97356 Nme2 "NME/NM23 nucleoside diphosphate kinase 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|619877 Nme2 "NME/NM23 nucleoside diphosphate kinase 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-7656 nme2a "non-metastatic cells 2a, protein (NM23B) expressed in" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3KPD9 NME2 "Nucleoside diphosphate kinase B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q50KA8 NME2 "Nucleoside diphosphate kinase B" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 2.7.4 | LOW CONFIDENCE prediction! |
| 4th Layer | 2.7.4.6 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 179 | |||
| PRK00668 | 134 | PRK00668, ndk, mulitfunctional nucleoside diphosph | 4e-23 | |
| cd04413 | 130 | cd04413, NDPk_I, Nucleoside diphosphate kinase Gro | 7e-23 | |
| pfam00334 | 135 | pfam00334, NDK, Nucleoside diphosphate kinase | 1e-21 | |
| COG0105 | 135 | COG0105, Ndk, Nucleoside diphosphate kinase [Nucle | 5e-21 | |
| PTZ00093 | 149 | PTZ00093, PTZ00093, nucleoside diphosphate kinase, | 4e-20 | |
| smart00562 | 135 | smart00562, NDK, Enzymes that catalyze nonsubstrat | 1e-18 | |
| cd04413 | 130 | cd04413, NDPk_I, Nucleoside diphosphate kinase Gro | 2e-16 | |
| PLN02619 | 238 | PLN02619, PLN02619, nucleoside-diphosphate kinase | 2e-15 | |
| pfam00334 | 135 | pfam00334, NDK, Nucleoside diphosphate kinase | 9e-15 | |
| PTZ00093 | 149 | PTZ00093, PTZ00093, nucleoside diphosphate kinase, | 1e-14 | |
| PRK14544 | 183 | PRK14544, PRK14544, nucleoside diphosphate kinase; | 2e-14 | |
| cd00595 | 133 | cd00595, NDPk, Nucleoside diphosphate kinases (NDP | 1e-12 | |
| PRK00668 | 134 | PRK00668, ndk, mulitfunctional nucleoside diphosph | 2e-12 | |
| PRK14540 | 134 | PRK14540, PRK14540, nucleoside diphosphate kinase; | 4e-12 | |
| smart00562 | 135 | smart00562, NDK, Enzymes that catalyze nonsubstrat | 9e-12 | |
| COG0105 | 135 | COG0105, Ndk, Nucleoside diphosphate kinase [Nucle | 2e-10 | |
| PRK14542 | 137 | PRK14542, PRK14542, nucleoside diphosphate kinase; | 5e-10 | |
| PRK14545 | 139 | PRK14545, PRK14545, nucleoside diphosphate kinase; | 6e-10 | |
| PRK14543 | 169 | PRK14543, PRK14543, nucleoside diphosphate kinase; | 7e-10 | |
| PLN02619 | 238 | PLN02619, PLN02619, nucleoside-diphosphate kinase | 2e-09 | |
| cd00595 | 133 | cd00595, NDPk, Nucleoside diphosphate kinases (NDP | 3e-09 | |
| PRK14541 | 140 | PRK14541, PRK14541, nucleoside diphosphate kinase; | 4e-06 | |
| cd04418 | 132 | cd04418, NDPk5, Nucleoside diphosphate kinase homo | 5e-05 | |
| PLN02931 | 177 | PLN02931, PLN02931, nucleoside diphosphate kinase | 6e-05 | |
| cd04412 | 134 | cd04412, NDPk7B, Nucleoside diphosphate kinase 7 d | 2e-04 | |
| cd04415 | 131 | cd04415, NDPk7A, Nucleoside diphosphate kinase 7 d | 6e-04 | |
| cd04416 | 132 | cd04416, NDPk_TX, NDP kinase domain of thioredoxin | 0.002 | |
| PRK14541 | 140 | PRK14541, PRK14541, nucleoside diphosphate kinase; | 0.004 |
| >gnl|CDD|179085 PRK00668, ndk, mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated | Back alignment and domain information |
|---|
Score = 88.6 bits (221), Expect = 4e-23
Identities = 26/40 (65%), Positives = 32/40 (80%)
Query: 22 ERTFLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWVS 61
ERTF +IKPD VQRGL+G II RFE KG K+VA+K + +S
Sbjct: 2 ERTFSIIKPDAVQRGLIGEIISRFEKKGLKIVALKMMQLS 41
|
Length = 134 |
| >gnl|CDD|239876 cd04413, NDPk_I, Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate | Back alignment and domain information |
|---|
| >gnl|CDD|201162 pfam00334, NDK, Nucleoside diphosphate kinase | Back alignment and domain information |
|---|
| >gnl|CDD|223183 COG0105, Ndk, Nucleoside diphosphate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|173387 PTZ00093, PTZ00093, nucleoside diphosphate kinase, cytosolic; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197791 smart00562, NDK, Enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates | Back alignment and domain information |
|---|
| >gnl|CDD|239876 cd04413, NDPk_I, Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate | Back alignment and domain information |
|---|
| >gnl|CDD|178228 PLN02619, PLN02619, nucleoside-diphosphate kinase | Back alignment and domain information |
|---|
| >gnl|CDD|201162 pfam00334, NDK, Nucleoside diphosphate kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173387 PTZ00093, PTZ00093, nucleoside diphosphate kinase, cytosolic; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173010 PRK14544, PRK14544, nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238335 cd00595, NDPk, Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation | Back alignment and domain information |
|---|
| >gnl|CDD|179085 PRK00668, ndk, mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|184733 PRK14540, PRK14540, nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197791 smart00562, NDK, Enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates | Back alignment and domain information |
|---|
| >gnl|CDD|223183 COG0105, Ndk, Nucleoside diphosphate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|173008 PRK14542, PRK14542, nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184734 PRK14545, PRK14545, nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237749 PRK14543, PRK14543, nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178228 PLN02619, PLN02619, nucleoside-diphosphate kinase | Back alignment and domain information |
|---|
| >gnl|CDD|238335 cd00595, NDPk, Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation | Back alignment and domain information |
|---|
| >gnl|CDD|173007 PRK14541, PRK14541, nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239880 cd04418, NDPk5, Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species | Back alignment and domain information |
|---|
| >gnl|CDD|215503 PLN02931, PLN02931, nucleoside diphosphate kinase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|239875 cd04412, NDPk7B, Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B | Back alignment and domain information |
|---|
| >gnl|CDD|239878 cd04415, NDPk7A, Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B | Back alignment and domain information |
|---|
| >gnl|CDD|239879 cd04416, NDPk_TX, NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively | Back alignment and domain information |
|---|
| >gnl|CDD|173007 PRK14541, PRK14541, nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 179 | ||||
| 1nsq_A | 153 | Mechanism Of Phosphate Transfer By Nucleoside Dipho | 2e-15 | ||
| 1nsq_A | 153 | Mechanism Of Phosphate Transfer By Nucleoside Dipho | 2e-10 | ||
| 1ndl_A | 153 | The Awd Nucleotide Diphosphate Kinase From Drosophi | 2e-15 | ||
| 1ndl_A | 153 | The Awd Nucleotide Diphosphate Kinase From Drosophi | 2e-10 | ||
| 3r9l_A | 155 | Crystal Structure Of Nucleoside Diphosphate Kinase | 9e-13 | ||
| 3r9l_A | 155 | Crystal Structure Of Nucleoside Diphosphate Kinase | 3e-06 | ||
| 3bbc_A | 151 | Crystal Structure Of R88a Mutant Of The Nm23-H2 Tra | 2e-12 | ||
| 3bbc_A | 151 | Crystal Structure Of R88a Mutant Of The Nm23-H2 Tra | 8e-10 | ||
| 1nsk_R | 152 | The Crystal Structure Of A Human Nucleoside Diphosp | 2e-12 | ||
| 1nsk_R | 152 | The Crystal Structure Of A Human Nucleoside Diphosp | 8e-10 | ||
| 1nue_A | 151 | X-ray Structure Of Nm23 Human Nucleoside Diphosphat | 2e-12 | ||
