Psyllid ID: psy3751

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------
MNNFKNDIFYKNNLNNLYLDWLESEAIHIMREVSAECNNPVLLFSGGKDSVVLLRLAEKAFRPSRFPFPMVHIDTGHNFPEVISFRDNCISKLGETLIVRSVEDSIMKGTVRLRKPNTDSRNAAQSITLLETIKEFKFDACIGGARRDEEKARAKERIFSFRDKFGQWNPKSQRPELWNLYNTRVHPGENIRVFPISNWTELDIWQYIEREKIILPSLYFAHKRKIIKRKGLLIPFTNLTPAHPGEIIENLMVRFRTVGDILCTCPILSNATTVEDIIKEISVTQITERGATRIDDQNSEASMEKRKKTEAPEKKQSVFKKHSLLRFITAGSVDDGKSTLIGRLLFDSKNIFIDQLDAVSRTKYKRVMSGHNIDLSLLTDGLESEREQGITIDVAYRYFNTPKRKFIIADTPGHEQYTRNMITGASTADAVIILIDASKIKFNPSVNLLTQTKRHSIIAHLLRIKHIIIAVNKMDLINYNQIFYKRIVYAYKKFAEDIHFQNINTIPISALNGDNIISASNNMLWYNGPTLISLLESLNTNEKIDKKPLRFPVQLVARHCGHISKDFRGYMGRIESGIIKKNDCLIVEPSGKKATIKDIQMLNKSLDMAITGQSVTLIIKEYLDISRGNMLVSPFKRPVSLRSINANLCWLSEESLDLRRKYLLKHSTNQILSRILKINALLNINTQKWCPPKLLDLNDIGCVTINIYEPISVDSYDNIRSTGSFILIDEITFQTVAAVYIIGAGPGAADLITVRGARLLRKADVVLYDALITNELLMLCPKAKHIFVGKRFKKHSIAQYIINRIIVKCAFKYNLVVRLKGGDPMLFGRTDEELNALKKYNIKVKVIPGITAALAAASESKQSLTKRNISRSVVLFTSSTMLKNNYLKNIPISDTLVEYMGGNNIFLTAKKLLKLGFLPTTPVIVVENCSLSNQKITRLILLDLKKKIFQFEKPVLFMIGKSLKSHY
ccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHcccccccccEEEccccccHHHHHHHHHHHHHHcccEEEEEEccccccccEEEEccccccccccHHHHHHHHHHHHccccEEEccccccHHHHHccccccccccccccccccccccccccccccccccccEEEEEEcccccHHHHHHHHHHcccccccccccccccEEEEccEEEEccccccccccccEEEEEEEEEEEcccccccccccccccHHHHHHHHHHHHHcccccccccccccHHHHHHccccccHHHHHHcccccccEEEEEcccccccHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccHHHHccccHHHHcccccEEEEccccccccccEEEcccccccccccccccccccccEEEEEEEcccccccccccccccccHHHHHHHHHcccEEEEEEEccccccccHHHHHHHHHHHHHHHHHccccccEEEEccccccccccccccccccccccHHHHHHcccccccccccccccccEEEEEccccccccccccccEEEcccEEccccEEEEcccccEEEEEEEEcccccccccccccEEEEEEccccccccccEEcccccccccccEEEEEEEEccccccccccEEEEEEEcEEEEEEEEcccEEEEccccccccccccccccEEEEEEEccccccccccccccccccEEEEEcccccEEEEEEEccccccccccHHHHHHHHHccccccccccEEEEccccccccHHHHHHHHHHHHccccEEEEccccHHccccccccEEEcccccccccccHHHHHHHHHcccEEEEEccHHHHHHHHccccHHHHHHHHccEEEEEEccccccccccccccccccHHHHccccEEEEEHHHHHHccccccccEEEEEccccccccHHHHHHHHcccccccccccEEEEEcccccccc
cccccccHHccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHcccccccccEEEEccccccHHEEEEHHHHHHHHcccEEEEEcccccccccccccccccccHHHHHHHHHHHHHHcccccHEccccccHHHHHHHHHHEEEcccccccccccccccHHHHHHccccccccEEEEEEccccHHHHHHHHHHHcccccccHHHHHccEEEEccccEEEccccccccccHHHEccEEEEEEcccccccccEEEEEcccccccccccccccccccccccccHHHHHHHHHHccccccccHcccccccEEEEEEEEEEccccccccccEEEEEccccHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccEEEEcccEEEEEEEccccccHHHHHHHccccccEEEEEEEccHHHHHHHcccccHHHHHHHHHHHccccEEEEEEEcHHHHcccHHHHHHHHHHHHHHHHHHccccccEEEEccccccccccccccccccccHHHHHHHHHcccccccccccccccHHHEEEEccccccccEEccEEEEcEEEcccEEEEEcccccEEEEEEEHHcHHHHHcccccccccEEEccHHHHHccccccccccccHHcccccEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHccccccccccEEccccEEEEEEccccccEEcccccccccccEEHHccHHEEEEEEEEEEEcccccccHHHHHHHHHHccccEEEHHHHHHHHHHHHcccccEEEEcHHcHHHHHHHHHHHHHHHHHHHHEEEEEEEcccccccccccHHHHHHHHHHccEEEEccHHHHHHHHHHHcHccccccccccEEEEEEcHHHHHHcHHccccccHHHHHHHcccHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHHHHHHHHccccEEEEEccccHccc
mnnfkndifykNNLNNLYLDWLESEAIHIMREVSaecnnpvllfsggkDSVVLLRLAEkafrpsrfpfpmvhidtghnfpeviSFRDNCISKLGETLIVRSVEDSIMKGTvrlrkpntdsrnAAQSITLLETIKEfkfdaciggarRDEEKARAKERIFSFRdkfgqwnpksqrpelwnlyntrvhpgenirvfpisnwtelDIWQYIEREKIILPSLYFAHKRKIIKRkgllipftnltpahpgeIIENLMVRFRTVgdilctcpilsnattVEDIIKEISVTQitergatriddqnseaSMEKRkkteapekkqsVFKKHSLLRFitagsvddgksTLIGRLlfdsknifidQLDAVSRTKYKRvmsghnidlslltdglesereqGITIDVAYRYfntpkrkfiiadtpgheqytrnmitgasTADAVIILIDaskikfnpsvnlltqTKRHSIIAHLLRIKHIIIAVNKMDLINYNQIFYKRIVYAYKKFAEdihfqnintipisalngdniisasnnmlwyngPTLISLLESLntnekidkkplrfpVQLVARHCGHISKDFRGYmgriesgiikkndclivepsgkkatIKDIQMLNKSLDMAITGQSVTLIIKEYLdisrgnmlvspfkrpvslRSINANLCWLSEESLDLRRKYLLKHSTNQILSRILKINALLNintqkwcppklldlndigcvtiniyepisvdsydnirstgSFILIDEITFQTVAAVYIIGAGPGAADLITVRGARLLRKADVVLYDALITNELLMlcpkakhifvgkrfkkhSIAQYIINRIIVKCAFKYNLVVRlkggdpmlfgrtDEELNALKKYNIKVKVIPGITAALAAASESKqsltkrnisRSVVLFTSStmlknnylknipisdTLVEYMGGNNIFLTAKKLLklgflpttpvivvencslsnqKITRLILLDLKKKIFQFEKPVLFMIGKSLKSHY
MNNFKNDIFYKNNLNNLYLDWLESEAIHIMREVSAECNNPVLLFSGGKDSVVLLRLAEKAFRPSRFPFPMVHIDTGHNFPEVISFRDNCISKLGETLivrsvedsimkgtvrlrkpntdsrnaAQSITLletikefkfdaciggarRDEEKARAKERIfsfrdkfgqwnpksqrpeLWNLYntrvhpgenirvfpisNWTELDIWQYIEREKIILPSLYFAHKRKIIKRKGLLIPFTNLTPAHPGEIIENLMVRFRTVGDILCTCPILSNATTVEDIIKEIsvtqitergatriddqnseasmekrkkteapekkqsvfkkhsllrfitagsvddgkSTLIGRLLfdsknifiDQLDAVSRTKYKRVMSGHNIDLSLLTDGLESEREQGITIDVAYRYFNTPKRKFIIADTPGHEQYTRNMITGASTADAVIILIDASKIKFNPSVNLLTQTKRHSIIAHLLRIKHIIIAVNKMDLINYNQIFYKRIVYAYKKFAEDIHFQNINTIPISALNGDNIISASNNMLWYNGPTLISLLESLNTNEKIDKKPLRFPVQLVARHCGHISKDFRGYMGRIESgiikkndclivepsgkKATIKDIQMLNKSLDMAITGQSVTLIIKEYLDISRGNMLVSPFKRPVSLRSINANLCWLSEESLDLRRKYLLKHSTNQILSRILKINALLNINTQKWCPPKLLDLNDIGCVTINIYepisvdsydNIRSTGSFILIDEITFQTVAAVYIIGAGPGAADLITVRGARLLRKADVVLYDALITNELLMLCPKAKHIFVGKRFKKHSIAQYIINRIIVKCAFKYNLVVRLKGGDPMLFGRTDEELNALKKYNIKVKVIPGITAALAAAseskqsltkrnisrSVVLftsstmlknnyLKNIPISDTLVEYMGGNNIFLTAKKLLKLGFLPTTPVIVvencslsnqKITRLILLDLKKKIFQFEKPVLFMIGKSLKSHY
MNNFKNDIFYKNNLNNLYLDWLESEAIHIMREVSAECNNPVLLFSGGKDSVVLLRLAEKAFRPSRFPFPMVHIDTGHNFPEVISFRDNCISKLGETLIVRSVEDSIMKGTVRLRKPNTDSRNAAQSITLLETIKEFKFDACIGGarrdeekarakerIFSFRDKFGQWNPKSQRPELWNLYNTRVHPGENIRVFPISNWTELDIWQYIEREKIILPSLYFAHkrkiikrkGLLIPFTNLTPAHPGEIIENLMVRFRTVGDILCTCPILSNATTVEDIIKEISVTQITERGATRIDDQNSEASMEKRKKTEAPEKKQSVFKKHSLLRFITAGSVDDGKSTLIGRLLFDSKNIFIDQLDAVSRTKYKRVMSGHNIDLSLLTDGLESEREQGITIDVAYRYFNTPKRKFIIADTPGHEQYTRNMITGASTADAVIILIDASKIKFNPSVNLLTQTKRHSIIAHLLRIKHIIIAVNKMDLINYNQIFYKRIVYAYKKFAEDIHFQNINTIPISALNGDNIISASNNMLWYNGPTLISLLESLNTNEKIDKKPLRFPVQLVARHCGHISKDFRGYMGRIESGIIKKNDCLIVEPSGKKATIKDIQMLNKSLDMAITGQSVTLIIKEYLDISRGNMLVSPFKRPVSLRSINANLCWLSEESLDLRRKYLLKHSTNQILSRILKINALLNINTQKWCPPKLLDLNDIGCVTINIYEPISVDSYDNIRSTGSFILIDEITFQTVAAVYIIGAGPGAADLITVRGARLLRKADVVLYDALITNELLMLCPKAKHIFVGKRFKKHSIAQYIINRIIVKCAFKYNLVVRLKGGDPMLFGRTDEELNALKKYNIKVKVIPGITAALAAASESKQSLTKRNISRSVVLFTSSTMLKNNYLKNIPISDTLVEYMGGNNIFLTAKKLLKLGFLPTTPVIVVENCSLSNQKITRLILLDLKKKIFQFEKPVLFMIGKSLKSHY
*****NDIFYKNNLNNLYLDWLESEAIHIMREVSAECNNPVLLFSGGKDSVVLLRLAEKAFRPSRFPFPMVHIDTGHNFPEVISFRDNCISKLGETLIVRSVEDSIMKGTV*************QSITLLETIKEFKFDACIGGA***********RIFSFRDKFGQWNPKSQRPELWNLYNTRVHPGENIRVFPISNWTELDIWQYIEREKIILPSLYFAHKRKIIKRKGLLIPFTNLTPAHPGEIIENLMVRFRTVGDILCTCPILSNATTVEDIIKEISVTQIT********************************KKHSLLRFITAGSVDDGKSTLIGRLLFDSKNIFIDQLDAVSRTKYKRVMSGHNIDLSLLTDGLESEREQGITIDVAYRYFNTPKRKFIIADTPGHEQYTRNMITGASTADAVIILIDASKIKFNPSVNLLTQTKRHSIIAHLLRIKHIIIAVNKMDLINYNQIFYKRIVYAYKKFAEDIHFQNINTIPISALNGDNIISASNNMLWYNGPTLISLLESLNTNEKIDKKPLRFPVQLVARHCGHISKDFRGYMGRIESGIIKKNDCLIVEPSGKKATIKDIQMLNKSLDMAITGQSVTLIIKEYLDISRGNMLVSPFKRPVSLRSINANLCWLSEESLDLRRKYLLKHSTNQILSRILKINALLNINTQKWCPPKLLDLNDIGCVTINIYEPISVDSYDNIRSTGSFILIDEITFQTVAAVYIIGAGPGAADLITVRGARLLRKADVVLYDALITNELLMLCPKAKHIFVGKRFKKHSIAQYIINRIIVKCAFKYNLVVRLKGGDPMLFGRTDEELNALKKYNIKVKVIPGITAALAA***********NISRSVVLFTSSTMLKNNYLKNIPISDTLVEYMGGNNIFLTAKKLLKLGFLPTTPVIVVENCSLSNQKITRLILLDLKKKIFQFEKPVLFMIG*******
*************LNNLYLDWLESEAIHIMREVSAECNNPVLLFSGGKDSVVLLRLAEKAFRPSRFPFPMVHIDTGHNFPEVISFRDNCISKLGETLIVRSVEDSIMKGTV**********NAAQSITLLETIKEFKFDACIGGARRDEEKARAKERIFSFRDKFGQWNPKSQRPELWNLYNTRVHPGENIRVFPISNWTELDIWQYIEREKIILPSLYFAHKRKIIKRKGLLIPFTNLTPAHPGEIIENLMVRFRTVGDILCTCPILSNATTVEDIIKEISVTQ*********************************FKKHSLLRFITAGSVDDGKSTLIGRLLFDSKNIFIDQLDAVSRT******SGHNIDLSLLTDGLESEREQGITIDVAYRYFNTPKRKFIIADTPGHEQYTRNMITGASTADAVIILIDASKIKFNPSVNLLTQTKRHSIIAHLLRIKHIIIAVNKMDLINYNQIFYKRIVYAYKKFAEDIHFQNINTIPISALNGDNIISASNNMLWYNGPTLISLLESLNTNEKIDKKPLRFPVQLVARHCGHISKDFRGYMGRIESGIIKKNDCLIVEPSGKKATIKDIQMLNKSLDMAITGQSVTLIIKEYLDISRGNMLVSPFKRPVSLRSINANLCWLSEESLDLRRKYLLKHSTNQILSRILKINALLNINTQKWCPPKLLDLNDIGCVTINIYEPISVDSYDNIRSTGSFILIDEITFQTVAAVYIIGAGPGA****************VVLYDALITNELLMLCPKAKHIFVGKRFKKHSIAQYIINRIIVKCAFKYNLVVRLKGGDPMLFGRTDEELNALKKYNIKVKVIPGITAALAAAS*************SVVLFTSSTMLKNNYLKNIPISDTLVEYMGGNNIFLTAKKLLKLGFLPTTPVIVVENCSLSNQKITRLILLDLKKKIFQFEKPVLFMIGKSL****
MNNFKNDIFYKNNLNNLYLDWLESEAIHIMREVSAECNNPVLLFSGGKDSVVLLRLAEKAFRPSRFPFPMVHIDTGHNFPEVISFRDNCISKLGETLIVRSVEDSIMKGTVRLRKPNTDSRNAAQSITLLETIKEFKFDACIGGARRDEEKARAKERIFSFRDKFGQWNPKSQRPELWNLYNTRVHPGENIRVFPISNWTELDIWQYIEREKIILPSLYFAHKRKIIKRKGLLIPFTNLTPAHPGEIIENLMVRFRTVGDILCTCPILSNATTVEDIIKEISVTQITERGATRID**********************VFKKHSLLRFITAGSVDDGKSTLIGRLLFDSKNIFIDQLDAVSRTKYKRVMSGHNIDLSLLTDGLESEREQGITIDVAYRYFNTPKRKFIIADTPGHEQYTRNMITGASTADAVIILIDASKIKFNPSVNLLTQTKRHSIIAHLLRIKHIIIAVNKMDLINYNQIFYKRIVYAYKKFAEDIHFQNINTIPISALNGDNIISASNNMLWYNGPTLISLLESLNTNEKIDKKPLRFPVQLVARHCGHISKDFRGYMGRIESGIIKKNDCLIVEPSGKKATIKDIQMLNKSLDMAITGQSVTLIIKEYLDISRGNMLVSPFKRPVSLRSINANLCWLSEESLDLRRKYLLKHSTNQILSRILKINALLNINTQKWCPPKLLDLNDIGCVTINIYEPISVDSYDNIRSTGSFILIDEITFQTVAAVYIIGAGPGAADLITVRGARLLRKADVVLYDALITNELLMLCPKAKHIFVGKRFKKHSIAQYIINRIIVKCAFKYNLVVRLKGGDPMLFGRTDEELNALKKYNIKVKVIPGITAALA***********RNISRSVVLFTSSTMLKNNYLKNIPISDTLVEYMGGNNIFLTAKKLLKLGFLPTTPVIVVENCSLSNQKITRLILLDLKKKIFQFEKPVLFMIGKSLKSHY
**NFKNDIFYKNNLNNLYLDWLESEAIHIMREVSAECNNPVLLFSGGKDSVVLLRLAEKAFRPSRFPFPMVHIDTGHNFPEVISFRDNCISKLGETLIVRSVEDSIMKGTVRLRKPNTDSRNAAQSITLLETIKEFKFDACIGGARRDEEKARAKERIFSFRDKFGQWNPKSQRPELWNLYNTRVHPGENIRVFPISNWTELDIWQYIEREKIILPSLYFAHKRKIIKRKGLLIPFTNLTPAHPGEIIENLMVRFRTVGDILCTCPILSNATTVEDI*****************************************FKKHSLLRFITAGSVDDGKSTLIGRLLFDSKNIFIDQLDAVSRTKYKRVMSGHNIDLSLLTDGLESEREQGITIDVAYRYFNTPKRKFIIADTPGHEQYTRNMITGASTADAVIILIDASKIKFNPSVNLLTQTKRHSIIAHLLRIKHIIIAVNKMDLINYNQIFYKRIVYAYKKFAEDIHFQNINTIPISALNGDNIISASNNMLWYNGPTLISLLESLNTNEKIDKKPLRFPVQLVARHCGHISKDFRGYMGRIESGIIKKNDCLIVEPSGKKATIKDIQMLNKSLDMAITGQSVTLIIKEYLDISRGNMLVSPFKRPVSLRSINANLCWLSEESLDLRRKYLLKHSTNQILSRILKINALLNINTQKWCPPKLLDLNDIGCVTINIYEPISVDSYDNIRSTGSFILIDEITFQTVAAVYIIGAGPGAADLITVRG***LRKADVVLYDALITNELLMLCPKAKHIFVGKRFKKHSIAQYIINRIIVKCAFKYNLVVRLKGGDPMLFGRTDEELNALKKYNIKVKVIPGITAALAAASESKQSLTKRNISRSVVLFTSSTMLKNNYLKNIPISDTLVEYMGGNNIFLTAKKLLKLGFLPTTPVIVVENCSLSNQKITRLILLDLKKKIFQFEKPVLFMIGKSL****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNFKNDIFYKNNLNNLYLDWLESEAIHIMREVSAECNNPVLLFSGGKDSVVLLRLAEKAFRPSRFPFPMVHIDTGHNFPEVISFRDNCISKLGETLIVRSVEDSIMKGTVRLRKPNTDSRNAAQSITLLETIKEFKFDACIGGARRDEEKARAKERIFSFRDKFGQWNPKSQRPELWNLYNTRVHPGENIRVFPISNWTELDIWQYIEREKIILPSLYFAHKRKIIKRKGLLIPFTNLTPAHPGEIIENLMVRFRTVGDILCTCPILSNATTVEDIIKEISVTQITERGATRIDDQNSEASMEKRKKTEAPEKKQSVFKKHSLLRFITAGSVDDGKSTLIGRLLFDSKNIFIDQLDAVSRTKYKRVMSGHNIDLSLLTDGLESEREQGITIDVAYRYFNTPKRKFIIADTPGHEQYTRNMITGASTADAVIILIDASKIKFNPSVNLLTQTKRHSIIAHLLRIKHIIIAVNKMDLINYNQIFYKRIVYAYKKFAEDIHFQNINTIPISALNGDNIISASNNMLWYNGPTLISLLESLNTNEKIDKKPLRFPVQLVARHCGHISKDFRGYMGRIESGIIKKNDCLIVEPSGKKATIKDIQMLNKSLDMAITGQSVTLIIKEYLDISRGNMLVSPFKRPVSLRSINANLCWLSEESLDLRRKYLLKHSTNQILSRILKINALLNINTQKWCPPKLLDLNDIGCVTINIYEPISVDSYDNIRSTGSFILIDEITFQTVAAVYIIGAGPGAADLITVRGARLLRKADVVLYDALITNELLMLCPKAKHIFVGKRFKKHSIAQYIINRIIVKCAFKYNLVVRLKGGDPMLFGRTDEELNALKKYNIKVKVIPGITAALAAASESKQSLTKRNISRSVVLFTSSTMLKNNYLKNIPISDTLVEYMGGNNIFLTAKKLLKLGFLPTTPVIVVENCSLSNQKITRLILLDLKKKIFQFEKPVLFMIGKSLKSHY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query967 2.2.26 [Sep-21-2011]
P72339646 Bifunctional enzyme NodQ N/A N/A 0.426 0.637 0.498 1e-116
A0KP35475 Sulfate adenylyltransfera yes N/A 0.422 0.861 0.480 1e-110
A4SRG8471 Sulfate adenylyltransfera yes N/A 0.422 0.868 0.478 1e-110
A1ST27469 Sulfate adenylyltransfera yes N/A 0.434 0.895 0.469 1e-109
P13442641 Bifunctional enzyme NodQ yes N/A 0.452 0.683 0.447 1e-108
O07309633 Bifunctional enzyme NodQ N/A N/A 0.421 0.644 0.463 1e-108
B1KMH4469 Sulfate adenylyltransfera yes N/A 0.431 0.889 0.477 1e-108
Q482Z9466 Sulfate adenylyltransfera yes N/A 0.432 0.896 0.465 1e-106
O50274633 Bifunctional enzyme CysN/ yes N/A 0.432 0.660 0.459 1e-105
Q5LES3476 Sulfate adenylyltransfera yes N/A 0.426 0.865 0.470 1e-105
>sp|P72339|NODQ_RHIS3 Bifunctional enzyme NodQ OS=Rhizobium sp. (strain N33) GN=nodQ PE=3 SV=1 Back     alignment and function desciption
 Score =  419 bits (1077), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 211/423 (49%), Positives = 283/423 (66%), Gaps = 11/423 (2%)