| 1nue_A | 151 | X-ray Structure Of Nm23 Human Nucleoside Diphosphat | 8e-10 | ||
| 1bhn_A | 152 | Nucleoside Diphosphate Kinase Isoform A From Bovine | 2e-12 | ||
| 1bhn_A | 152 | Nucleoside Diphosphate Kinase Isoform A From Bovine | 9e-09 | ||
| 1be4_A | 151 | Nucleoside Diphosphate Kinase Isoform B From Bovine | 4e-12 | ||
| 1be4_A | 151 | Nucleoside Diphosphate Kinase Isoform B From Bovine | 1e-08 | ||
| 1zs6_A | 169 | Structure Of Human Nucleoside-diphosphate Kinase 3 | 5e-12 | ||
| 1zs6_A | 169 | Structure Of Human Nucleoside-diphosphate Kinase 3 | 2e-07 | ||
| 1jxv_A | 152 | Crystal Structure Of Human Nucleoside Diphosphate K | 1e-11 | ||
| 1jxv_A | 152 | Crystal Structure Of Human Nucleoside Diphosphate K | 9e-09 | ||
| 3l7u_A | 172 | Crystal Structure Of Human Nm23-H1 Length = 172 | 1e-11 | ||
| 3l7u_A | 172 | Crystal Structure Of Human Nm23-H1 Length = 172 | 1e-08 | ||
| 2hve_A | 152 | S120g Mutant Of Human Nucleoside Diphosphate Kinase | 1e-11 | ||
| 2hve_A | 152 | S120g Mutant Of Human Nucleoside Diphosphate Kinase | 9e-09 | ||
| 1ucn_A | 152 | X-Ray Structure Of Human Nucleoside Diphosphate Kin | 1e-11 | ||
| 1ucn_A | 152 | X-Ray Structure Of Human Nucleoside Diphosphate Kin | 2e-08 | ||
| 4fkx_A | 161 | Crystal Structure Of Nucleoside Diphosphate Kinase | 4e-11 | ||
| 4fkx_A | 161 | Crystal Structure Of Nucleoside Diphosphate Kinase | 1e-08 | ||
| 4f36_A | 157 | Crystal Structure Of Nucleoside Diphosphate Kinase | 5e-11 | ||
| 4f36_A | 157 | Crystal Structure Of Nucleoside Diphosphate Kinase | 1e-08 | ||
| 2zua_A | 174 | Crystal Structure Of Nucleoside Diphosphate Kinase | 5e-11 | ||
| 2zua_A | 174 | Crystal Structure Of Nucleoside Diphosphate Kinase | 7e-05 | ||
| 1xiq_A | 157 | Plasmodium Falciparum Nucleoside Diphosphate Kinase | 7e-11 | ||
| 1xiq_A | 157 | Plasmodium Falciparum Nucleoside Diphosphate Kinase | 2e-07 | ||
| 1nb2_A | 150 | Crystal Structure Of Nucleoside Diphosphate Kinase | 8e-11 | ||
| 1wkj_A | 137 | Crystal Structure Of Nucleoside Diphosphate Kinase | 2e-10 | ||
| 1wkj_A | 137 | Crystal Structure Of Nucleoside Diphosphate Kinase | 6e-07 | ||
| 3ngr_A | 151 | Crystal Structure Of Leishmania Nucleoside Diphosph | 2e-10 | ||
| 3ngr_A | 151 | Crystal Structure Of Leishmania Nucleoside Diphosph | 4e-07 | ||
| 3js9_A | 156 | Crystal Structure Of Nucleoside Diphosphate Kinase | 3e-10 | ||
| 2az3_A | 164 | Structure Of A Halophilic Nucleoside Diphosphate Ki | 3e-10 | ||
| 2az3_A | 164 | Structure Of A Halophilic Nucleoside Diphosphate Ki | 3e-05 | ||
| 2az1_A | 181 | Structure Of A Halophilic Nucleoside Diphosphate Ki | 3e-10 | ||
| 2az1_A | 181 | Structure Of A Halophilic Nucleoside Diphosphate Ki | 3e-05 | ||
| 3b54_A | 161 | Saccharomyces Cerevisiae Nucleoside Diphosphate Kin | 4e-10 | ||
| 3b54_A | 161 | Saccharomyces Cerevisiae Nucleoside Diphosphate Kin | 1e-04 | ||
| 1pku_A | 150 | Crystal Structure Of Nucleoside Diphosphate Kinase | 6e-10 | ||
| 1pku_A | 150 | Crystal Structure Of Nucleoside Diphosphate Kinase | 3e-07 | ||
| 1s57_A | 153 | Crystal Structure Of Nucleoside Diphosphate Kinase | 1e-09 | ||
| 1s57_A | 153 | Crystal Structure Of Nucleoside Diphosphate Kinase | 2e-05 | ||
| 1u8w_A | 149 | Crystal Structure Of Arabidopsis Thaliana Nucleosid | 2e-09 | ||
| 1u8w_A | 149 | Crystal Structure Of Arabidopsis Thaliana Nucleosid | 1e-04 | ||
| 1mn7_A | 155 | Ndp Kinase Mutant (H122g;n119s;f64w) In Complex Wit | 2e-09 | ||
| 1mn7_A | 155 | Ndp Kinase Mutant (H122g;n119s;f64w) In Complex Wit | 9e-05 | ||
| 2cwk_A | 160 | Crystal Structure Of Nucleotide Diphosphate Kinase | 2e-09 | ||
| 3prv_A | 157 | Nucleoside Diphosphate Kinase B From Trypanosoma Cr | 2e-09 | ||
| 3prv_A | 157 | Nucleoside Diphosphate Kinase B From Trypanosoma Cr | 7e-07 | ||
| 1w7w_A | 182 | Structure And Mutational Analysis Of A Plant Mitoch | 3e-09 | ||
| 1w7w_A | 182 | Structure And Mutational Analysis Of A Plant Mitoch | 2e-06 | ||
| 1lwx_A | 155 | Azt Diphosphate Binding To Nucleoside Diphosphate K | 3e-09 | ||
| 1lwx_A | 155 | Azt Diphosphate Binding To Nucleoside Diphosphate K | 3e-05 | ||
| 1hlw_A | 155 | Structure Of The H122a Mutant Of The Nucleoside Dip | 4e-09 | ||
| 1hlw_A | 155 | Structure Of The H122a Mutant Of The Nucleoside Dip | 3e-05 | ||
| 1pae_X | 155 | Nucleoside Diphosphate Kinase Length = 155 | 4e-09 | ||
| 1pae_X | 155 | Nucleoside Diphosphate Kinase Length = 155 | 1e-04 | ||
| 1leo_A | 150 | P100s Nucleoside Diphosphate Kinase Length = 150 | 4e-09 | ||
| 1leo_A | 150 | P100s Nucleoside Diphosphate Kinase Length = 150 | 2e-05 | ||
| 1ndp_A | 155 | Adenosine 5'-Diphosphate Binding And The Active Sit | 4e-09 | ||
| 1ndp_A | 155 | Adenosine 5'-Diphosphate Binding And The Active Sit | 3e-05 | ||
| 1nsp_A | 155 | Mechanism Of Phosphate Transfer By Nucleoside Dipho | 4e-09 | ||
| 1nsp_A | 155 | Mechanism Of Phosphate Transfer By Nucleoside Dipho | 3e-05 | ||
| 1npk_A | 154 | Refined X-Ray Structure Of Dictyostelium Nucleoside | 4e-09 | ||
| 1npk_A | 154 | Refined X-Ray Structure Of Dictyostelium Nucleoside | 3e-05 | ||
| 1b4s_A | 155 | Structure Of Nucleoside Diphosphate Kinase H122g Mu | 4e-09 | ||
| 1b4s_A | 155 | Structure Of Nucleoside Diphosphate Kinase H122g Mu | 3e-05 | ||
| 1ncl_A | 150 | Thermal Stability Of Hexameric And Tetrameric Nucle | 4e-09 | ||
| 1ncl_A | 150 | Thermal Stability Of Hexameric And Tetrameric Nucle | 2e-05 | ||
| 1ndk_A | 155 | X-Ray Structure Of Nucleoside Diphosphate Kinase Le | 4e-09 | ||
| 1ndk_A | 155 | X-Ray Structure Of Nucleoside Diphosphate Kinase Le | 3e-05 | ||
| 2vu5_A | 148 | Crystal Structure Of Pndk From Bacillus Anthracis L | 5e-09 | ||
| 1ehw_A | 162 | Human Nucleoside Diphosphate Kinase 4 Length = 162 | 7e-09 | ||
| 1ehw_A | 162 | Human Nucleoside Diphosphate Kinase 4 Length = 162 | 1e-07 | ||
| 1hhq_A | 155 | Role Of Active Site Resiude Lys16 In Nucleoside Dip | 1e-08 | ||
| 1hhq_A | 155 | Role Of Active Site Resiude Lys16 In Nucleoside Dip | 3e-05 | ||
| 3q83_A | 157 | Crystal Structure Of Staphylococcus Aureus Nucleosi | 3e-08 | ||
| 2nck_R | 144 | Crystal Structure Of Myxococcus Xanthus Nucleoside | 5e-07 | ||
| 1xqi_A | 195 | Crystal Structure Analysis Of An Ndp Kinase From Py | 2e-06 | ||
| 3mpd_A | 151 | Crystal Structure Of Nucleoside Diphosphate Kinase | 2e-06 | ||
| 1k44_A | 136 | Mycobacterium Tuberculosis Nucleoside Diphosphate K | 2e-06 | ||
| 1k44_A | 136 | Mycobacterium Tuberculosis Nucleoside Diphosphate K | 7e-04 | ||
| 4di6_A | 190 | Crystal Structure Of Nucleoside-Diphosphate Kinase | 3e-06 | ||
| 3pj9_A | 140 | Crystal Structure Of A Nucleoside Diphosphate Kinas | 5e-06 | ||
| 2b8p_A | 157 | Crystal Structure Of Acanthamoeba Polyphaga Mimivir | 9e-06 | ||
| 3ejm_A | 146 | Crystal Structure Of The Mimivirus Ndk +kpn Mutant | 9e-06 | ||
| 3em1_A | 146 | Crystal Structure Of The Mimivirus Ndk +kpn-N62l Do | 9e-06 | ||
| 3ddi_A | 146 | Crystal Structure Of The Mimivirus Ndk +kpn-N62l-R1 | 1e-05 | ||
| 3emt_A | 146 | Crystal Structure Of The Mimivirus Ndk +kpn-R107g D | 1e-05 | ||
| 2b8q_A | 142 | X-Ray Structure Of Acanthamoeba Ployphaga Mimivirus | 1e-05 | ||
| 3fbf_A | 142 | Crystal Structure Of The Mimivirus Ndk N62l Mutant | 1e-05 | ||
| 2hur_A | 142 | Escherichia Coli Nucleoside Diphosphate Kinase Leng | 1e-05 | ||
| 3fbe_A | 142 | Crystal Structure Of The Mimivirus Ndk N62l-R107g D | 1e-05 | ||
| 3evw_A | 142 | Crystal Structure Of The Mimivirus Ndk R107g Mutant | 1e-05 | ||
| 3vgu_A | 141 | E134a Mutant Nucleoside Diphosphate Kinase Derived | 5e-05 | ||
| 3vgs_A | 141 | Wild-Type Nucleoside Diphosphate Kinase Derived Fro | 5e-05 | ||
| 4dut_A | 145 | The Structure Of Nucleoside Diphosphate Kinase (Ndk | 7e-05 | ||
| 3ztq_A | 142 | Hexagonal Crystal Form P61 Of The Aquifex Aeolicus | 4e-04 |
| >pdb|1NSQ|A Chain A, Mechanism Of Phosphate Transfer By Nucleoside Diphosphate Kinase: X- Ray Structures Of A Phospho-Histidine Intermediate Of The Enzymes From Drosophila And Dictyostelium Length = 153 | Back alignment and structure |
|
| >pdb|1NSQ|A Chain A, Mechanism Of Phosphate Transfer By Nucleoside Diphosphate Kinase: X- Ray Structures Of A Phospho-Histidine Intermediate Of The Enzymes From Drosophila And Dictyostelium Length = 153 | Back alignment and structure |
| >pdb|1NDL|A Chain A, The Awd Nucleotide Diphosphate Kinase From Drosophila Length = 153 | Back alignment and structure |
| >pdb|1NDL|A Chain A, The Awd Nucleotide Diphosphate Kinase From Drosophila Length = 153 | Back alignment and structure |
| >pdb|3R9L|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Giardia Lamblia Featuring A Disordered Dinucleotide Binding Site Length = 155 | Back alignment and structure |
| >pdb|3R9L|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Giardia Lamblia Featuring A Disordered Dinucleotide Binding Site Length = 155 | Back alignment and structure |
| >pdb|3BBC|A Chain A, Crystal Structure Of R88a Mutant Of The Nm23-H2 Transcription Factor Length = 151 | Back alignment and structure |
| >pdb|3BBC|A Chain A, Crystal Structure Of R88a Mutant Of The Nm23-H2 Transcription Factor Length = 151 | Back alignment and structure |
| >pdb|1NSK|R Chain R, The Crystal Structure Of A Human Nucleoside Diphosphate Kinase, Nm23-H2 Length = 152 | Back alignment and structure |
| >pdb|1NSK|R Chain R, The Crystal Structure Of A Human Nucleoside Diphosphate Kinase, Nm23-H2 Length = 152 | Back alignment and structure |
| >pdb|1NUE|A Chain A, X-ray Structure Of Nm23 Human Nucleoside Diphosphate Kinase B Complexed With Gdp At 2 Angstroms Resolution Length = 151 | Back alignment and structure |
| >pdb|1NUE|A Chain A, X-ray Structure Of Nm23 Human Nucleoside Diphosphate Kinase B Complexed With Gdp At 2 Angstroms Resolution Length = 151 | Back alignment and structure |
| >pdb|1BHN|A Chain A, Nucleoside Diphosphate Kinase Isoform A From Bovine Retina Length = 152 | Back alignment and structure |
| >pdb|1BHN|A Chain A, Nucleoside Diphosphate Kinase Isoform A From Bovine Retina Length = 152 | Back alignment and structure |
| >pdb|1BE4|A Chain A, Nucleoside Diphosphate Kinase Isoform B From Bovine Retina Length = 151 | Back alignment and structure |
| >pdb|1BE4|A Chain A, Nucleoside Diphosphate Kinase Isoform B From Bovine Retina Length = 151 | Back alignment and structure |
| >pdb|1ZS6|A Chain A, Structure Of Human Nucleoside-diphosphate Kinase 3 Length = 169 | Back alignment and structure |
| >pdb|1ZS6|A Chain A, Structure Of Human Nucleoside-diphosphate Kinase 3 Length = 169 | Back alignment and structure |
| >pdb|1JXV|A Chain A, Crystal Structure Of Human Nucleoside Diphosphate Kinase A Length = 152 | Back alignment and structure |
| >pdb|1JXV|A Chain A, Crystal Structure Of Human Nucleoside Diphosphate Kinase A Length = 152 | Back alignment and structure |
| >pdb|3L7U|A Chain A, Crystal Structure Of Human Nm23-H1 Length = 172 | Back alignment and structure |
| >pdb|3L7U|A Chain A, Crystal Structure Of Human Nm23-H1 Length = 172 | Back alignment and structure |
| >pdb|2HVE|A Chain A, S120g Mutant Of Human Nucleoside Diphosphate Kinase A Complexed With Adp Length = 152 | Back alignment and structure |
| >pdb|2HVE|A Chain A, S120g Mutant Of Human Nucleoside Diphosphate Kinase A Complexed With Adp Length = 152 | Back alignment and structure |
| >pdb|1UCN|A Chain A, X-Ray Structure Of Human Nucleoside Diphosphate Kinase A Complexed With Adp At 2 A Resolution Length = 152 | Back alignment and structure |
| >pdb|1UCN|A Chain A, X-Ray Structure Of Human Nucleoside Diphosphate Kinase A Complexed With Adp At 2 A Resolution Length = 152 | Back alignment and structure |
| >pdb|4FKX|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase B From Trypanosoma Brucei Bound To Cdp Length = 161 | Back alignment and structure |
| >pdb|4FKX|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase B From Trypanosoma Brucei Bound To Cdp Length = 161 | Back alignment and structure |
| >pdb|4F36|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase B From Trypanosoma Brucei, Apo Form Length = 157 | Back alignment and structure |
| >pdb|4F36|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase B From Trypanosoma Brucei, Apo Form Length = 157 | Back alignment and structure |
| >pdb|2ZUA|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Haloarcula Quadrata Length = 174 | Back alignment and structure |
| >pdb|2ZUA|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Haloarcula Quadrata Length = 174 | Back alignment and structure |
| >pdb|1XIQ|A Chain A, Plasmodium Falciparum Nucleoside Diphosphate Kinase B Length = 157 | Back alignment and structure |
| >pdb|1XIQ|A Chain A, Plasmodium Falciparum Nucleoside Diphosphate Kinase B Length = 157 | Back alignment and structure |
| >pdb|1NB2|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Bacillus Halodenitrificans Length = 150 | Back alignment and structure |
| >pdb|1WKJ|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Thermus Thermophilus Hb8 Length = 137 | Back alignment and structure |
| >pdb|1WKJ|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Thermus Thermophilus Hb8 Length = 137 | Back alignment and structure |
| >pdb|3NGR|A Chain A, Crystal Structure Of Leishmania Nucleoside Diphosphate Kinase B With Unordered Nucleotide-Binding Loop. Length = 151 | Back alignment and structure |
| >pdb|3NGR|A Chain A, Crystal Structure Of Leishmania Nucleoside Diphosphate Kinase B With Unordered Nucleotide-Binding Loop. Length = 151 | Back alignment and structure |
| >pdb|3JS9|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase Family Protein From Babesia Bovis Length = 156 | Back alignment and structure |
| >pdb|2AZ3|A Chain A, Structure Of A Halophilic Nucleoside Diphosphate Kinase From Halobacterium Salinarum In Complex With Cdp Length = 164 | Back alignment and structure |
| >pdb|2AZ3|A Chain A, Structure Of A Halophilic Nucleoside Diphosphate Kinase From Halobacterium Salinarum In Complex With Cdp Length = 164 | Back alignment and structure |
| >pdb|2AZ1|A Chain A, Structure Of A Halophilic Nucleoside Diphosphate Kinase From Halobacterium Salinarum Length = 181 | Back alignment and structure |
| >pdb|2AZ1|A Chain A, Structure Of A Halophilic Nucleoside Diphosphate Kinase From Halobacterium Salinarum Length = 181 | Back alignment and structure |
| >pdb|3B54|A Chain A, Saccharomyces Cerevisiae Nucleoside Diphosphate Kinase Length = 161 | Back alignment and structure |
| >pdb|3B54|A Chain A, Saccharomyces Cerevisiae Nucleoside Diphosphate Kinase Length = 161 | Back alignment and structure |
| >pdb|1PKU|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Rice Length = 150 | Back alignment and structure |
| >pdb|1PKU|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Rice Length = 150 | Back alignment and structure |