Query: 320 KKHSLLRFITAGSVDDGKSTLIGRLLFDSKNIFIDQLDAVSRTKYKRVMSGHNIDLSLLT 379
           +K SLLRF+T GSVDDGKSTLIGRLL D+K IF DQL A+ R   K   +G +ID +LL 
Sbjct: 23  EKKSLLRFLTCGSVDDGKSTLIGRLLSDTKQIFEDQLAALERDSRKHGTTGDDIDFALLV 82

Query: 380 DGLESEREQGITIDVAYRYFNTPKRKFIIADTPGHEQYTRNMITGASTADAVIILIDASK 439
           DGLE+EREQGITIDVAYR+F TPKRKFI+ADTPGHEQYTRNM TGASTAD  I+LIDA +
Sbjct: 83  DGLEAEREQGITIDVAYRFFATPKRKFIVADTPGHEQYTRNMATGASTADLAIVLIDARQ 142

Query: 440 IKFNPSVNLLTQTKRHSIIAHLLRIKHIIIAVNKMDLINYNQIFYKRIVYAYKKFAEDIH 499
                   +L QT+RHSIIA LL I+HI++AVNK+DL+ ++Q  ++RI  +Y++F+ D+ 
Sbjct: 143 -------GVLRQTRRHSIIASLLGIRHIVLAVNKIDLVGFDQAVFERITESYRQFSRDLG 195

Query: 500 FQNINTIPISALNGDNIISASNNMLWYNGPTLISLLESLNTNEKIDKKPLRFPVQLVARH 559
           FQ I  IP+SA  GDN+ S S +M WY+GPTLI  LE+++  E + + P RFPVQ V R 
Sbjct: 196 FQTIVPIPMSARYGDNVTSRSESMEWYSGPTLIEHLETVSVEEAVVELPFRFPVQYVNRP 255

Query: 560 CGHISKDFRGYMGRIESGIIKKNDCLIVEPSGKKATIKDIQMLNKSLDMAITGQSVTLII 619
               + DFRG+ G + SG +   D ++V  SGK + +K I      L  A  GQ+VTL++
Sbjct: 256 ----NLDFRGFAGTVASGSVAPGDEVVVAKSGKSSRVKRIVSYGGDLAQAAAGQAVTLVL 311

Query: 620 KEYLDISRGNMLVSPFKRPVSLRSINANLCWLSEESLDLRRKYLLKHSTNQILSRILKIN 679
            + ++ISRGNMLVSP  RP       AN+ W  E +L   R Y+L+  T+Q  + +  + 
Sbjct: 312 DDEVEISRGNMLVSPAARPQVADQFAANIVWFDEHALLPGRSYILRTETDQTSATVTDLK 371

Query: 680 ALLNINTQKWCPPKLLDLNDIGCVTINIYEPISVDSYDNIRSTGSFILIDEITFQTVAAV 739
             +N+N       K L++N++G   I+   PI+ D++   R+TG+FILID IT  TV A 
Sbjct: 372 YRINVNDFAHEAAKSLEMNEVGICNISTRSPIAFDTFAENRTTGAFILIDRITNATVGAG 431