| >pdb|1S57|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From Arabidopsis Length = 153 | Back alignment and structure |
| >pdb|1S57|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From Arabidopsis Length = 153 | Back alignment and structure |
| >pdb|1U8W|A Chain A, Crystal Structure Of Arabidopsis Thaliana Nucleoside Diphosphate Kinase 1 Length = 149 | Back alignment and structure |
| >pdb|1U8W|A Chain A, Crystal Structure Of Arabidopsis Thaliana Nucleoside Diphosphate Kinase 1 Length = 149 | Back alignment and structure |
| >pdb|1MN7|A Chain A, Ndp Kinase Mutant (H122g;n119s;f64w) In Complex With Abazttp Length = 155 | Back alignment and structure |
| >pdb|1MN7|A Chain A, Ndp Kinase Mutant (H122g;n119s;f64w) In Complex With Abazttp Length = 155 | Back alignment and structure |
| >pdb|2CWK|A Chain A, Crystal Structure Of Nucleotide Diphosphate Kinase From Pyrococcus Horikoshii Length = 160 | Back alignment and structure |
| >pdb|3PRV|A Chain A, Nucleoside Diphosphate Kinase B From Trypanosoma Cruzi Length = 157 | Back alignment and structure |
| >pdb|3PRV|A Chain A, Nucleoside Diphosphate Kinase B From Trypanosoma Cruzi Length = 157 | Back alignment and structure |
| >pdb|1W7W|A Chain A, Structure And Mutational Analysis Of A Plant Mitochondrial Nucleoside Diphosphate Kinase: Identification Of Residues Involved In Serine Phosphorylation And Oligomerization. Length = 182 | Back alignment and structure |
| >pdb|1W7W|A Chain A, Structure And Mutational Analysis Of A Plant Mitochondrial Nucleoside Diphosphate Kinase: Identification Of Residues Involved In Serine Phosphorylation And Oligomerization. Length = 182 | Back alignment and structure |
| >pdb|1LWX|A Chain A, Azt Diphosphate Binding To Nucleoside Diphosphate Kinase Length = 155 | Back alignment and structure |
| >pdb|1LWX|A Chain A, Azt Diphosphate Binding To Nucleoside Diphosphate Kinase Length = 155 | Back alignment and structure |
| >pdb|1HLW|A Chain A, Structure Of The H122a Mutant Of The Nucleoside Diphosphate Kinase Length = 155 | Back alignment and structure |
| >pdb|1HLW|A Chain A, Structure Of The H122a Mutant Of The Nucleoside Diphosphate Kinase Length = 155 | Back alignment and structure |
| >pdb|1PAE|X Chain X, Nucleoside Diphosphate Kinase Length = 155 | Back alignment and structure |
| >pdb|1PAE|X Chain X, Nucleoside Diphosphate Kinase Length = 155 | Back alignment and structure |
| >pdb|1LEO|A Chain A, P100s Nucleoside Diphosphate Kinase Length = 150 | Back alignment and structure |
| >pdb|1LEO|A Chain A, P100s Nucleoside Diphosphate Kinase Length = 150 | Back alignment and structure |
| >pdb|1NDP|A Chain A, Adenosine 5'-Diphosphate Binding And The Active Site Of Nucleoside Diphosphate Kinase Length = 155 | Back alignment and structure |
| >pdb|1NDP|A Chain A, Adenosine 5'-Diphosphate Binding And The Active Site Of Nucleoside Diphosphate Kinase Length = 155 | Back alignment and structure |
| >pdb|1NSP|A Chain A, Mechanism Of Phosphate Transfer By Nucleoside Diphosphate Kinase: X- Ray Structures Of A Phospho-Histidine Intermediate Of The Enzymes From Drosophila And Dictyostelium Length = 155 | Back alignment and structure |
| >pdb|1NSP|A Chain A, Mechanism Of Phosphate Transfer By Nucleoside Diphosphate Kinase: X- Ray Structures Of A Phospho-Histidine Intermediate Of The Enzymes From Drosophila And Dictyostelium Length = 155 | Back alignment and structure |
| >pdb|1NPK|A Chain A, Refined X-Ray Structure Of Dictyostelium Nucleoside Diphosphate Kinase At 1,8 Angstroms Resolution Length = 154 | Back alignment and structure |
| >pdb|1NPK|A Chain A, Refined X-Ray Structure Of Dictyostelium Nucleoside Diphosphate Kinase At 1,8 Angstroms Resolution Length = 154 | Back alignment and structure |
| >pdb|1B4S|A Chain A, Structure Of Nucleoside Diphosphate Kinase H122g Mutant Length = 155 | Back alignment and structure |
| >pdb|1B4S|A Chain A, Structure Of Nucleoside Diphosphate Kinase H122g Mutant Length = 155 | Back alignment and structure |
| >pdb|1NCL|A Chain A, Thermal Stability Of Hexameric And Tetrameric Nucleoside, Diphosphate Kinases Length = 150 | Back alignment and structure |
| >pdb|1NCL|A Chain A, Thermal Stability Of Hexameric And Tetrameric Nucleoside, Diphosphate Kinases Length = 150 | Back alignment and structure |
| >pdb|1NDK|A Chain A, X-Ray Structure Of Nucleoside Diphosphate Kinase Length = 155 | Back alignment and structure |
| >pdb|1NDK|A Chain A, X-Ray Structure Of Nucleoside Diphosphate Kinase Length = 155 | Back alignment and structure |
| >pdb|2VU5|A Chain A, Crystal Structure Of Pndk From Bacillus Anthracis Length = 148 | Back alignment and structure |
| >pdb|1EHW|A Chain A, Human Nucleoside Diphosphate Kinase 4 Length = 162 | Back alignment and structure |
| >pdb|1EHW|A Chain A, Human Nucleoside Diphosphate Kinase 4 Length = 162 | Back alignment and structure |
| >pdb|1HHQ|A Chain A, Role Of Active Site Resiude Lys16 In Nucleoside Diphosphate Kinase Length = 155 | Back alignment and structure |
| >pdb|1HHQ|A Chain A, Role Of Active Site Resiude Lys16 In Nucleoside Diphosphate Kinase Length = 155 | Back alignment and structure |
| >pdb|3Q83|A Chain A, Crystal Structure Of Staphylococcus Aureus Nucleoside Diphosphate Kinase Length = 157 | Back alignment and structure |
| >pdb|2NCK|R Chain R, Crystal Structure Of Myxococcus Xanthus Nucleoside Diphosphate Kinase And Its Interaction With A Nucleotide Substrate At 2.0 Angstroms Resolution Length = 144 | Back alignment and structure |
| >pdb|1XQI|A Chain A, Crystal Structure Analysis Of An Ndp Kinase From Pyrobaculum Aerophilum Length = 195 | Back alignment and structure |
| >pdb|3MPD|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Encephalitozoon Cuniculi, Cubic Form, Apo Length = 151 | Back alignment and structure |
| >pdb|1K44|A Chain A, Mycobacterium Tuberculosis Nucleoside Diphosphate Kinase Length = 136 | Back alignment and structure |
| >pdb|1K44|A Chain A, Mycobacterium Tuberculosis Nucleoside Diphosphate Kinase Length = 136 | Back alignment and structure |
| >pdb|4DI6|A Chain A, Crystal Structure Of Nucleoside-Diphosphate Kinase From Borrelia Burgdorferi Length = 190 | Back alignment and structure |
| >pdb|3PJ9|A Chain A, Crystal Structure Of A Nucleoside Diphosphate Kinase From Campylobacter Jejuni Length = 140 | Back alignment and structure |
| >pdb|2B8P|A Chain A, Crystal Structure Of Acanthamoeba Polyphaga Mimivirus Ndk, The First Viral Nucleoside Diphosphate Kinase Length = 157 | Back alignment and structure |
| >pdb|3EJM|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn Mutant Complexed With Gdp Length = 146 | Back alignment and structure |
| >pdb|3EM1|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-N62l Double Mutant Complexed With Dtdp Length = 146 | Back alignment and structure |
| >pdb|3DDI|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-N62l-R107g Triple Mutant Complexed With Tdp Length = 146 | Back alignment and structure |
| >pdb|3EMT|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-R107g Double Mutant Complexed With Dgdp Length = 146 | Back alignment and structure |
| >pdb|2B8Q|A Chain A, X-Ray Structure Of Acanthamoeba Ployphaga Mimivirus Nucleoside Diphosphate Kinase Complexed With Tdp Length = 142 | Back alignment and structure |
| >pdb|3FBF|A Chain A, Crystal Structure Of The Mimivirus Ndk N62l Mutant Complexed With Dtdp Length = 142 | Back alignment and structure |
| >pdb|2HUR|A Chain A, Escherichia Coli Nucleoside Diphosphate Kinase Length = 142 | Back alignment and structure |
| >pdb|3FBE|A Chain A, Crystal Structure Of The Mimivirus Ndk N62l-R107g Double Mutant Complexed With Gdp Length = 142 | Back alignment and structure |
| >pdb|3EVW|A Chain A, Crystal Structure Of The Mimivirus Ndk R107g Mutant Complexed With Dtdp Length = 142 | Back alignment and structure |
| >pdb|3VGU|A Chain A, E134a Mutant Nucleoside Diphosphate Kinase Derived From Halomonas Sp. 593 Length = 141 | Back alignment and structure |
| >pdb|3VGS|A Chain A, Wild-Type Nucleoside Diphosphate Kinase Derived From Halomonas Sp. 593 Length = 141 | Back alignment and structure |
| >pdb|4DUT|A Chain A, The Structure Of Nucleoside Diphosphate Kinase (Ndk) From Burkholderia Thailandensis Length = 145 | Back alignment and structure |
| >pdb|3ZTQ|A Chain A, Hexagonal Crystal Form P61 Of The Aquifex Aeolicus Nucleoside Diphosphate Kinase Length = 142 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 Length = 195 | Back alignment and structure |
|---|
Score = 115 bits (289), Expect = 6e-33
Identities = 40/173 (23%), Positives = 59/173 (34%), Gaps = 52/173 (30%)
Query: 6 LHLLYIVIHKIMAEPKERTFLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWVSFCVS 65
+H + I ++ P E+T L++KPD V RGLV II RF+ G K+VA+K V
Sbjct: 1 MHAINIAFFDLIM-PVEKTLLILKPDAVARGLVDEIISRFKKAGLKIVALKMVK------ 53
Query: 66 FLEKKSACCRMVSSVPAYEISGKLLVGITYSTVLGHLNLETSECPLFHIDYELFPAERQF 125
+ + Y +
Sbjct: 54 ---------------------------ASPEEIERF--------------Y----PSSEE 68
Query: 126 YCLNNYLTTCKLLTEMGIPSEELLKQHYSDLATKPFFPGLVKYMSSGPVVPMV 178
+ + K E+GI + + LVKYM+SGP V MV
Sbjct: 69 WLQSAGQKLLKAYQELGIDPRAKIGTDDPVEVGRIIKRNLVKYMTSGPNVVMV 121
|
| >1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 Length = 169 | Back alignment and structure |
|---|
| >1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 Length = 169 | Back alignment and structure |
|---|
| >3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} Length = 161 | Back alignment and structure |
|---|
| >3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} Length = 161 | Back alignment and structure |
|---|
| >2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A Length = 164 | Back alignment and structure |
|---|
| >2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A Length = 164 | Back alignment and structure |
|---|
| >3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* Length = 151 | Back alignment and structure |
|---|
| >3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* Length = 151 | Back alignment and structure |
|---|
| >4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* Length = 190 | Back alignment and structure |
|---|
| >4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* Length = 190 | Back alignment and structure |
|---|
| >3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} Length = 155 | Back alignment and structure |
|---|
| >3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} Length = 155 | Back alignment and structure |
|---|
| >1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 Length = 157 | Back alignment and structure |
|---|
| >1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 Length = 157 | Back alignment and structure |
|---|
| >3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} Length = 156 | Back alignment and structure |
|---|
| >3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} Length = 156 | Back alignment and structure |
|---|
| >3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} Length = 172 | Back alignment and structure |
|---|
| >3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} Length = 172 | Back alignment and structure |
|---|
| >4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* Length = 161 | Back alignment and structure |
|---|
| >4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* Length = 161 | Back alignment and structure |
|---|
| >2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} Length = 148 | Back alignment and structure |
|---|
| >2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} Length = 148 | Back alignment and structure |
|---|
| >1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 Length = 150 | Back alignment and structure |
|---|
| >1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 Length = 150 | Back alignment and structure |
|---|
| >1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 Length = 150 | Back alignment and structure |
|---|
| >1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 Length = 150 | Back alignment and structure |
|---|
| >1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* Length = 153 | Back alignment and structure |
|---|
| >1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* Length = 153 | Back alignment and structure |
|---|
| >1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 Length = 136 | Back alignment and structure |
|---|
| >1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 Length = 136 | Back alignment and structure |
|---|
| >1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 Length = 149 | Back alignment and structure |
|---|
| >1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 Length = 149 | Back alignment and structure |
|---|
| >1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* Length = 137 | Back alignment and structure |
|---|
| >1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* Length = 137 | Back alignment and structure |
|---|
| >3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... Length = 155 | Back alignment and structure |
|---|
| >3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... Length = 155 | Back alignment and structure |
|---|
| >1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A Length = 144 | Back alignment and structure |
|---|
| >1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A Length = 144 | Back alignment and structure |
|---|
| >1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 Length = 162 | Back alignment and structure |
|---|
| >1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 Length = 162 | Back alignment and structure |
|---|
| >2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} Length = 142 | Back alignment and structure |
|---|
| >2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} Length = 142 | Back alignment and structure |
|---|
| >3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* Length = 157 | Back alignment and structure |
|---|
| >3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* Length = 157 | Back alignment and structure |
|---|
| >3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} Length = 151 | Back alignment and structure |
|---|
| >3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} Length = 151 | Back alignment and structure |
|---|
| >1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 Length = 182 | Back alignment and structure |
|---|
| >1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 Length = 182 | Back alignment and structure |
|---|
| >4ek2_A Nucleoside diphosphate kinase; seattle structural genomics center for infectious disease, S DAMP, niaid; HET: DA; 2.00A {Burkholderia thailandensis} PDB: 4dut_A* Length = 145 | Back alignment and structure |
|---|