Query: 740 YII 742
            I+
Sbjct: 432 MIL 434
APS kinase catalyzes the synthesis of activated sulfate.
Rhizobium sp. (strain N33) (taxid: 103798)
EC: 2EC: .EC: 7EC: .EC: 1EC: .EC: 2EC: 5
>sp|A0KP35|CYSN_AERHH Sulfate adenylyltransferase subunit 1 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / NCIB 9240) GN=cysN PE=3 SV=1 Back     alignment and function description
>sp|A4SRG8|CYSN_AERS4 Sulfate adenylyltransferase subunit 1 OS=Aeromonas salmonicida (strain A449) GN=cysN PE=3 SV=1 Back     alignment and function description
>sp|A1ST27|CYSN_PSYIN Sulfate adenylyltransferase subunit 1 OS=Psychromonas ingrahamii (strain 37) GN=cysN PE=3 SV=1 Back     alignment and function description
>sp|P13442|NODQ_RHIME Bifunctional enzyme NodQ OS=Rhizobium meliloti (strain 1021) GN=nodQ PE=3 SV=1 Back     alignment and function description
>sp|O07309|NODQ_RHISB Bifunctional enzyme NodQ OS=Rhizobium sp. (strain BR816) GN=nodQ PE=3 SV=1 Back     alignment and function description
>sp|B1KMH4|CYSN_SHEWM Sulfate adenylyltransferase subunit 1 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=cysN PE=3 SV=1 Back     alignment and function description
>sp|Q482Z9|CYSN_COLP3 Sulfate adenylyltransferase subunit 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=cysN PE=3 SV=1 Back     alignment and function description
>sp|O50274|CYSNC_PSEAE Bifunctional enzyme CysN/CysC OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysNC PE=3 SV=1 Back     alignment and function description
>sp|Q5LES3|CYSN_BACFN Sulfate adenylyltransferase subunit 1 OS=Bacteroides fragilis (strain ATCC 25285 / NCTC 9343) GN=cysN PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query967
399017230445 sulfate adenylyltransferase, large subun 0.434 0.943 0.654 1e-164
198284802450 sulfate adenylyltransferase large subuni 0.438 0.942 0.641 1e-164
340788693451 sulfate adenylyltransferase subunit 1 [C 0.434 0.931 0.661 1e-164
152979899443 sulfate adenylyltransferase subunit 1 [J 0.433 0.945 0.658 1e-163
300312403443 sulfate adenylyltransferase [Herbaspiril 0.434 0.948 0.643 1e-163
409406833443 sulfate adenylyltransferase subunit 1 pr 0.434 0.948 0.638 1e-162
344200707450 sulfate adenylyltransferase large subuni 0.438 0.942 0.631 1e-160
134095573443 ATP-sulfurylase subunit 1 [Herminiimonas 0.433 0.945 0.646 1e-160
395761405438 sulfate adenylyltransferase subunit 1 [J 0.434 0.958 0.609 1e-154
445495656438 sulfate adenylyltransferase subunit 1 [J 0.443 0.979 0.607 1e-153
>gi|399017230|ref|ZP_10719428.1| sulfate adenylyltransferase, large subunit [Herbaspirillum sp. CF444] gi|398104134|gb|EJL94288.1| sulfate adenylyltransferase, large subunit [Herbaspirillum sp. CF444] Back     alignment and taxonomy information
 Score =  585 bits (1509), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 277/423 (65%), Positives = 342/423 (80%), Gaps = 3/423 (0%)

Query: 321 KHSLLRFITAGSVDDGKSTLIGRLLFDSKNIFIDQLDAVSRTKYKRVMSGHNIDLSLLTD 380
           +  LLRFITAGSVDDGKSTLIGRLLFDSK IF DQLDA+SR K+KR + G  IDLSLLTD
Sbjct: 20  ERGLLRFITAGSVDDGKSTLIGRLLFDSKGIFADQLDAISRAKHKRTV-GDTIDLSLLTD 78

Query: 381 GLESEREQGITIDVAYRYFNTPKRKFIIADTPGHEQYTRNMITGASTADAVIILIDASKI 440
           GLE+EREQGITIDVAYRYF TPKRKFIIADTPGHEQYTRNM+TGASTADAVIILID SK+
Sbjct: 79  GLEAEREQGITIDVAYRYFATPKRKFIIADTPGHEQYTRNMVTGASTADAVIILIDVSKV 138

Query: 441 KF--NPSVNLLTQTKRHSIIAHLLRIKHIIIAVNKMDLINYNQIFYKRIVYAYKKFAEDI 498
           K   + SV LLTQTKRHS IAHLL+I+H+++AVNKMDL+NY+Q  Y RIV AY++FA  +
Sbjct: 139 KLGDDGSVELLTQTKRHSTIAHLLQIQHVVVAVNKMDLVNYDQTVYDRIVGAYQEFAAQL 198

Query: 499 HFQNINTIPISALNGDNIISASNNMLWYNGPTLISLLESLNTNEKIDKKPLRFPVQLVAR 558
             +++  IP+SAL GDN+++A +N+ WY GPTLI LLESL+  E   ++P RFPVQLVAR
Sbjct: 199 GLKDVRPIPLSALAGDNVVTAGDNLSWYKGPTLIELLESLSVYEDAHEEPFRFPVQLVAR 258

Query: 559 HCGHISKDFRGYMGRIESGIIKKNDCLIVEPSGKKATIKDIQMLNKSLDMAITGQSVTLI 618
           H GH + DFRGYMGRIE+G + K D L+V+PSG+ AT++DI  L+ SL  A  GQSVT++
Sbjct: 259 HNGHEANDFRGYMGRIEAGKVSKGDKLLVQPSGQTATVRDILTLDGSLPSASAGQSVTIL 318

Query: 619 IKEYLDISRGNMLVSPFKRPVSLRSINANLCWLSEESLDLRRKYLLKHSTNQILSRILKI 678
           + EYLDISRG+ML S    P  L+++NA+LCWLSE++LD RRKY LKH+T Q+ +R+ K+
Sbjct: 319 LDEYLDISRGDMLASAESAPTLLKTVNADLCWLSEDALDPRRKYWLKHTTKQVAARVTKV 378

Query: 679 NALLNINTQKWCPPKLLDLNDIGCVTINIYEPISVDSYDNIRSTGSFILIDEITFQTVAA 738
           + LL+INTQ+  P + L LNDI  V+IN+ + I+ DSYD IR+TG+FILIDE+T QTVAA
Sbjct: 379 DTLLDINTQERHPAESLKLNDIARVSINVQQAIAADSYDAIRATGAFILIDEVTHQTVAA 438

Query: 739 VYI 741
             I
Sbjct: 439 GMI 441

Source: Herbaspirillum sp. CF444

Species: Herbaspirillum sp. CF444

Genus: Herbaspirillum

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria
>gi|198284802|ref|YP_002221123.1| sulfate adenylyltransferase large subunit [Acidithiobacillus ferrooxidans ATCC 53993] gi|218665028|ref|YP_002427487.1| sulfate adenylyltransferase, large subunit [Acidithiobacillus ferrooxidans ATCC 23270] gi|198249323|gb|ACH84916.1| sulfate adenylyltransferase, large subunit [Acidithiobacillus ferrooxidans ATCC 53993] gi|218517241|gb|ACK77827.1| sulfate adenylyltransferase, large subunit [Acidithiobacillus ferrooxidans ATCC 23270] Back     alignment and taxonomy information
>gi|340788693|ref|YP_004754158.1| sulfate adenylyltransferase subunit 1 [Collimonas fungivorans Ter331] gi|340553960|gb|AEK63335.1| Sulfate adenylyltransferase subunit 1 [Collimonas fungivorans Ter331] Back     alignment and taxonomy information
>gi|152979899|ref|YP_001354146.1| sulfate adenylyltransferase subunit 1 [Janthinobacterium sp. Marseille] gi|151279976|gb|ABR88386.1| sulfate adenylyltransferase subunit 1 [Janthinobacterium sp. Marseille] Back     alignment and taxonomy information
>gi|300312403|ref|YP_003776495.1| sulfate adenylyltransferase [Herbaspirillum seropedicae SmR1] gi|300075188|gb|ADJ64587.1| sulfate adenylyltransferase subunit 1 protein [Herbaspirillum seropedicae SmR1] Back     alignment and taxonomy information
>gi|409406833|ref|ZP_11255295.1| sulfate adenylyltransferase subunit 1 protein [Herbaspirillum sp. GW103] gi|386435382|gb|EIJ48207.1| sulfate adenylyltransferase subunit 1 protein [Herbaspirillum sp. GW103] Back     alignment and taxonomy information
>gi|344200707|ref|YP_004785033.1| sulfate adenylyltransferase large subunit [Acidithiobacillus ferrivorans SS3] gi|343776151|gb|AEM48707.1| sulfate adenylyltransferase, large subunit [Acidithiobacillus ferrivorans SS3] Back     alignment and taxonomy information
>gi|134095573|ref|YP_001100648.1| ATP-sulfurylase subunit 1 [Herminiimonas arsenicoxydans] gi|133739476|emb|CAL62527.1| Sulfate adenylyltransferase subunit 1 (Sulfate adenylate transferase) (SAT) (ATP-sulfurylase large subunit) [Herminiimonas arsenicoxydans] Back     alignment and taxonomy information
>gi|395761405|ref|ZP_10442074.1| sulfate adenylyltransferase subunit 1 [Janthinobacterium lividum PAMC 25724] Back     alignment and taxonomy information
>gi|445495656|ref|ZP_21462700.1| sulfate adenylyltransferase subunit 1 [Janthinobacterium sp. HH01] gi|444791817|gb|ELX13364.1| sulfate adenylyltransferase subunit 1 [Janthinobacterium sp. HH01] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query967
TIGR_CMR|CPS_2143466 CPS_2143 "sulfate adenylate tr 0.429 0.890 0.466 3.7e-96
TIGR_CMR|SO_3726475 SO_3726 "sulfate adenylyltrans 0.426 0.867 0.445 3.1e-90
UNIPROTKB|Q9KP20476 cysN "Sulfate adenylyltransfer 0.418 0.850 0.455 3.7e-87
TIGR_CMR|VC_2559476 VC_2559 "sulfate adenylate tra 0.418 0.850 0.455 3.7e-87
UNIPROTKB|P23845475 cysN [Escherichia coli K-12 (t 0.423 0.863 0.434 7.7e-87
UNIPROTKB|Q10600614 cysNC "Bifunctional enzyme Cys 0.423 0.667 0.446 3.3e-86
UNIPROTKB|P65670309 cysD "Sulfate adenylyltransfer 0.297 0.932 0.536 1.1e-78
UNIPROTKB|Q74CF6516 cysN "Sulfate adenylyltransfer 0.403 0.755 0.325 3.5e-56
TIGR_CMR|GSU_1718516 GSU_1718 "elongation factor Tu 0.403 0.755 0.325 3.5e-56
TIGR_CMR|CPS_2142299 CPS_2142 "sulfate adenylate tr 0.302 0.979 0.420 9.5e-56
TIGR_CMR|CPS_2143 CPS_2143 "sulfate adenylate transferase, subunit 1" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
 Score = 956 (341.6 bits), Expect = 3.7e-96, P = 3.7e-96
 Identities = 200/429 (46%), Positives = 275/429 (64%)

Query:   313 EKKQSVFKKHS---LLRFITAGSVDDGKSTLIGRLLFDSKNIFIDQLDAVSRTKYKRVMS 369
             E  Q+  K+H    L+RF+T GSVDDGKSTLIGRLL DSK IF DQL A+ +   K   +
Sbjct:    10 EDIQAYLKQHENKELVRFLTCGSVDDGKSTLIGRLLHDSKMIFEDQLAAIEKDSKKSGTT 69

Query:   370 GHNIDLSLLTDGLESEREQGITIDVAYRYFNTPKRKFIIADTPGHEQYTRNMITGASTAD 429
             G  IDL+LL DGL+SEREQGITIDVAYRYF+T KRKFIIADTPGHEQYTRNM TGAST D
Sbjct:    70 GEAIDLALLVDGLQSEREQGITIDVAYRYFSTDKRKFIIADTPGHEQYTRNMATGASTCD 129

Query:   430 AVIILIDASKIKFNPSVNLLTQTKRHSIIAHLLRIKHIIIAVNKMDLINYNQIFYKRIVY 489
               IILIDA          + TQT+RHS I  LL IKHI++AVNKMDL++Y+Q  Y+ I  
Sbjct:   130 IAIILIDAR-------YGVQTQTRRHSFICSLLGIKHIVVAVNKMDLVDYSQERYQEIKK 182

Query:   490 AYKKFAEDIHFQNINTIPISALNGDNIISASNNMLWYNGPTLISLLESLNTNEKIDKKPL 549
              Y++F E + F ++  +P+SALNGDN++  S NM WY G TL+ LL +++   +     L
Sbjct:   183 EYREFTESLEFSDVRFVPLSALNGDNVVDESVNMPWYPGATLMKLLNTIDVKTQEQFTQL 242

Query:   550 RFPVQLVARHCGHISKDFRGYMGRIESGIIKKNDCLIVEPSGKKATIKDIQMLNKSLDMA 609
             RF VQ V R     + DFRG+ G + SG +   D ++  PSGK++ +K+I   + +L+ A
Sbjct:   243 RFQVQYVNRP----NLDFRGFAGTLASGHVLVGDTIVALPSGKESVVKEIVTYDGNLERA 298

Query:   610 ITGQSVTLIIKEYLDISRGNMLVSPFKRPVSLRSINANLCWLSEESLDLRRKYLLKHSTN 669
               G +VTL +++ +DISRG ++V     P+S +  +A + W+ E  L+  R+Y +KH + 
Sbjct:   299 DKGMAVTLTLEDEIDISRGEIIVKKGSLPISAKEFSATVVWMHENELEPGREYFIKHGSK 358

Query:   670 QILSRILKINALLNINTQKWCPPKLLDLNDIGCVTINIYEPISVDSYDNIRSTGSFILID 729
                     I +  ++NT +      L +NDIG V     E +  D+Y++ + TG+FI+ID
Sbjct:   359 MTTGHAQNIVSKYDVNTMESLSSSQLAINDIGIVNFVAGETLHFDAYEDNQGTGAFIIID 418