| >4ek2_A Nucleoside diphosphate kinase; seattle structural genomics center for infectious disease, S DAMP, niaid; HET: DA; 2.00A {Burkholderia thailandensis} PDB: 4dut_A* Length = 145 | Back alignment and structure |
|---|
| >2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* Length = 160 | Back alignment and structure |
|---|
| >2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* Length = 160 | Back alignment and structure |
|---|
| >3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A Length = 142 | Back alignment and structure |
|---|
| >3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A Length = 142 | Back alignment and structure |
|---|
| >3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... Length = 146 | Back alignment and structure |
|---|
| >3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... Length = 146 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 179 | |||
| 1zs6_A | 169 | Nucleoside diphosphate kinase 3; nucleotide metabo | 100.0 | |
| 4hr2_A | 145 | Nucleoside diphosphate kinase; ssgcid, seattle str | 100.0 | |
| 4fkx_A | 161 | NDK B, nucleoside diphosphate kinase; structural g | 100.0 | |
| 3l7u_A | 172 | Nucleoside diphosphate kinase A; ATP-binding, nucl | 100.0 | |
| 3b54_A | 161 | NDK, NDP kinase, nucleoside diphosphate kinase; al | 100.0 | |
| 3mpd_A | 151 | Nucleoside diphosphate kinase; ssgcid, NIH, niaid, | 100.0 | |
| 3evo_A | 146 | NDP kinase, NDK, nucleoside diphosphate kinase; ph | 100.0 | |
| 3q8u_A | 157 | Nucleoside diphosphate kinase; ferridoxin fold, al | 100.0 | |
| 1wkj_A | 137 | Nucleoside diphosphate kinase; thermus thermophilu | 100.0 | |
| 1xiq_A | 157 | Nucleoside diphosphate kinase B; protein structure | 99.98 | |
| 3fkb_A | 155 | NDP kinase, NDK, nucleoside diphosphate kinase, cy | 99.98 | |
| 1k44_A | 136 | Nucleoside diphosphate kinase; nucleoside triphosp | 99.98 | |
| 2hur_A | 142 | NDK, nucleoside diphosphate kinase, NDP kinase; ty | 99.98 | |
| 3r9l_A | 155 | Nucleoside diphosphate kinase; structural genomics | 99.98 | |
| 1nhk_R | 144 | Nucleoside diphosphate kinase; phosphotransferase; | 99.98 | |
| 2vu5_A | 148 | Nucleoside diphosphate kinase; nucleotide-binding, | 99.98 | |
| 1s57_A | 153 | Nucleoside diphosphate kinase II; transferase; HET | 99.98 | |
| 3bbb_A | 151 | Nucleoside diphosphate kinase B; transcription fac | 99.98 | |
| 1pku_A | 150 | Nucleoside diphosphate kinase I; RICE, transferase | 99.98 | |
| 2az3_A | 164 | Nucleoside diphosphate kinase; halophilic, transfe | 99.97 | |
| 1u8w_A | 149 | Nucleoside diphosphate kinase I; nucleotide diphos | 99.97 | |
| 2dxe_A | 160 | Nucleoside diphosphate kinase; nucleoside binding, | 99.97 | |
| 1nb2_A | 150 | Nucleoside diphosphate kinase; bacillus halodenitr | 99.97 | |
| 3ztp_A | 142 | Nucleoside diphosphate kinase; transferase; HET: G | 99.97 | |
| 1ehw_A | 162 | NDPK H4, nucleoside diphosphate kinase; NM23, mito | 99.97 | |
| 3js9_A | 156 | Nucleoside diphosphate kinase family protein; niai | 99.97 | |
| 1w7w_A | 182 | Nucleoside diphosphate kinase; NDPK3, transferase; | 99.97 | |
| 4dz6_A | 190 | Nucleoside diphosphate kinase; ssgcid, niaid, vana | 99.97 | |
| 1xqi_A | 195 | Nucleoside diphosphate kinase; alpha/beta sandwich | 99.96 | |
| 3bh7_B | 352 | Protein XRP2; protein-protein complex, GTPase acti | 99.82 | |
| 4hr2_A | 145 | Nucleoside diphosphate kinase; ssgcid, seattle str | 99.46 | |
| 1k44_A | 136 | Nucleoside diphosphate kinase; nucleoside triphosp | 99.45 | |
| 3mpd_A | 151 | Nucleoside diphosphate kinase; ssgcid, NIH, niaid, | 99.45 | |
| 3evo_A | 146 | NDP kinase, NDK, nucleoside diphosphate kinase; ph | 99.45 | |
| 3ztp_A | 142 | Nucleoside diphosphate kinase; transferase; HET: G | 99.44 | |
| 1wkj_A | 137 | Nucleoside diphosphate kinase; thermus thermophilu | 99.44 | |
| 2hur_A | 142 | NDK, nucleoside diphosphate kinase, NDP kinase; ty | 99.44 | |
| 1nhk_R | 144 | Nucleoside diphosphate kinase; phosphotransferase; | 99.44 | |
| 4fkx_A | 161 | NDK B, nucleoside diphosphate kinase; structural g | 99.44 | |
| 3js9_A | 156 | Nucleoside diphosphate kinase family protein; niai | 99.44 | |
| 3fkb_A | 155 | NDP kinase, NDK, nucleoside diphosphate kinase, cy | 99.44 | |
| 2vu5_A | 148 | Nucleoside diphosphate kinase; nucleotide-binding, | 99.43 | |
| 3q8u_A | 157 | Nucleoside diphosphate kinase; ferridoxin fold, al | 99.43 | |
| 1s57_A | 153 | Nucleoside diphosphate kinase II; transferase; HET | 99.42 | |
| 1pku_A | 150 | Nucleoside diphosphate kinase I; RICE, transferase | 99.42 | |
| 1u8w_A | 149 | Nucleoside diphosphate kinase I; nucleotide diphos | 99.42 | |
| 2az3_A | 164 | Nucleoside diphosphate kinase; halophilic, transfe | 99.41 | |
| 3bbb_A | 151 | Nucleoside diphosphate kinase B; transcription fac | 99.41 | |
| 1xiq_A | 157 | Nucleoside diphosphate kinase B; protein structure | 99.41 | |
| 2dxe_A | 160 | Nucleoside diphosphate kinase; nucleoside binding, | 99.41 | |
| 1ehw_A | 162 | NDPK H4, nucleoside diphosphate kinase; NM23, mito | 99.4 | |
| 1nb2_A | 150 | Nucleoside diphosphate kinase; bacillus halodenitr | 99.4 | |
| 1zs6_A | 169 | Nucleoside diphosphate kinase 3; nucleotide metabo | 99.4 | |
| 3l7u_A | 172 | Nucleoside diphosphate kinase A; ATP-binding, nucl | 99.4 | |
| 3b54_A | 161 | NDK, NDP kinase, nucleoside diphosphate kinase; al | 99.39 | |
| 1w7w_A | 182 | Nucleoside diphosphate kinase; NDPK3, transferase; | 99.37 | |
| 3r9l_A | 155 | Nucleoside diphosphate kinase; structural genomics | 99.37 | |
| 4dz6_A | 190 | Nucleoside diphosphate kinase; ssgcid, niaid, vana | 99.25 | |
| 1xqi_A | 195 | Nucleoside diphosphate kinase; alpha/beta sandwich | 99.09 | |
| 3bh7_B | 352 | Protein XRP2; protein-protein complex, GTPase acti | 98.69 | |
| 1wr1_B | 58 | Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu | 89.43 | |
| 2jy5_A | 52 | Ubiquilin-1; UBA, alternative splicing, cytoplasm, | 89.41 | |
| 2knz_A | 53 | Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc | 87.66 | |
| 2bwb_A | 46 | Ubiquitin-like protein DSK2; UBA, signaling protei | 83.08 |
| >1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 | Back alignment and structure |
|---|
Probab=100.00 E-value=9.9e-36 Score=241.96 Aligned_cols=117 Identities=37% Similarity=0.535 Sum_probs=95.6
Q ss_pred ChhHHHHHHHHHHHHhhcCccceEEEEEcCccccCCchHHHHHHHHHcCcEEEEeehhhhhhhh---hhhhhhhccCCCC
Q psy3715 1 MICTVLHLLYIVIHKIMAEPKERTFLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWVSFCV---SFLEKKSACCRMV 77 (179)
Q Consensus 1 ~~~~~~~~~~~~~~~~~~~~~erTl~~IKPD~~~~g~~g~Ii~~~~~~G~kiv~~K~~~~s~~~---hY~ehkdk~~~Ff 77 (179)
||||+++++.--.-.++....||||++||||++++|++|+||++|+.+||+|+++|+.+++.++ ||++|++| |||
T Consensus 1 ~~~~~~~~~~~~~~~~~~~~~erTl~iIKPDav~~~l~GeIi~rie~~Gf~Iv~~k~~~ls~e~a~~fY~~h~~k--pff 78 (169)
T 1zs6_A 1 MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRER--PFY 78 (169)
T ss_dssp -----------------CGGGCEEEEEECHHHHHTTCHHHHHHHHHHHTCEEEEEEEECCCHHHHHHHTGGGTTS--TTH
T ss_pred ChhhHHhHhccCcchhhhhhhccEEEEEChhhhhcccHHHHHHHHHHCCCEEEEEEEecCCHHHHHHHHHHHcCC--Cch
Confidence 7899999887655555667789999999999999999999999999999999999999888665 99999999 999
Q ss_pred CCchhhhhhCceE--------EEeeehhhccCCCCCCCCCCceeeecccc
Q psy3715 78 SSVPAYEISGKLL--------VGITYSTVLGHLNLETSECPLFHIDYELF 119 (179)
Q Consensus 78 ~~l~~~m~sgPvl--------aV~~~R~mlG~TnP~~A~pGTIRgdF~~~ 119 (179)
++|++||+|||++ ||++||.|+|+|||.+|.||||||||+.+