Query:   730 EITFQTVAA 738
              ++  TV A
Sbjct:   419 RLSNVTVGA 427
GO:0004781 "sulfate adenylyltransferase (ATP) activity" evidence=ISS
GO:0006790 "sulfur compound metabolic process" evidence=ISS
TIGR_CMR|SO_3726 SO_3726 "sulfate adenylyltransferase, subunit 1" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KP20 cysN "Sulfate adenylyltransferase subunit 1" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_2559 VC_2559 "sulfate adenylate transferase, subunit 1" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|P23845 cysN [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|Q10600 cysNC "Bifunctional enzyme CysN/CysC" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
UNIPROTKB|P65670 cysD "Sulfate adenylyltransferase subunit 2" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
UNIPROTKB|Q74CF6 cysN "Sulfate adenylyltransferase, subunit 1" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1718 GSU_1718 "elongation factor Tu GTP binding domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_2142 CPS_2142 "sulfate adenylate transferase, subunit 2" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P65670CYSD_MYCTU2, ., 7, ., 7, ., 40.59100.29780.9320yesN/A
P65671CYSD_MYCBO2, ., 7, ., 7, ., 40.59100.29780.9320yesN/A
A5U1Y3CYSD_MYCTA2, ., 7, ., 7, ., 40.59100.29780.9320yesN/A
A1KI72CYSD_MYCBP2, ., 7, ., 7, ., 40.59100.29780.9320yesN/A
A1TDE9CYSD_MYCVP2, ., 7, ., 7, ., 40.59580.29670.9288yesN/A
A4T8Q2CYSD_MYCGI2, ., 7, ., 7, ., 40.59240.29670.9288yesN/A
A1UK27CYSD_MYCSK2, ., 7, ., 7, ., 40.59520.29470.9223yesN/A
Q1B510CYSD_MYCSS2, ., 7, ., 7, ., 40.59520.29470.9223yesN/A
A3Q3I2CYSD_MYCSJ2, ., 7, ., 7, ., 40.58840.29470.9223yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.1.1.1070.737
3rd Layer2.1.10.691
3rd Layer2.7.70.691
4th Layer2.7.7.40.737

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query967
PRK05253301 PRK05253, PRK05253, sulfate adenylyltransferase su 0.0
PRK05506632 PRK05506, PRK05506, bifunctional sulfate adenylylt 0.0
COG2895431 COG2895, CysN, GTPases - Sulfate adenylate transfe 0.0
PRK05124474 PRK05124, cysN, sulfate adenylyltransferase subuni 1e-174
TIGR02034406 TIGR02034, CysN, sulfate adenylyltransferase, larg 1e-169
PRK12563312 PRK12563, PRK12563, sulfate adenylyltransferase su 1e-147
TIGR02039294 TIGR02039, CysD, sulfate adenylyltransferase, smal 1e-138
cd04166209 cd04166, CysN_ATPS, CysN, together with protein Cy 1e-115
PRK06136249 PRK06136, PRK06136, uroporphyrin-III C-methyltrans 4e-84
cd11642233 cd11642, SUMT, Uroporphyrin-III C-methyltransferas 1e-80
COG5256428 COG5256, TEF1, Translation elongation factor EF-1a 3e-80
TIGR01469236 TIGR01469, cobA_cysG_Cterm, uroporphyrin-III C-met 5e-71
PRK12317425 PRK12317, PRK12317, elongation factor 1-alpha; Rev 1e-70
COG0007244 COG0007, CysG, Uroporphyrinogen-III methylase [Coe 2e-68
TIGR00483426 TIGR00483, EF-1_alpha, translation elongation fact 3e-68
cd01883219 cd01883, EF1_alpha, Elongation Factor 1-alpha (EF1 3e-59
COG0175261 COG0175, CysH, 3'-phosphoadenosine 5'-phosphosulfa 1e-54
PLN02625263 PLN02625, PLN02625, uroporphyrin-III C-methyltrans 6e-54
PTZ00141446 PTZ00141, PTZ00141, elongation factor 1- alpha; Pr 9e-54
pfam01507173 pfam01507, PAPS_reduct, Phosphoadenosine phosphosu 2e-45
PLN00043447 PLN00043, PLN00043, elongation factor 1-alpha; Pro 1e-44
pfam00009184 pfam00009, GTP_EFTU, Elongation factor Tu GTP bind 7e-44
PRK10637457 PRK10637, cysG, siroheme synthase; Provisional 7e-42
pfam00590202 pfam00590, TP_methylase, Tetrapyrrole (Corrin/Porp 9e-42
cd11641228 cd11641, Precorrin-4_C11-MT, Precorrin-4 C11-methy 8e-41
COG2875254 COG2875, CobM, Precorrin-4 methylase [Coenzyme met 3e-39
cd01713173 cd01713, PAPS_reductase, This domain is found in p 7e-38
cd00881183 cd00881, GTP_translation_factor, GTP translation f 1e-35
TIGR01465247 TIGR01465, cobM_cbiF, precorrin-4 C11-methyltransf 9e-35
PRK07168 474 PRK07168, PRK07168, bifunctional uroporphyrinogen- 1e-34
COG3276447 COG3276, SelB, Selenocysteine-specific translation 1e-31
cd09815224 cd09815, TP_methylase, S-AdoMet dependent tetrapyr 4e-30
cd04095103 cd04095, CysN_NoDQ_III, TCysN_NoDQ_II: This subfam 5e-29
TIGR00475581 TIGR00475, selB, selenocysteine-specific elongatio 4e-27
cd0369581 cd03695, CysN_NodQ_II, CysN_NodQ_II: This subfamil 1e-26
PRK15473257 PRK15473, cbiF, cobalt-precorrin-4 C(11)-methyltra 7e-24
cd04171170 cd04171, SelB, SelB, the dedicated elongation fact 6e-22
COG0050394 COG0050, TufB, GTPases - translation elongation fa 9e-22
TIGR00485394 TIGR00485, EF-Tu, translation elongation factor TU 3e-21
CHL00071409 CHL00071, tufA, elongation factor Tu 3e-21
PLN03127447 PLN03127, PLN03127, Elongation factor Tu; Provisio 3e-20
PRK12736394 PRK12736, PRK12736, elongation factor Tu; Reviewed 9e-19
PLN03126478 PLN03126, PLN03126, Elongation factor Tu; Provisio 3e-18
cd11645226 cd11645, Precorrin_2_C20_MT, Precorrin-2 C20-methy 2e-17
PRK12735396 PRK12735, PRK12735, elongation factor Tu; Reviewed 1e-16
PRK00049396 PRK00049, PRK00049, elongation factor Tu; Reviewed 6e-16
cd01884195 cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-b 9e-16
COG2243234 COG2243, CobF, Precorrin-2 methylase [Coenzyme met 2e-15
PRK13795636 PRK13795, PRK13795, hypothetical protein; Provisio 2e-15
PRK05576229 PRK05576, PRK05576, cobalt-precorrin-2 C(20)-methy 2e-14
cd01888197 cd01888, eIF2_gamma, Gamma subunit of initiation f 7e-14
PRK04000411 PRK04000, PRK04000, translation initiation factor 1e-13
TIGR03680406 TIGR03680, eif2g_arch, translation initiation fact 2e-13
TIGR01467230 TIGR01467, cobI_cbiL, precorrin-2 C20-methyltransf 6e-13
COG5257415 COG5257, GCD11, Translation initiation factor 2, g 1e-12
cd0369391 cd03693, EF1_alpha_II, EF1_alpha_II: this family r 4e-11
PRK05787210 PRK05787, PRK05787, cobalt-precorrin-6Y C(5)-methy 5e-11
cd0134283 cd01342, Translation_Factor_II_like, Translation_F 1e-10
PRK13794479 PRK13794, PRK13794, hypothetical protein; Provisio 2e-10
COG1010249 COG1010, CobJ, Precorrin-3B methylase [Coenzyme me 3e-10
COG2241210 COG2241, CobL, Precorrin-6B methylase 1 [Coenzyme 4e-10
cd0369883 cd03698, eRF3_II_like, eRF3_II_like: domain simila 4e-10
cd11724255 cd11724, TP_methylase_like, Uncharacterized subfam 5e-10
TIGR01466239 TIGR01466, cobJ_cbiH, precorrin-3B C17-methyltrans 8e-10
cd11644201 cd11644, Precorrin-6Y-methylase, Precorrin-6Y meth 1e-09
cd01889192 cd01889, SelB_euk, SelB, the dedicated elongation 1e-09
PRK05765246 PRK05765, PRK05765, precorrin-3B C17-methyltransfe 2e-09
PTZ00327460 PTZ00327, PTZ00327, eukaryotic translation initiat 3e-09
cd11646240 cd11646, Precorrin_3B_C17_MT, Precorrin-3B C(17)-m 3e-09
TIGR02467204 TIGR02467, CbiE, precorrin-6y C5,15-methyltransfer 3e-09
cd01887169 cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ euk 4e-09
TIGR00434212 TIGR00434, cysH, phosophoadenylyl-sulfate reductas 2e-08
pfam0314470 pfam03144, GTP_EFTU_D2, Elongation factor Tu domai 7e-08
cd04163168 cd04163, Era, E 7e-08
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 8e-08
PRK13351687 PRK13351, PRK13351, elongation factor G; Reviewed 8e-08
COG5258527 COG5258, GTPBP1, GTPase [General function predicti 1e-07
PRK10512614 PRK10512, PRK10512, selenocysteinyl-tRNA-specific 2e-07
PRK04160258 PRK04160, PRK04160, diphthine synthase; Provisiona 2e-07
cd04168237 cd04168, TetM_like, Tet(M)-like family includes Te 2e-07
TIGR02057226 TIGR02057, PAPS_reductase, phosphoadenosine phosph 4e-07
COG1798260 COG1798, DPH5, Diphthamide biosynthesis methyltran 4e-07
cd0369787 cd03697, EFTU_II, EFTU_II: Elongation factor Tu do 4e-07
cd01891194 cd01891, TypA_BipA, Tyrosine phosphorylated protei 4e-07
cd11647241 cd11647, Diphthine_synthase, Diphthine synthase, a 4e-07
COG0480697 COG0480, FusA, Translation elongation factors (GTP 4e-07
PRK08557417 PRK08557, PRK08557, hypothetical protein; Provisio 7e-07
PRK02090241 PRK02090, PRK02090, phosphoadenosine phosphosulfat 8e-07
PRK00089292 PRK00089, era, GTPase Era; Reviewed 1e-06
cd0369683 cd03696, selB_II, selB_II: this subfamily represen 1e-06
TIGR01394594 TIGR01394, TypA_BipA, GTP-binding protein TypA/Bip 3e-06
TIGR01393595 TIGR01393, lepA, GTP-binding protein LepA 3e-06
COG0532509 COG0532, InfB, Translation initiation factor 2 (IF 5e-06
TIGR02055191 TIGR02055, APS_reductase, thioredoxin-dependent ad 1e-05
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 1e-05
PRK12740668 PRK12740, PRK12740, elongation factor G; Reviewed 1e-05
cd01890179 cd01890, LepA, LepA also known as Elongation Facto 1e-05
cd0408982 cd04089, eRF3_II, eRF3_II: domain II of the eukary 2e-05
CHL00189742 CHL00189, infB, translation initiation factor 2; P 2e-05
cd04169268 cd04169, RF3, Release Factor 3 (RF3) protein invol 3e-05
PRK08576438 PRK08576, PRK08576, hypothetical protein; Provisio 3e-05
cd04167213 cd04167, Snu114p, Snu114p, a spliceosome protein, 4e-05
cd01879159 cd01879, FeoB, Ferrous iron transport protein B (F 4e-05
COG2229187 COG2229, COG2229, Predicted GTPase [General functi 5e-05
TIGR00487587 TIGR00487, IF-2, translation initiation factor IF- 8e-05
cd00880161 cd00880, Era_like, E 1e-04
TIGR00503527 TIGR00503, prfC, peptide chain release factor 3 2e-04
PRK10218607 PRK10218, PRK10218, GTP-binding protein; Provision 5e-04
PRK15478241 PRK15478, cbiH, cobalt-precorrin-3B C(17)-methyltr 5e-04
pfam02421190 pfam02421, FeoB_N, Ferrous iron transport protein 5e-04
cd01895174 cd01895, EngA2, EngA2 GTPase contains the second d 6e-04
PRK05948238 PRK05948, PRK05948, precorrin-2 methyltransferase; 7e-04
COG1159298 COG1159, Era, GTPase [General function prediction 8e-04
COG1217603 COG1217, TypA, Predicted membrane GTPase involved 0.001
COG1160444 COG1160, COG1160, Predicted GTPases [General funct 0.001
TIGR00484689 TIGR00484, EF-G, translation elongation factor EF- 0.002
cd01886270 cd01886, EF-G, Elongation factor G (EF-G) family i 0.002
cd09912180 cd09912, DLP_2, Dynamin-like protein including dyn 0.002
PRK05990241 PRK05990, PRK05990, precorrin-2 C(20)-methyltransf 0.003
COG4108528 COG4108, PrfC, Peptide chain release factor RF-3 [ 0.004
PRK05306746 PRK05306, infB, translation initiation factor IF-2 0.004
>gnl|CDD|235375 PRK05253, PRK05253, sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information 
 Score =  560 bits (1447), Expect = 0.0
 Identities = 166/291 (57%), Positives = 215/291 (73%), Gaps = 1/291 (0%)

Query: 18  YLDWLESEAIHIMREVSAECNNPVLLFSGGKDSVVLLRLAEKAFRPSRFPFPMVHIDTGH 77
           +LD LE+E+IHI+REV+AE  NPV+L+S GKDS V+L LA KAF P + PFP++H+DTG 
Sbjct: 8   HLDQLEAESIHILREVAAEFENPVMLYSIGKDSSVMLHLARKAFYPGKLPFPLLHVDTGW 67

Query: 78  NFPEVISFRDNCISKLGETLIVRSVEDSIMKGTVRLRKPNTDSRNAAQSITLLETIKEFK 137
            FPE+I FRD    +LG  LIV S  + I +G    R  +    NA ++  L + ++++ 
Sbjct: 68  KFPEMIEFRDRRAKELGLELIVHSNPEGIARGINPFRHGSAKHTNAMKTEGLKQALEKYG 127

Query: 138 FDACIGGARRDEEKARAKERIFSFRDKFGQWNPKSQRPELWNLYNTRVHPGENIRVFPIS 197
           FDA  GGARRDEEK+RAKERIFSFRD+FGQW+PK+QRPELWNLYN R++ GE+IRVFP+S
Sbjct: 128 FDAAFGGARRDEEKSRAKERIFSFRDEFGQWDPKNQRPELWNLYNGRINKGEHIRVFPLS 187