T Consensus 79 ~~Lv~~mtSGPvvamvleg~~aV~~~R~l~G~t~p~~A~pgtIR~~fg~~ 128 (169)
T 1zs6_A 79 GRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIE 128 (169)
T ss_dssp HHHHHHHTSSCEEEEEEESTTHHHHHHHHHCCSSGGGSCTTSHHHHHCCS
T ss_pred HHHHHHhcCCCEEEEEEecCCchHHHHHHhCCCCcccCCCCChHHHHcCC
Confidence 9999999999999 89999999999999999999999999874
|
| >4hr2_A Nucleoside diphosphate kinase; ssgcid, seattle structural genomics center for infectious DI niaid; HET: ADP; 1.95A {Burkholderia thailandensis} PDB: 4dut_A* 4ek2_A* | Back alignment and structure |
|---|
| >4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* | Back alignment and structure |
|---|
| >3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} SCOP: d.58.6.0 | Back alignment and structure |
|---|
| >3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} SCOP: d.58.6.1 PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... | Back alignment and structure |
|---|
| >3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* | Back alignment and structure |
|---|
| >1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* | Back alignment and structure |
|---|
| >1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} SCOP: d.58.6.1 PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... | Back alignment and structure |
|---|
| >1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} | Back alignment and structure |
|---|
| >3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A | Back alignment and structure |
|---|
| >2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* | Back alignment and structure |
|---|
| >3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* | Back alignment and structure |
|---|
| >1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A | Back alignment and structure |
|---|
| >1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* | Back alignment and structure |
|---|
| >1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A | Back alignment and structure |
|---|
| >1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} SCOP: d.58.6.0 | Back alignment and structure |
|---|
| >1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* | Back alignment and structure |
|---|
| >1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >3bh7_B Protein XRP2; protein-protein complex, GTPase activating protein and GTPase, retinitis pigmentosa, GTP-binding, lipoprotein, myristate; HET: GDP; 1.90A {Homo sapiens} PDB: 3bh6_B* 2bx6_A | Back alignment and structure |
|---|
| >4hr2_A Nucleoside diphosphate kinase; ssgcid, seattle structural genomics center for infectious DI niaid; HET: ADP; 1.95A {Burkholderia thailandensis} PDB: 4dut_A* 4ek2_A* | Back alignment and structure |
|---|
| >1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} SCOP: d.58.6.0 | Back alignment and structure |
|---|
| >3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} SCOP: d.58.6.1 PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... | Back alignment and structure |
|---|
| >3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A | Back alignment and structure |
|---|
| >1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* | Back alignment and structure |
|---|
| >2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} | Back alignment and structure |
|---|
| >1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A | Back alignment and structure |
|---|
| >4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* | Back alignment and structure |
|---|
| >3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} SCOP: d.58.6.0 | Back alignment and structure |
|---|
| >3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} SCOP: d.58.6.1 PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... | Back alignment and structure |
|---|
| >2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* | Back alignment and structure |
|---|
| >1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* | Back alignment and structure |
|---|
| >1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A | Back alignment and structure |
|---|
| >3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* | Back alignment and structure |
|---|
| >1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* | Back alignment and structure |
|---|
| >1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* | Back alignment and structure |
|---|
| >1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >3bh7_B Protein XRP2; protein-protein complex, GTPase activating protein and GTPase, retinitis pigmentosa, GTP-binding, lipoprotein, myristate; HET: GDP; 1.90A {Homo sapiens} PDB: 3bh6_B* 2bx6_A | Back alignment and structure |
|---|
| >1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B | Back alignment and structure |
|---|
| >2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 179 | ||||
| d2dyaa1 | 153 | d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, | 2e-19 | |
| d3bbba1 | 150 | d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, | 4e-19 | |
| d1xqia1 | 182 | d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, | 6e-19 | |
| d1xqia1 | 182 | d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, | 6e-06 | |
| d1hlwa_ | 150 | d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { | 9e-19 | |
| d1s57a_ | 153 | d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { | 1e-18 | |
| d1nb2a_ | 149 | d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { | 1e-18 | |
| d1xiqa_ | 149 | d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { | 3e-18 | |
| d1zs6a1 | 152 | d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, | 3e-18 | |
| d1zs6a1 | 152 | d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, | 3e-04 | |
| d1k44a_ | 135 | d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { | 4e-18 | |
| d1w7wa_ | 151 | d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { | 4e-18 | |
| d1nhkl_ | 143 | d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK { | 9e-18 | |
| d1nhkl_ | 143 | d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK { | 0.001 | |
| d1wkja1 | 137 | d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, | 1e-17 | |
| d1wkja1 | 137 | d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, | 0.003 | |
| d2az3a1 | 152 | d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, | 2e-17 | |
| d1u8wa_ | 149 | d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { | 5e-17 | |
| d1ehwa_ | 143 | d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { | 1e-16 | |
| d2b8qa1 | 128 | d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, | 1e-15 |
| >d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 153 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: Nucleoside diphosphate kinase, NDK family: Nucleoside diphosphate kinase, NDK domain: Nucleoside diphosphate kinase, NDK species: Archaeon Pyrococcus horikoshii [TaxId: 53953]
Score = 78.2 bits (192), Expect = 2e-19
Identities = 28/105 (26%), Positives = 44/105 (41%), Gaps = 9/105 (8%)
Query: 21 KERTFLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWVS--FCVSFLEK-------KS 71
ERT ++IKPD V RGL+G II RFE KG K+V MK +W+ E+ K+
Sbjct: 2 TERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIWIDRELAEKHYEEHREKPFFKA 61
Query: 72 ACCRMVSSVPAYEISGKLLVGITYSTVLGHLNLETSECPLFHIDY 116
+ + + + G + + + D+
Sbjct: 62 LIDYITKTPVVVMVLEGRYAVEVVRKMAGATDPKDAAPGTIRGDF 106
|