Query: 198 NWTELDIWQYIEREKIILPSLYFAHKRKIIKRKGLLIPFTNLTPAHPGEIIENLMVRFRT 257
           NWTELDIWQYIERE I +  LYFAH+R +++R G+LI   +  P  PGE++E  MVRFRT
Sbjct: 188 NWTELDIWQYIERENIPIVPLYFAHERPVVERDGMLIMVDDRMPLRPGEVVEERMVRFRT 247

Query: 258 VGDILCTCPILSNATTVEDIIKEISVTQITERGATRIDDQNSEASMEKRKK 308
           +G   CT  + S A T+E+II E+ VT+ +ERG   IDD   EASMEKRK+
Sbjct: 248 LGCYPCTGAVESEAATLEEIIAEMLVTRTSERGGRAIDDD-QEASMEKRKR 297

Length = 301
>gnl|CDD|180120 PRK05506, PRK05506, bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>gnl|CDD|225448 COG2895, CysN, GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|235349 PRK05124, cysN, sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|213679 TIGR02034, CysN, sulfate adenylyltransferase, large subunit Back     alignment and domain information
>gnl|CDD|237138 PRK12563, PRK12563, sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|131094 TIGR02039, CysD, sulfate adenylyltransferase, small subunit Back     alignment and domain information
>gnl|CDD|206729 cd04166, CysN_ATPS, CysN, together with protein CysD, forms the ATP sulfurylase (ATPS) complex Back     alignment and domain information
>gnl|CDD|235711 PRK06136, PRK06136, uroporphyrin-III C-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|212501 cd11642, SUMT, Uroporphyrin-III C-methyltransferase (S-Adenosyl-L-methionine:uroporphyrinogen III methyltransferase, SUMT) Back     alignment and domain information
>gnl|CDD|227581 COG5256, TEF1, Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|233426 TIGR01469, cobA_cysG_Cterm, uroporphyrin-III C-methyltransferase Back     alignment and domain information
>gnl|CDD|237055 PRK12317, PRK12317, elongation factor 1-alpha; Reviewed Back     alignment and domain information
>gnl|CDD|223086 COG0007, CysG, Uroporphyrinogen-III methylase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|129574 TIGR00483, EF-1_alpha, translation elongation factor EF-1 alpha Back     alignment and domain information
>gnl|CDD|206670 cd01883, EF1_alpha, Elongation Factor 1-alpha (EF1-alpha) protein family Back     alignment and domain information
>gnl|CDD|223253 COG0175, CysH, 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase and related enzymes [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|178232 PLN02625, PLN02625, uroporphyrin-III C-methyltransferase Back     alignment and domain information
>gnl|CDD|185474 PTZ00141, PTZ00141, elongation factor 1- alpha; Provisional Back     alignment and domain information
>gnl|CDD|201832 pfam01507, PAPS_reduct, Phosphoadenosine phosphosulfate reductase family Back     alignment and domain information
>gnl|CDD|165621 PLN00043, PLN00043, elongation factor 1-alpha; Provisional Back     alignment and domain information
>gnl|CDD|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain Back     alignment and domain information
>gnl|CDD|182606 PRK10637, cysG, siroheme synthase; Provisional Back     alignment and domain information
>gnl|CDD|216012 pfam00590, TP_methylase, Tetrapyrrole (Corrin/Porphyrin) Methylases Back     alignment and domain information
>gnl|CDD|212500 cd11641, Precorrin-4_C11-MT, Precorrin-4 C11-methyltransferase (CbiF/CobM) Back     alignment and domain information
>gnl|CDD|225430 COG2875, CobM, Precorrin-4 methylase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|238846 cd01713, PAPS_reductase, This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase Back     alignment and domain information
>gnl|CDD|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors Back     alignment and domain information
>gnl|CDD|200107 TIGR01465, cobM_cbiF, precorrin-4 C11-methyltransferase Back     alignment and domain information
>gnl|CDD|180864 PRK07168, PRK07168, bifunctional uroporphyrinogen-III methyltransferase/uroporphyrinogen-III synthase; Reviewed Back     alignment and domain information
>gnl|CDD|225815 COG3276, SelB, Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|212499 cd09815, TP_methylase, S-AdoMet dependent tetrapyrrole methylases Back     alignment and domain information
>gnl|CDD|239762 cd04095, CysN_NoDQ_III, TCysN_NoDQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu Back     alignment and domain information
>gnl|CDD|129567 TIGR00475, selB, selenocysteine-specific elongation factor SelB Back     alignment and domain information
>gnl|CDD|239666 cd03695, CysN_NodQ_II, CysN_NodQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu Back     alignment and domain information
>gnl|CDD|185370 PRK15473, cbiF, cobalt-precorrin-4 C(11)-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|206734 cd04171, SelB, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome Back     alignment and domain information
>gnl|CDD|223128 COG0050, TufB, GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129576 TIGR00485, EF-Tu, translation elongation factor TU Back     alignment and domain information
>gnl|CDD|177010 CHL00071, tufA, elongation factor Tu Back     alignment and domain information
>gnl|CDD|178673 PLN03127, PLN03127, Elongation factor Tu; Provisional Back     alignment and domain information
>gnl|CDD|237184 PRK12736, PRK12736, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|215592 PLN03126, PLN03126, Elongation factor Tu; Provisional Back     alignment and domain information
>gnl|CDD|212504 cd11645, Precorrin_2_C20_MT, Precorrin-2 C20-methyltransferase, also named CobI or CbiL Back     alignment and domain information
>gnl|CDD|183708 PRK12735, PRK12735, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|234596 PRK00049, PRK00049, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|206671 cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-binding proteins Back     alignment and domain information
>gnl|CDD|225152 COG2243, CobF, Precorrin-2 methylase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|237510 PRK13795, PRK13795, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235512 PRK05576, PRK05576, cobalt-precorrin-2 C(20)-methyltransferase; Validated Back     alignment and domain information
>gnl|CDD|206675 cd01888, eIF2_gamma, Gamma subunit of initiation factor 2 (eIF2 gamma) Back     alignment and domain information
>gnl|CDD|235194 PRK04000, PRK04000, translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>gnl|CDD|211860 TIGR03680, eif2g_arch, translation initiation factor 2 subunit gamma Back     alignment and domain information
>gnl|CDD|233425 TIGR01467, cobI_cbiL, precorrin-2 C20-methyltransferase Back     alignment and domain information
>gnl|CDD|227582 COG5257, GCD11, Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|239664 cd03693, EF1_alpha_II, EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages Back     alignment and domain information
>gnl|CDD|235609 PRK05787, PRK05787, cobalt-precorrin-6Y C(5)-methyltransferase; Validated Back     alignment and domain information
>gnl|CDD|238652 cd01342, Translation_Factor_II_like, Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins Back     alignment and domain information
>gnl|CDD|237509 PRK13794, PRK13794, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223942 COG1010, CobJ, Precorrin-3B methylase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|225150 COG2241, CobL, Precorrin-6B methylase 1 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|239669 cd03698, eRF3_II_like, eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>gnl|CDD|212510 cd11724, TP_methylase_like, Uncharacterized subfamily of S-AdoMet dependent tetrapyrrole methylases Back     alignment and domain information
>gnl|CDD|233424 TIGR01466, cobJ_cbiH, precorrin-3B C17-methyltransferase Back     alignment and domain information
>gnl|CDD|212503 cd11644, Precorrin-6Y-methylase, Precorrin-6Y methyltransferase, the cobalamin biosynthesis enzyme CbiE Back     alignment and domain information
>gnl|CDD|206676 cd01889, SelB_euk, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome Back     alignment and domain information
>gnl|CDD|235597 PRK05765, PRK05765, precorrin-3B C17-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|240362 PTZ00327, PTZ00327, eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>gnl|CDD|212505 cd11646, Precorrin_3B_C17_MT, Precorrin-3B C(17)-methyltransferase (CobJ/CbiH) Back     alignment and domain information
>gnl|CDD|233878 TIGR02467, CbiE, precorrin-6y C5,15-methyltransferase (decarboxylating), CbiE subunit Back     alignment and domain information
>gnl|CDD|206674 cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ eukaryotic Initiation Factor 5B (eIF5B) family Back     alignment and domain information
>gnl|CDD|129526 TIGR00434, cysH, phosophoadenylyl-sulfate reductase (thioredoxin) Back     alignment and domain information
>gnl|CDD|217388 pfam03144, GTP_EFTU_D2, Elongation factor Tu domain 2 Back     alignment and domain information
>gnl|CDD|206726 cd04163, Era, E Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|237358 PRK13351, PRK13351, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|227583 COG5258, GTPBP1, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|182508 PRK10512, PRK10512, selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>gnl|CDD|235231 PRK04160, PRK04160, diphthine synthase; Provisional Back     alignment and domain information
>gnl|CDD|206731 cd04168, TetM_like, Tet(M)-like family includes Tet(M), Tet(O), Tet(W), and OtrA, containing tetracycline resistant proteins Back     alignment and domain information
>gnl|CDD|131112 TIGR02057, PAPS_reductase, phosphoadenosine phosphosulfate reductase, thioredoxin dependent Back     alignment and domain information
>gnl|CDD|224711 COG1798, DPH5, Diphthamide biosynthesis methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|239668 cd03697, EFTU_II, EFTU_II: Elongation factor Tu domain II Back     alignment and domain information
>gnl|CDD|206678 cd01891, TypA_BipA, Tyrosine phosphorylated protein A (TypA)/BipA family belongs to ribosome-binding GTPases Back     alignment and domain information
>gnl|CDD|212506 cd11647, Diphthine_synthase, Diphthine synthase, also known as DPH5 Back     alignment and domain information
>gnl|CDD|223556 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|181465 PRK08557, PRK08557, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|234997 PRK02090, PRK02090, phosphoadenosine phosphosulfate reductase; Provisional Back     alignment and domain information
>gnl|CDD|234624 PRK00089, era, GTPase Era; Reviewed Back     alignment and domain information
>gnl|CDD|239667 cd03696, selB_II, selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu Back     alignment and domain information
>gnl|CDD|233394 TIGR01394, TypA_BipA, GTP-binding protein TypA/BipA Back     alignment and domain information
>gnl|CDD|130460 TIGR01393, lepA, GTP-binding protein LepA Back     alignment and domain information
>gnl|CDD|223606 COG0532, InfB, Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|233701 TIGR02055, APS_reductase, thioredoxin-dependent adenylylsulfate APS reductase Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|237186 PRK12740, PRK12740, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|206677 cd01890, LepA, LepA also known as Elongation Factor 4 (EF4) Back     alignment and domain information
>gnl|CDD|239756 cd04089, eRF3_II, eRF3_II: domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|206732 cd04169, RF3, Release Factor 3 (RF3) protein involved in the terminal step of translocation in bacteria Back     alignment and domain information
>gnl|CDD|236300 PRK08576, PRK08576, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206730 cd04167, Snu114p, Snu114p, a spliceosome protein, is a GTPase Back     alignment and domain information
>gnl|CDD|206667 cd01879, FeoB, Ferrous iron transport protein B (FeoB) family Back     alignment and domain information
>gnl|CDD|225138 COG2229, COG2229, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|232995 TIGR00487, IF-2, translation initiation factor IF-2 Back     alignment and domain information
>gnl|CDD|206646 cd00880, Era_like, E Back     alignment and domain information
>gnl|CDD|129594 TIGR00503, prfC, peptide chain release factor 3 Back     alignment and domain information
>gnl|CDD|104396 PRK10218, PRK10218, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|185375 PRK15478, cbiH, cobalt-precorrin-3B C(17)-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|217025 pfam02421, FeoB_N, Ferrous iron transport protein B Back     alignment and domain information
>gnl|CDD|206682 cd01895, EngA2, EngA2 GTPase contains the second domain of EngA Back     alignment and domain information
>gnl|CDD|180320 PRK05948, PRK05948, precorrin-2 methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|224081 COG1159, Era, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224138 COG1217, TypA, Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|224082 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|129575 TIGR00484, EF-G, translation elongation factor EF-G Back     alignment and domain information
>gnl|CDD|206673 cd01886, EF-G, Elongation factor G (EF-G) family involved in both the elongation and ribosome recycling phases of protein synthesis Back     alignment and domain information
>gnl|CDD|206739 cd09912, DLP_2, Dynamin-like protein including dynamins, mitofusins, and guanylate-binding proteins Back     alignment and domain information
>gnl|CDD|180341 PRK05990, PRK05990, precorrin-2 C(20)-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|226593 COG4108, PrfC, Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 967
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPa 100.0
COG2895431 CysN GTPases - Sulfate adenylate transferase subun 100.0
PLN00043447 elongation factor 1-alpha; Provisional 100.0
PTZ00141446 elongation factor 1- alpha; Provisional 100.0
PRK05124474 cysN sulfate adenylyltransferase subunit 1; Provis 100.0
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 100.0
PRK12317425 elongation factor 1-alpha; Reviewed 100.0
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 100.0
KOG0458|consensus603 100.0
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 100.0
KOG0459|consensus501 100.0
PLN03126478 Elongation factor Tu; Provisional 100.0
CHL00071409 tufA elongation factor Tu 100.0
PRK12735396 elongation factor Tu; Reviewed 100.0
PRK00049396 elongation factor Tu; Reviewed 100.0
COG0050394 TufB GTPases - translation elongation factors [Tra 100.0
PRK12736394 elongation factor Tu; Reviewed 100.0
TIGR00485394 EF-Tu translation elongation factor TU. This align 100.0
KOG0460|consensus449 100.0
PLN03127447 Elongation factor Tu; Provisional 100.0
PTZ00327460 eukaryotic translation initiation factor 2 gamma s 100.0
PRK12563312 sulfate adenylyltransferase subunit 2; Provisional 100.0
TIGR02039294 CysD sulfate adenylyltransferase, small subunit. I 100.0
PRK05253301 sulfate adenylyltransferase subunit 2; Provisional 100.0
PRK10512614 selenocysteinyl-tRNA-specific translation factor; 100.0
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 100.0
PRK04000411 translation initiation factor IF-2 subunit gamma; 100.0
COG3276447 SelB Selenocysteine-specific translation elongatio 100.0
TIGR00475581 selB selenocysteine-specific elongation factor Sel 100.0
COG5258527 GTPBP1 GTPase [General function prediction only] 100.0
COG0007244 CysG Uroporphyrinogen-III methylase [Coenzyme meta 100.0
COG5257415 GCD11 Translation initiation factor 2, gamma subun 100.0
COG2875254 CobM Precorrin-4 methylase [Coenzyme metabolism] 100.0
KOG0463|consensus641 100.0
PRK07168 474 bifunctional uroporphyrinogen-III methyltransferas 100.0
KOG0461|consensus522 100.0
TIGR01394594 TypA_BipA GTP-binding protein TypA/BipA. This bact 100.0
PRK06136249 uroporphyrin-III C-methyltransferase; Reviewed 100.0
PRK15473257 cbiF cobalt-precorrin-4 C(11)-methyltransferase; P 100.0
PLN02625263 uroporphyrin-III C-methyltransferase 100.0
KOG1143|consensus591 100.0
KOG0462|consensus650 100.0
COG1217603 TypA Predicted membrane GTPase involved in stress 100.0
TIGR01469236 cobA_cysG_Cterm uroporphyrin-III C-methyltransfera 100.0
KOG0052|consensus391 100.0
TIGR01465229 cobM_cbiF precorrin-4 C11-methyltransferase. This 100.0
TIGR02057226 PAPS_reductase phosphoadenosine phosphosulfate red 100.0
COG0175261 CysH 3'-phosphoadenosine 5'-phosphosulfate sulfotr 100.0
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 100.0
COG0481603 LepA Membrane GTPase LepA [Cell envelope biogenesi 100.0
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 100.0
PRK10637457 cysG siroheme synthase; Provisional 100.0
PRK10218607 GTP-binding protein; Provisional 100.0
KOG1527|consensus506 100.0
TIGR00434212 cysH phosophoadenylyl-sulfate reductase (thioredox 100.0
TIGR01393595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 100.0
PRK15478241 cbiH cobalt-precorrin-3B C(17)-methyltransferase; 100.0
PRK05433600 GTP-binding protein LepA; Provisional 100.0
TIGR00522257 dph5 diphthine synthase. This protein participates 100.0
PRK02090241 phosphoadenosine phosphosulfate reductase; Provisi 100.0
PRK08557417 hypothetical protein; Provisional 100.0
TIGR00424463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 100.0
PLN02309457 5'-adenylylsulfate reductase 99.98
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.98
PRK05765246 precorrin-3B C17-methyltransferase; Provisional 99.98
PRK05948238 precorrin-2 methyltransferase; Provisional 99.97
PTZ00175270 diphthine synthase; Provisional 99.97
PRK13794479 hypothetical protein; Provisional 99.97
PF00590210 TP_methylase: Tetrapyrrole (Corrin/Porphyrin) Meth 99.97
COG2243234 CobF Precorrin-2 methylase [Coenzyme metabolism] 99.97
PRK05990241 precorrin-2 C(20)-methyltransferase; Reviewed 99.97
PRK14994287 SAM-dependent 16S ribosomal RNA C1402 ribose 2'-O- 99.97
PF01507174 PAPS_reduct: Phosphoadenosine phosphosulfate reduc 99.97
TIGR01467230 cobI_cbiL precorrin-2 C20-methyltransferase. This 99.97
PRK05576229 cobalt-precorrin-2 C(20)-methyltransferase; Valida 99.97
TIGR00487587 IF-2 translation initiation factor IF-2. This mode 99.96
PRK13795636 hypothetical protein; Provisional 99.96
TIGR02467204 CbiE precorrin-6y C5,15-methyltransferase (decarbo 99.96
TIGR01466239 cobJ_cbiH precorrin-3B C17-methyltransferase. This 99.96
PRK05306787 infB translation initiation factor IF-2; Validated 99.96
TIGR02055191 APS_reductase thioredoxin-dependent adenylylsulfat 99.96
PRK05787210 cobalt-precorrin-6Y C(5)-methyltransferase; Valida 99.96
PRK07560731 elongation factor EF-2; Reviewed 99.96
COG1010249 CobJ Precorrin-3B methylase [Coenzyme metabolism] 99.96
PRK00007693 elongation factor G; Reviewed 99.96
PRK12739691 elongation factor G; Reviewed 99.96
PRK05991250 precorrin-3B C17-methyltransferase; Provisional 99.96
COG2241210 CobL Precorrin-6B methylase 1 [Coenzyme metabolism 99.96
PRK08576438 hypothetical protein; Provisional 99.96
PRK08284253 precorrin 6A synthase; Provisional 99.96
PRK04160258 diphthine synthase; Provisional 99.95
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.95
TIGR02434249 CobF precorrin-6A synthase (deacetylating). This m 99.95
COG0480697 FusA Translation elongation factors (GTPases) [Tra 99.95
TIGR00484689 EF-G translation elongation factor EF-G. After pep 99.95
PRK00741526 prfC peptide chain release factor 3; Provisional 99.95
KOG0466|consensus466 99.95
CHL00189742 infB translation initiation factor 2; Provisional 99.95
TIGR00503527 prfC peptide chain release factor 3. This translat 99.95
KOG0189|consensus261 99.95
PRK04004586 translation initiation factor IF-2; Validated 99.94
KOG1145|consensus683 99.94
PRK06850507 hypothetical protein; Provisional 99.94
PRK13351687 elongation factor G; Reviewed 99.94
TIGR00491590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.94
TIGR00490720 aEF-2 translation elongation factor aEF-2. This mo 99.94
TIGR03183447 DNA_S_dndC putative sulfurtransferase DndC. Member 99.94
COG0532509 InfB Translation initiation factor 2 (IF-2; GTPase 99.93
PRK12740668 elongation factor G; Reviewed 99.93
COG4108528 PrfC Peptide chain release factor RF-3 [Translatio 99.93
COG0313275 Predicted methyltransferases [General function pre 99.93
cd01713173 PAPS_reductase This domain is found in phosphoaden 99.93
PLN00116 843 translation elongation factor EF-2 subunit; Provis 99.92
PTZ00416 836 elongation factor 2; Provisional 99.91
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.91
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.9
KOG0465|consensus721 99.9
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.9
COG1160444 Predicted GTPases [General function prediction onl 99.9
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.89
COG1798260 DPH5 Diphthamide biosynthesis methyltransferase [T 99.88
PRK148451049 translation initiation factor IF-2; Provisional 99.88
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.88
TIGR00096276 probable S-adenosylmethionine-dependent methyltran 99.87
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.87
COG1159298 Era GTPase [General function prediction only] 99.86
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.85
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.85
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 99.85
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.85
KOG0467|consensus 887 99.81
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 99.81
cd00881189 GTP_translation_factor GTP translation factor fami 99.81
KOG3123|consensus272 99.79
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.79
KOG1144|consensus1064 99.78
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.78
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.78
cd01993185 Alpha_ANH_like_II This is a subfamily of Adenine n 99.78
KOG0469|consensus 842 99.77
TIGR02432189 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-t 99.77
cd01992185 PP-ATPase N-terminal domain of predicted ATPase of 99.77
PF01171182 ATP_bind_3: PP-loop family; InterPro: IPR011063 Th 99.77
PRK00093435 GTP-binding protein Der; Reviewed 99.77
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.76
KOG0464|consensus753 99.76
COG3969407 Predicted phosphoadenosine phosphosulfate sulfotra 99.76
COG1160444 Predicted GTPases [General function prediction onl 99.75
PRK10696258 tRNA 2-thiocytidine biosynthesis protein TtcA; Pro 99.75
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 99.74
PRK15494339 era GTPase Era; Provisional 99.74
PRK03003472 GTP-binding protein Der; Reviewed 99.73
cd04095103 CysN_NoDQ_III TCysN_NoDQ_II: This subfamily repres 99.73
COG0037298 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle 99.72
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.71
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.7
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.69
PRK00089292 era GTPase Era; Reviewed 99.68
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.68
KOG0468|consensus 971 99.67
cd03705104 EF1_alpha_III Domain III of EF-1. Eukaryotic elong 99.67
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.67
cd04093107 HBS1_C HBS1_C: this family represents the C-termin 99.66
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.66
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.64
COG2262411 HflX GTPases [General function prediction only] 99.63
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.63
cd03704108 eRF3c_III This family represents eEF1alpha-like C- 99.63
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.63
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.63
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.63
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.62
PRK04213201 GTP-binding protein; Provisional 99.62
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.62
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.62
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.62
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.62
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.62
PRK03003472 GTP-binding protein Der; Reviewed 99.61
COG0486454 ThdF Predicted GTPase [General function prediction 99.61
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.61
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.61
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.61
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.61
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.61
KOG0092|consensus200 99.61
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.6
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.6
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.6
KOG0084|consensus205 99.6
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.6
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.6
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.6
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.6
cd0369391 EF1_alpha_II EF1_alpha_II: this family represents 99.6
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.6
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.6
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.59
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.59
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.59
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.59
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.59
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.59
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.59
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.59
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.59
COG0218200 Predicted GTPase [General function prediction only 99.58
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.58
PRK10660436 tilS tRNA(Ile)-lysidine synthetase; Provisional 99.58
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.58
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.58
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.58
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.58
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.58
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.58
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.58
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.57
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.57
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.57
PRK00093435 GTP-binding protein Der; Reviewed 99.57
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.57
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.56
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.56
PRK12296500 obgE GTPase CgtA; Reviewed 99.56
KOG1423|consensus379 99.56
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.56
PRK11058426 GTPase HflX; Provisional 99.56
cd01513102 Translation_factor_III Domain III of Elongation fa 99.56
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.56
PRK12298390 obgE GTPase CgtA; Reviewed 99.56
PLN00223181 ADP-ribosylation factor; Provisional 99.56
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.56
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.56
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.56
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.56
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.55
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.55
PRK12299335 obgE GTPase CgtA; Reviewed 99.55
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.55
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.55
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.55
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.54
cd0369883 eRF3_II_like eRF3_II_like: domain similar to domai 99.54
PLN03118211 Rab family protein; Provisional 99.54
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.54
KOG0098|consensus216 99.54
TIGR00268252 conserved hypothetical protein TIGR00268. The N-te 99.54
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.54
KOG0094|consensus221 99.54
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.54
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.53
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.53
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.53
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.53
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.53
PRK00919307 GMP synthase subunit B; Validated 99.53
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.53
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.53
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.53
PLN03110216 Rab GTPase; Provisional 99.53
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.53
PTZ00369189 Ras-like protein; Provisional 99.52
PTZ00133182 ADP-ribosylation factor; Provisional 99.52
cd0369581 CysN_NodQ_II CysN_NodQ_II: This subfamily represen 99.52
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 99.52
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.52
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.52
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.52
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.52
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.52
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.52
PRK00074511 guaA GMP synthase; Reviewed 99.51
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.51
cd01990202 Alpha_ANH_like_I This is a subfamily of Adenine nu 99.51
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.51
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.51
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.51
KOG0078|consensus207 99.51
cd0408982 eRF3_II eRF3_II: domain II of the eukaryotic class 99.51
PLN03108210 Rab family protein; Provisional 99.51
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.51
COG0370653 FeoB Fe2+ transport system protein B [Inorganic io 99.5
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.5
COG1606269 ATP-utilizing enzymes of the PP-loop superfamily [ 99.5
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.5
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.5
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.5
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.5
PRK12297424 obgE GTPase CgtA; Reviewed 99.5
TIGR00884311 guaA_Cterm GMP synthase (glutamine-hydrolyzing), C 99.5
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.49
COG1163365 DRG Predicted GTPase [General function prediction 99.49
PRK00143346 mnmA tRNA-specific 2-thiouridylase MnmA; Reviewed 99.49
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.49
COG2229187 Predicted GTPase [General function prediction only 99.48
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.48
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.48
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.48
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.48
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.48
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.47
PF0314399 GTP_EFTU_D3: Elongation factor Tu C-terminal domai 99.47
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.47
cd01712177 ThiI ThiI is required for thiazole synthesis in th 99.47
cd01997295 GMP_synthase_C The C-terminal domain of GMP synthe 99.46
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.46
TIGR00437591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.46
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.46
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.46
PRK09866741 hypothetical protein; Provisional 99.46
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.45
KOG0394|consensus210 99.45
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.45
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.45
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.45
cd0369787 EFTU_II EFTU_II: Elongation factor Tu domain II. E 99.44
COG3956 488 Protein containing tetrapyrrole methyltransferase 99.44
cd0369487 GTPBP_II Domain II of the GP-1 family of GTPase. T 99.44
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.44
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.44
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.44
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.44
cd0369683 selB_II selB_II: this subfamily represents the dom 99.42
KOG1489|consensus366 99.42
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.42
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.41
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.41
KOG0086|consensus214 99.41
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.41
PRK08349198 hypothetical protein; Validated 99.4
cd01998349 tRNA_Me_trans tRNA methyl transferase. This family 99.4
TIGR00420352 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-me 99.4
KOG0073|consensus185 99.39
COG1084346 Predicted GTPase [General function prediction only 99.39
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.39
KOG0080|consensus209 99.38
KOG1191|consensus531 99.38
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 99.38
cd01896233 DRG The developmentally regulated GTP-binding prot 99.38
PRK14561194 hypothetical protein; Provisional 99.37
cd01995169 ExsB ExsB is a transcription regulator related pro 99.36
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.35
PRK14665360 mnmA tRNA-specific 2-thiouridylase MnmA; Provision 99.33
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 99.33
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.31
KOG0087|consensus222 99.31
TIGR00552250 nadE NAD+ synthetase. NAD+ synthetase is a nearly 99.3
KOG0093|consensus193 99.3
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.29
PRK14664362 tRNA-specific 2-thiouridylase MnmA; Provisional 99.29
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 99.29
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.29
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.28
cd04105203 SR_beta Signal recognition particle receptor, beta 99.27
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.27
PRK13820394 argininosuccinate synthase; Provisional 99.26
KOG0095|consensus213 99.25
COG3596296 Predicted GTPase [General function prediction only 99.25
PRK08384381 thiamine biosynthesis protein ThiI; Provisional 99.24
PLN02347536 GMP synthetase 99.21
KOG0097|consensus215 99.21
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 99.2
PLN00023334 GTP-binding protein; Provisional 99.19
cd00553248 NAD_synthase NAD+ synthase is a homodimer, which c 99.19
TIGR00032394 argG argininosuccinate synthase. argG in bacteria, 99.19
TIGR00364201 exsB protein. This protein family is represented b 99.18
PRK13980265 NAD synthetase; Provisional 99.17
KOG0075|consensus186 99.16
KOG0410|consensus410 99.15
KOG0091|consensus213 99.15
COG0536369 Obg Predicted GTPase [General function prediction 99.15
KOG0079|consensus198 99.15
PRK00509399 argininosuccinate synthase; Provisional 99.15
KOG0076|consensus197 99.15
cd01999385 Argininosuccinate_Synthase Argininosuccinate synth 99.14
TIGR00342371 thiazole biosynthesis/tRNA modification protein Th 99.13
COG1100219 GTPase SAR1 and related small G proteins [General 99.13
PF09439181 SRPRB: Signal recognition particle receptor beta s 99.12
cd0370887 GTPBP_III Domain III of the GP-1 family of GTPase. 99.1
cd0370693 mtEFTU_III Domain III of mitochondrial EF-TU (mtEF 99.1
cd0370790 EFTU_III Domain III of elongation factor (EF) Tu. 99.09
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 99.07
KOG0070|consensus181 99.07
PRK04527400 argininosuccinate synthase; Provisional 99.07
PRK11106231 queuosine biosynthesis protein QueC; Provisional 99.06
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 99.05
COG4917148 EutP Ethanolamine utilization protein [Amino acid 99.04
cd01996154 Alpha_ANH_like_III This is a subfamily of Adenine 99.04
PF03054356 tRNA_Me_trans: tRNA methyl transferase; InterPro: 99.04
PLN00200404 argininosuccinate synthase; Provisional 99.03
PRK09435332 membrane ATPase/protein kinase; Provisional 99.0
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 99.0
KOG0088|consensus218 98.99
cd0409497 selB_III This family represents the domain of elon 98.98
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 98.97
PRK01269482 tRNA s(4)U8 sulfurtransferase; Provisional 98.97
PRK01565394 thiamine biosynthesis protein ThiI; Provisional 98.95
PTZ00099176 rab6; Provisional 98.94
KOG1532|consensus366 98.94
KOG0081|consensus219 98.94
PRK09601364 GTP-binding protein YchF; Reviewed 98.94
PRK13768253 GTPase; Provisional 98.93
KOG0395|consensus196 98.93
COG0482356 TrmU Predicted tRNA(5-methylaminomethyl-2-thiourid 98.92
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 98.92
TIGR03573343 WbuX N-acetyl sugar amidotransferase. This enzyme 98.92
cd03688113 eIF2_gamma_II eIF2_gamma_II: this subfamily repres 98.9
PRK09602396 translation-associated GTPase; Reviewed 98.89
PTZ00258390 GTP-binding protein; Provisional 98.89
cd0369284 mtIF2_IVc mtIF2_IVc: this family represents the C2 98.89
KOG0083|consensus192 98.89
TIGR02836492 spore_IV_A stage IV sporulation protein A. A compa 98.88
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 98.87
cd01986103 Alpha_ANH_like Adenine nucleotide alpha hydrolases 98.87
KOG0090|consensus238 98.84
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 98.83
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 98.83
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 98.82
PF06508209 QueC: Queuosine biosynthesis protein QueC; InterPr 98.81
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 98.8
KOG0071|consensus180 98.8
KOG4252|consensus246 98.8
PF05049376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 98.8
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 98.79
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 98.77
PTZ00323294 NAD+ synthase; Provisional 98.74
KOG0077|consensus193 98.74
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 98.72
KOG0072|consensus182 98.71
PF02540242 NAD_synthase: NAD synthase; InterPro: IPR022310 NA 98.71
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 98.68
KOG2840|consensus347 98.68
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 98.67
KOG2644|consensus282 98.67
KOG1486|consensus364 98.66
TIGR00101199 ureG urease accessory protein UreG. This model rep 98.66
cd01994194 Alpha_ANH_like_IV This is a subfamily of Adenine n 98.64
KOG2486|consensus320 98.64
KOG1490|consensus620 98.62
KOG0074|consensus185 98.62
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 98.61
TIGR00993763 3a0901s04IAP86 chloroplast protein import componen 98.61
cd0134283 Translation_Factor_II_like Translation_Factor_II_l 98.56
COG0603222 Predicted PP-loop superfamily ATPase [General func 98.53
COG0519315 GuaA GMP synthase, PP-ATPase domain/subunit [Nucle 98.53
PF02568197 ThiI: Thiamine biosynthesis protein (ThiI); InterP 98.52
PRK00876326 nadE NAD synthetase; Reviewed 98.52
COG0012372 Predicted GTPase, probable translation factor [Tra 98.5
PRK02628679 nadE NAD synthetase; Reviewed 98.45
KOG2805|consensus377 98.44
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 98.43
KOG3886|consensus295 98.43
PRK00768268 nadE NAD synthetase; Reviewed 98.41
COG2117198 Predicted subunit of tRNA(5-methylaminomethyl-2-th 98.41
KOG1707|consensus625 98.41
PF0314474 GTP_EFTU_D2: Elongation factor Tu domain 2; InterP 98.41
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 98.4
TIGR03679218 arCOG00187 arCOG00187 universal archaeal metal-bin 98.38
KOG0393|consensus198 98.36
PRK05370447 argininosuccinate synthase; Validated 98.35
COG5019373 CDC3 Septin family protein [Cell division and chro 98.35
PF1457881 GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1 98.34
KOG0448|consensus749 98.27
cd0369085 Tet_II Tet_II: This subfamily represents domain II 98.2
KOG1547|consensus336 98.19
PRK13981540 NAD synthetase; Provisional 98.17
KOG1673|consensus205 98.17
PF00764388 Arginosuc_synth: Arginosuccinate synthase; InterPr 98.17
cd0369986 lepA_II lepA_II: This subfamily represents the dom 98.14
cd0408883 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represen 98.12
cd0409283 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondri 98.12
KOG1954|consensus532 98.12
COG0171268 NadE NAD synthase [Coenzyme metabolism] 98.12
KOG3883|consensus198 98.11
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.09
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 98.09
cd01991269 Asn_Synthase_B_C The C-terminal domain of Asparagi 98.07
KOG1487|consensus358 98.04
PRK10416318 signal recognition particle-docking protein FtsY; 98.02
KOG2655|consensus366 98.01
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 97.99
cd0368985 RF3_II RF3_II: this subfamily represents the domai 97.98
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.98
KOG3905|consensus473 97.97
TIGR00064272 ftsY signal recognition particle-docking protein F 97.94
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 97.94
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 97.93
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 97.92
cd0369186 BipA_TypA_II BipA_TypA_II: domain II of BipA (also 97.92
PRK14974336 cell division protein FtsY; Provisional 97.92
KOG0096|consensus216 97.92
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 97.91
cd0409181 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondri 97.9
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 97.87
COG0137403 ArgG Argininosuccinate synthase [Amino acid transp 97.86
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 97.86
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 97.86
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 97.85
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 97.85
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.83
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-83  Score=676.23  Aligned_cols=417  Identities=33%  Similarity=0.505  Sum_probs=400.9