| >d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} Length = 150 | Back information, alignment and structure |
|---|
| >d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 182 | Back information, alignment and structure |
|---|
| >d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 182 | Back information, alignment and structure |
|---|
| >d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} Length = 150 | Back information, alignment and structure |
|---|
| >d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} Length = 153 | Back information, alignment and structure |
|---|
| >d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} Length = 149 | Back information, alignment and structure |
|---|
| >d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 149 | Back information, alignment and structure |
|---|
| >d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
| >d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
| >d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} Length = 135 | Back information, alignment and structure |
|---|
| >d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} Length = 151 | Back information, alignment and structure |
|---|
| >d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} Length = 143 | Back information, alignment and structure |
|---|
| >d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} Length = 143 | Back information, alignment and structure |
|---|
| >d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} Length = 137 | Back information, alignment and structure |
|---|
| >d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} Length = 137 | Back information, alignment and structure |
|---|
| >d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} Length = 152 | Back information, alignment and structure |
|---|
| >d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 149 | Back information, alignment and structure |
|---|
| >d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} Length = 143 | Back information, alignment and structure |
|---|
| >d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} Length = 128 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 179 | |||
| d1xqia1 | 182 | Nucleoside diphosphate kinase, NDK {Archaeon Pyrob | 99.97 | |
| d1zs6a1 | 152 | Nucleoside diphosphate kinase, NDK {Human(Homo sap | 99.97 | |
| d3bbba1 | 150 | Nucleoside diphosphate kinase, NDK {Human (Homo sa | 99.97 | |
| d1nb2a_ | 149 | Nucleoside diphosphate kinase, NDK {Bacillus halod | 99.97 | |
| d1s57a_ | 153 | Nucleoside diphosphate kinase, NDK {Thale cress (A | 99.97 | |
| d1ehwa_ | 143 | Nucleoside diphosphate kinase, NDK {Human (Homo sa | 99.97 | |
| d1w7wa_ | 151 | Nucleoside diphosphate kinase, NDK {Pea (Pisum sat | 99.97 | |
| d1hlwa_ | 150 | Nucleoside diphosphate kinase, NDK {Dictyostelium | 99.97 | |
| d1xiqa_ | 149 | Nucleoside diphosphate kinase, NDK {Plasmodium fal | 99.97 | |
| d2az3a1 | 152 | Nucleoside diphosphate kinase, NDK {Archaeon Halob | 99.97 | |
| d1u8wa_ | 149 | Nucleoside diphosphate kinase, NDK {Thale cress (A | 99.97 | |
| d1nhkl_ | 143 | Nucleoside diphosphate kinase, NDK {Myxococcus xan | 99.97 | |
| d1wkja1 | 137 | Nucleoside diphosphate kinase, NDK {Thermus thermo | 99.97 | |
| d2dyaa1 | 153 | Nucleoside diphosphate kinase, NDK {Archaeon Pyroc | 99.96 | |
| d1k44a_ | 135 | Nucleoside diphosphate kinase, NDK {Mycobacterium | 99.96 | |
| d2b8qa1 | 128 | Nucleoside diphosphate kinase, NDK {Mimivirus [Tax | 99.94 | |
| d1ehwa_ | 143 | Nucleoside diphosphate kinase, NDK {Human (Homo sa | 99.34 | |
| d1k44a_ | 135 | Nucleoside diphosphate kinase, NDK {Mycobacterium | 99.33 | |
| d1s57a_ | 153 | Nucleoside diphosphate kinase, NDK {Thale cress (A | 99.33 | |
| d1wkja1 | 137 | Nucleoside diphosphate kinase, NDK {Thermus thermo | 99.32 | |
| d1nhkl_ | 143 | Nucleoside diphosphate kinase, NDK {Myxococcus xan | 99.32 | |
| d1zs6a1 | 152 | Nucleoside diphosphate kinase, NDK {Human(Homo sap | 99.32 | |
| d2az3a1 | 152 | Nucleoside diphosphate kinase, NDK {Archaeon Halob | 99.31 | |
| d1xiqa_ | 149 | Nucleoside diphosphate kinase, NDK {Plasmodium fal | 99.31 | |
| d1w7wa_ | 151 | Nucleoside diphosphate kinase, NDK {Pea (Pisum sat | 99.3 | |
| d1hlwa_ | 150 | Nucleoside diphosphate kinase, NDK {Dictyostelium | 99.3 | |
| d2dyaa1 | 153 | Nucleoside diphosphate kinase, NDK {Archaeon Pyroc | 99.3 | |
| d3bbba1 | 150 | Nucleoside diphosphate kinase, NDK {Human (Homo sa | 99.3 | |
| d1u8wa_ | 149 | Nucleoside diphosphate kinase, NDK {Thale cress (A | 99.29 | |
| d1nb2a_ | 149 | Nucleoside diphosphate kinase, NDK {Bacillus halod | 99.28 | |
| d2b8qa1 | 128 | Nucleoside diphosphate kinase, NDK {Mimivirus [Tax | 99.28 | |
| d1xqia1 | 182 | Nucleoside diphosphate kinase, NDK {Archaeon Pyrob | 99.17 |
| >d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: Nucleoside diphosphate kinase, NDK family: Nucleoside diphosphate kinase, NDK domain: Nucleoside diphosphate kinase, NDK species: Archaeon Pyrobaculum aerophilum [TaxId: 13773]
Probab=99.97 E-value=6.5e-34 Score=231.32 Aligned_cols=99 Identities=29% Similarity=0.416 Sum_probs=93.4
Q ss_pred ccceEEEEEcCccccCCchHHHHHHHHHcCcEEEEeehhhhhhhh---hhhhhhh-------------------------
Q psy3715 20 PKERTFLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWVSFCV---SFLEKKS------------------------- 71 (179)
Q Consensus 20 ~~erTl~~IKPD~~~~g~~g~Ii~~~~~~G~kiv~~K~~~~s~~~---hY~ehkd------------------------- 71 (179)
|.||||++|||||++++++|+||++|+.+||+|+++|+.+++.++ ||.+|++
T Consensus 1 p~ErTl~iIKPDav~~~lvg~Ii~~ie~~Gf~Iva~k~~~lt~e~a~~fY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 80 (182)
T d1xqia1 1 PVEKTLLILKPDAVARGLVDEIISRFKKAGLKIVALKMVKASPEEIERFYPSSEEWLQSAGQKLLKAYQELGIDPRAKIG 80 (182)
T ss_dssp CCCEEEEEECHHHHHTTCHHHHHHHHHHHTCEEEEEEEECCCHHHHHHHSCCCHHHHHHHHHHHHHHHHHHTCCHHHHHS
T ss_pred CCceEEEEECcchhccCCHHHHHHHHHHCCCEEEEEeeecCCHHHHHHHHHHHHHHhhhhhhhhhhhhhhhccccccccc
Confidence 689999999999999999999999999999999999998888877 9999874
Q ss_pred --------ccCCCCCCchhhhhhCceE--------EEeeehhhccCCCCCCCCCCceeeeccccc
Q psy3715 72 --------ACCRMVSSVPAYEISGKLL--------VGITYSTVLGHLNLETSECPLFHIDYELFP 120 (179)
Q Consensus 72 --------k~~~Ff~~l~~~m~sgPvl--------aV~~~R~mlG~TnP~~A~pGTIRgdF~~~~ 120 (179)
| |||++|++||+|||++ ||++||.|+|||||.+|.||||||+|+.+.
T Consensus 81 ~~~~~~~gk--~f~~~Lv~~mtSgPvva~vleg~~aV~~~R~l~GptdP~~A~pgtIR~~fg~d~ 143 (182)
T d1xqia1 81 TDDPVEVGR--IIKRNLVKYMTSGPNVVMVLKGNRAVEIVRKLVGPTSPHSAPPGTIRGDYSIDS 143 (182)
T ss_dssp CCCHHHHHH--HHHHHHHHHHTSSCEEEEEEESTTHHHHHHHHHCCSCGGGSCTTSHHHHHCCCC
T ss_pred cccccccCC--cchHHHHHHHhcCceEEEEecccCHHHHHHHHhCCCCcccCCCCccHHhhCcCc
Confidence 5 8999999999999999 899999999999999999999999998754
|
| >d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} | Back information, alignment and structure |
|---|
| >d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} | Back information, alignment and structure |
|---|
| >d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} | Back information, alignment and structure |
|---|
| >d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} | Back information, alignment and structure |
|---|
| >d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} | Back information, alignment and structure |
|---|
| >d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} | Back information, alignment and structure |
|---|
| >d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|