Q ss_pred             cCCCeeEEEEEecCCCChHHHHhHHHhccCCCChHHHHHHhHHHhhcccCCCceeeeeccCCchhhhccceeEeeceeee
Q psy3751         320 KKHSLLRFITAGSVDDGKSTLIGRLLFDSKNIFIDQLDAVSRTKYKRVMSGHNIDLSLLTDGLESEREQGITIDVAYRYF  399 (967)
Q Consensus       320 ~~~~~~~v~ivG~~~~GKSTLi~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~e~~~g~Ti~~~~~~~  399 (967)
                      ..++.+|++++||+|||||||+++|++++|.++.+.++++++.+...|+  ++|.++|+||++++||+||+|++.++..|
T Consensus         3 ~~Kph~nl~~iGHVD~GKSTl~GrLly~~G~id~~tmeK~~~ea~~~gK--~sf~fawvlD~tkeERerGvTi~~~~~~f   80 (428)
T COG5256           3 SEKPHLNLVFIGHVDAGKSTLVGRLLYDLGEIDKRTMEKLEKEAKELGK--ESFKFAWVLDKTKEERERGVTIDVAHSKF   80 (428)
T ss_pred             CCCCceEEEEEcCCCCCchhhhhhhHHHhCCCCHHHHHHHHHHHHhcCC--CceEEEEEecCChhHHhcceEEEEEEEEe
Confidence            4578999999999999999999999999999999999999999999999  88999999999999999999999999999


Q ss_pred             ecCCceEEEeeChhhHHHHHHHHhhcccCCEEEEEEeCCCCCCCCCCCchhhHHHHHHHHHHcCCCeEEEEEecCCccCc
Q psy3751         400 NTPKRKFIIADTPGHEQYTRNMITGASTADAVIILIDASKIKFNPSVNLLTQTKRHSIIAHLLRIKHIIIAVNKMDLINY  479 (967)
Q Consensus       400 ~~~~~~~~liDtpG~~~~~~~~~~~~~~aD~~ilVvda~~~~~~~~~g~~~~t~~~~~~~~~~~~~~iivviNK~D~~~~  479 (967)
                      +++.+.++|+|||||+||+++|+.++++||++||||||..++||++++..+||+||+.+++.+|+.++||++||||+++|
T Consensus        81 et~k~~~tIiDaPGHrdFvknmItGasqAD~aVLVV~a~~~efE~g~~~~gQtrEH~~La~tlGi~~lIVavNKMD~v~w  160 (428)
T COG5256          81 ETDKYNFTIIDAPGHRDFVKNMITGASQADVAVLVVDARDGEFEAGFGVGGQTREHAFLARTLGIKQLIVAVNKMDLVSW  160 (428)
T ss_pred             ecCCceEEEeeCCchHHHHHHhhcchhhccEEEEEEECCCCccccccccCCchhHHHHHHHhcCCceEEEEEEccccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHHHHHHcCCc--cceEEeccccCCCcccccccCCCCCCCCcHHHHhhcccCCCcCCCCCceeeEEEee
Q psy3751         480 NQIFYKRIVYAYKKFAEDIHFQ--NINTIPISALNGDNIISASNNMLWYNGPTLISLLESLNTNEKIDKKPLRFPVQLVA  557 (967)
Q Consensus       480 ~~~~~~~i~~~~~~~~~~~~~~--~~~ii~iSa~~g~gi~~l~~~~~w~~~~~L~~~l~~~~~~~~~~~~~~~~~i~~v~  557 (967)
                      ++++|+++++++..+++.+|+.  +++|||+||++|+|+.+.++.++||+||||+++|+.+..|++..++||++||++++
T Consensus       161 de~rf~ei~~~v~~l~k~~G~~~~~v~FIPiSg~~G~Nl~~~s~~~pWY~GpTLleaLd~~~~p~~~~d~Plr~pI~~v~  240 (428)
T COG5256         161 DEERFEEIVSEVSKLLKMVGYNPKDVPFIPISGFKGDNLTKKSENMPWYKGPTLLEALDQLEPPERPLDKPLRLPIQDVY  240 (428)
T ss_pred             CHHHHHHHHHHHHHHHHHcCCCccCCeEEecccccCCcccccCcCCcCccCChHHHHHhccCCCCCCCCCCeEeEeeeEE
Confidence            9999999999999999999986  68999999999999999999999999999999999999999989999999999999


Q ss_pred             cCCCccCCCceEEEEEEEeeeecCCCEEEEecCCcEEEEEEEEeCccccceeecCCeEEEEEcc--ccCCCCCcccccCC
Q psy3751         558 RHCGHISKDFRGYMGRIESGIIKKNDCLIVEPSGKKATIKDIQMLNKSLDMAITGQSVTLIIKE--YLDISRGNMLVSPF  635 (967)
Q Consensus       558 ~~~~~~~~~~~v~~G~v~~G~l~~g~~v~i~p~~~~~~V~~i~~~~~~v~~a~~G~~v~l~l~~--~~~i~~G~vl~~~~  635 (967)
                      .+.+.|    +++.|||++|.|++||+|++.|.+....|+||++++.++++|.|||+|++++++  ..||+|||++++++
T Consensus       241 ~i~~~g----tv~vGrVEsG~i~~g~~v~~~p~~~~~evksie~~~~~~~~a~~GD~i~~~vrgv~~~dI~~Gdv~~~~~  316 (428)
T COG5256         241 SISGIG----TVPVGRVESGVIKPGQKVTFMPAGVVGEVKSIEMHHEEISQAEPGDNVGFNVRGVEKNDIRRGDVIGHSD  316 (428)
T ss_pred             EecCCc----eEEEEEEeeeeeccCCEEEEecCcceEEEeeeeecccccccCCCCCeEEEEecCCchhccCCccEeccCC
Confidence            988887    999999999999999999999999999999999999999999999999999996  56899999999999


Q ss_pred             CCccccceeEEEEEEecc-ccccCCceEEEEEeeeEEEEEEeeeeeeeecCCCccC--CCccccCCCEEEEEEeecCcee
Q psy3751         636 KRPVSLRSINANLCWLSE-ESLDLRRKYLLKHSTNQILSRILKINALLNINTQKWC--PPKLLDLNDIGCVTINIYEPIS  712 (967)
Q Consensus       636 ~~~~~~~~f~a~i~~~~~-~~i~~g~~~~~~~~~~~~~~~i~~i~~~~d~~~~~~~--~~~~l~~g~~a~v~l~l~~pi~  712 (967)
                      +++..+.+|.|++.++.+ .+|.+||++++|+|+.+++|++.+|..++|+.+++..  +|.+++.|+.+.|++++.+|+|
T Consensus       317 n~~t~s~~f~a~i~vl~~p~~i~~Gyt~vlh~hta~~a~~~~~l~~k~d~~t~k~~~~~p~f~k~g~~~iv~i~~~kP~~  396 (428)
T COG5256         317 NPPTVSPEFTAQIIVLWHPGIITSGYTPVLHAHTAQVACRIAELLSKLDPRTGKKLEENPQFLKRGDAAIVKIEPEKPLC  396 (428)
T ss_pred             CCcccccceEEEEEEEecCccccCCCccEEEecccceeeeHHHHHHhhCcccccccccChhhhhcCceEEEEEEecCceE
Confidence            999999999999999987 8899999999999999999999999999999877653  7999999999999999999999


Q ss_pred             eccccCccCCccceeecccccccceEEEEEec
Q psy3751         713 VDSYDNIRSTGSFILIDEITFQTVAAVYIIGA  744 (967)
Q Consensus       713 ~~~~~~~~~~grfil~d~~~~~~~~~~~~vg~  744 (967)
                      ++.+++++.+|||+|||  .++|++.|.++.+
T Consensus       397 ~e~~~~~~~Lgrfalrd--~g~tIA~G~v~~v  426 (428)
T COG5256         397 LEKVSEIPQLGRFALRD--MGQTIAAGKVLEV  426 (428)
T ss_pred             eeecccCCccceEEEEe--CCCeEEeEEEEec
Confidence            99999999999999998  4779999888754

>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>KOG0458|consensus Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>KOG0459|consensus Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>KOG0460|consensus Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>PRK12563 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>TIGR02039 CysD sulfate adenylyltransferase, small subunit Back     alignment and domain information
>PRK05253 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>COG0007 CysG Uroporphyrinogen-III methylase [Coenzyme metabolism] Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2875 CobM Precorrin-4 methylase [Coenzyme metabolism] Back     alignment and domain information
>KOG0463|consensus Back     alignment and domain information
>PRK07168 bifunctional uroporphyrinogen-III methyltransferase/uroporphyrinogen-III synthase; Reviewed Back     alignment and domain information
>KOG0461|consensus Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>PRK06136 uroporphyrin-III C-methyltransferase; Reviewed Back     alignment and domain information
>PRK15473 cbiF cobalt-precorrin-4 C(11)-methyltransferase; Provisional Back     alignment and domain information
>PLN02625 uroporphyrin-III C-methyltransferase Back     alignment and domain information
>KOG1143|consensus Back     alignment and domain information
>KOG0462|consensus Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01469 cobA_cysG_Cterm uroporphyrin-III C-methyltransferase Back     alignment and domain information
>KOG0052|consensus Back     alignment and domain information
>TIGR01465 cobM_cbiF precorrin-4 C11-methyltransferase Back     alignment and domain information
>TIGR02057 PAPS_reductase phosphoadenosine phosphosulfate reductase, thioredoxin dependent Back     alignment and domain information
>COG0175 CysH 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase and related enzymes [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>KOG1527|consensus Back     alignment and domain information
>TIGR00434 cysH phosophoadenylyl-sulfate reductase (thioredoxin) Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>PRK15478 cbiH cobalt-precorrin-3B C(17)-methyltransferase; Provisional Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>TIGR00522 dph5 diphthine synthase Back     alignment and domain information
>PRK02090 phosphoadenosine phosphosulfate reductase; Provisional Back     alignment and domain information
>PRK08557 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>PRK05765 precorrin-3B C17-methyltransferase; Provisional Back     alignment and domain information
>PRK05948 precorrin-2 methyltransferase; Provisional Back     alignment and domain information
>PTZ00175 diphthine synthase; Provisional Back     alignment and domain information
>PRK13794 hypothetical protein; Provisional Back     alignment and domain information
>PF00590 TP_methylase: Tetrapyrrole (Corrin/Porphyrin) Methylases Note this Prosite entry does not include all members of this family Back     alignment and domain information
>COG2243 CobF Precorrin-2 methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK05990 precorrin-2 C(20)-methyltransferase; Reviewed Back     alignment and domain information
>PRK14994 SAM-dependent 16S ribosomal RNA C1402 ribose 2'-O-methyltransferase; Provisional Back     alignment and domain information
>PF01507 PAPS_reduct: Phosphoadenosine phosphosulfate reductase family; InterPro: IPR002500 This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase Back     alignment and domain information
>TIGR01467 cobI_cbiL precorrin-2 C20-methyltransferase Back     alignment and domain information
>PRK05576 cobalt-precorrin-2 C(20)-methyltransferase; Validated Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PRK13795 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02467 CbiE precorrin-6y C5,15-methyltransferase (decarboxylating), CbiE subunit Back     alignment and domain information
>TIGR01466 cobJ_cbiH precorrin-3B C17-methyltransferase Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>TIGR02055 APS_reductase thioredoxin-dependent adenylylsulfate APS reductase Back     alignment and domain information
>PRK05787 cobalt-precorrin-6Y C(5)-methyltransferase; Validated Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>COG1010 CobJ Precorrin-3B methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>PRK05991 precorrin-3B C17-methyltransferase; Provisional Back     alignment and domain information
>COG2241 CobL Precorrin-6B methylase 1 [Coenzyme metabolism] Back     alignment and domain information
>PRK08576 hypothetical protein; Provisional Back     alignment and domain information
>PRK08284 precorrin 6A synthase; Provisional Back     alignment and domain information
>PRK04160 diphthine synthase; Provisional Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>TIGR02434 CobF precorrin-6A synthase (deacetylating) Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>KOG0466|consensus Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>KOG0189|consensus Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>KOG1145|consensus Back     alignment and domain information
>PRK06850 hypothetical protein; Provisional Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>TIGR03183 DNA_S_dndC putative sulfurtransferase DndC Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0313 Predicted methyltransferases [General function prediction only] Back     alignment and domain information
>cd01713 PAPS_reductase This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>KOG0465|consensus Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>COG1798 DPH5 Diphthamide biosynthesis methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>TIGR00096 probable S-adenosylmethionine-dependent methyltransferase, YraL family Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>KOG0467|consensus Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>KOG3123|consensus Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>KOG1144|consensus Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>KOG0469|consensus Back     alignment and domain information
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain Back     alignment and domain information
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>PF01171 ATP_bind_3: PP-loop family; InterPro: IPR011063 This entry represents the PP-loop motif superfamily [,] Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>KOG0464|consensus Back     alignment and domain information
>COG3969 Predicted phosphoadenosine phosphosulfate sulfotransferase [General function prediction only] Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04095 CysN_NoDQ_III TCysN_NoDQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu Back     alignment and domain information
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>KOG0468|consensus Back     alignment and domain information
>cd03705 EF1_alpha_III Domain III of EF-1 Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd04093 HBS1_C HBS1_C: this family represents the C-terminal domain of Hsp70 subfamily B suppressor 1 (HBS1) which is homologous to the domain III of EF-1alpha Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd03704 eRF3c_III This family represents eEF1alpha-like C-terminal region of eRF3 homologous to the domain III of EF-Tu Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>KOG0092|consensus Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>KOG0084|consensus Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd03693 EF1_alpha_II EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>cd01513 Translation_factor_III Domain III of Elongation factor (EF) Tu (EF-TU) and EF-G Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd03698 eRF3_II_like eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>KOG0098|consensus Back     alignment and domain information
>TIGR00268 conserved hypothetical protein TIGR00268 Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>KOG0094|consensus Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PRK00919 GMP synthase subunit B; Validated Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd03695 CysN_NodQ_II CysN_NodQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>KOG0078|consensus Back     alignment and domain information
>cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>COG1606 ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only] Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR00884 guaA_Cterm GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK00143 mnmA tRNA-specific 2-thiouridylase MnmA; Reviewed Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>PF03143 GTP_EFTU_D3: Elongation factor Tu C-terminal domain; InterPro: IPR004160 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd01712 ThiI ThiI is required for thiazole synthesis in the thiamine biosynthesis pathway Back     alignment and domain information
>cd01997 GMP_synthase_C The C-terminal domain of GMP synthetase Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>KOG0394|consensus Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd03697 EFTU_II EFTU_II: Elongation factor Tu domain II Back     alignment and domain information
>COG3956 Protein containing tetrapyrrole methyltransferase domain and MazG-like (predicted pyrophosphatase) domain [General function prediction only] Back     alignment and domain information
>cd03694 GTPBP_II Domain II of the GP-1 family of GTPase Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd03696 selB_II selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>KOG0086|consensus Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PRK08349 hypothetical protein; Validated Back     alignment and domain information
>cd01998 tRNA_Me_trans tRNA methyl transferase Back     alignment and domain information
>TIGR00420 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase Back     alignment and domain information
>KOG0073|consensus Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>KOG0080|consensus Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>PRK14561 hypothetical protein; Provisional Back     alignment and domain information
>cd01995 ExsB ExsB is a transcription regulator related protein Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>PRK14665 mnmA tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>KOG0087|consensus Back     alignment and domain information
>TIGR00552 nadE NAD+ synthetase Back     alignment and domain information
>KOG0093|consensus Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>PRK14664 tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>PRK13820 argininosuccinate synthase; Provisional Back     alignment and domain information
>KOG0095|consensus Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK08384 thiamine biosynthesis protein ThiI; Provisional Back     alignment and domain information
>PLN02347 GMP synthetase Back     alignment and domain information
>KOG0097|consensus Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>cd00553 NAD_synthase NAD+ synthase is a homodimer, which catalyzes the final step in de novo nicotinamide adenine dinucleotide (NAD+) biosynthesis, an amide transfer from either ammonia or glutamine to nicotinic acid adenine dinucleotide (NaAD) Back     alignment and domain information
>TIGR00032 argG argininosuccinate synthase Back     alignment and domain information
>TIGR00364 exsB protein Back     alignment and domain information
>PRK13980 NAD synthetase; Provisional Back     alignment and domain information
>KOG0075|consensus Back     alignment and domain information
>KOG0410|consensus Back     alignment and domain information
>KOG0091|consensus Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0079|consensus Back     alignment and domain information
>PRK00509 argininosuccinate synthase; Provisional Back     alignment and domain information
>KOG0076|consensus Back     alignment and domain information
>cd01999 Argininosuccinate_Synthase Argininosuccinate synthase Back     alignment and domain information
>TIGR00342 thiazole biosynthesis/tRNA modification protein ThiI Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd03708 GTPBP_III Domain III of the GP-1 family of GTPase Back     alignment and domain information
>cd03706 mtEFTU_III Domain III of mitochondrial EF-TU (mtEF-TU) Back     alignment and domain information
>cd03707 EFTU_III Domain III of elongation factor (EF) Tu Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>KOG0070|consensus Back     alignment and domain information
>PRK04527 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK11106 queuosine biosynthesis protein QueC; Provisional Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>cd01996 Alpha_ANH_like_III This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>PF03054 tRNA_Me_trans: tRNA methyl transferase; InterPro: IPR004506 tRNA-specific 2-thiouridylase catalyzes the 2-thiolation of uridine at the wobble position (U34) of tRNA, leading to the formation of s(2)U34 Back     alignment and domain information
>PLN00200 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>KOG0088|consensus Back     alignment and domain information
>cd04094 selB_III This family represents the domain of elongation factor SelB, homologous to domain III of EF-Tu Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional Back     alignment and domain information
>PRK01565 thiamine biosynthesis protein ThiI; Provisional Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>KOG1532|consensus Back     alignment and domain information
>KOG0081|consensus Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>KOG0395|consensus Back     alignment and domain information
>COG0482 TrmU Predicted tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03573 WbuX N-acetyl sugar amidotransferase Back     alignment and domain information
>cd03688 eIF2_gamma_II eIF2_gamma_II: this subfamily represents the domain II of the gamma subunit of eukaryotic translation initiation factor 2 (eIF2-gamma) found in Eukaryota and Archaea Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>cd03692 mtIF2_IVc mtIF2_IVc: this family represents the C2 subdomain of domain IV of mitochondrial translation initiation factor 2 (mtIF2) which adopts a beta-barrel fold displaying a high degree of structural similarity with domain II of the translation elongation factor EF-Tu Back     alignment and domain information
>KOG0083|consensus Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>cd01986 Alpha_ANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases and ATP sulphurylases Back     alignment and domain information
>KOG0090|consensus Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>PF06508 QueC: Queuosine biosynthesis protein QueC; InterPro: IPR018317 This protein family is represented by a single member in nearly every completed large (> 1000 genes) prokaryotic genome Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>KOG0071|consensus Back     alignment and domain information
>KOG4252|consensus Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PTZ00323 NAD+ synthase; Provisional Back     alignment and domain information
>KOG0077|consensus Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>KOG0072|consensus Back     alignment and domain information
>PF02540 NAD_synthase: NAD synthase; InterPro: IPR022310 NAD+ synthase (6 Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>KOG2840|consensus Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>KOG2644|consensus Back     alignment and domain information
>KOG1486|consensus Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>cd01994 Alpha_ANH_like_IV This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>KOG2486|consensus Back     alignment and domain information
>KOG1490|consensus Back     alignment and domain information
>KOG0074|consensus Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>cd01342 Translation_Factor_II_like Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins Back     alignment and domain information
>COG0603 Predicted PP-loop superfamily ATPase [General function prediction only] Back     alignment and domain information
>COG0519 GuaA GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>PF02568 ThiI: Thiamine biosynthesis protein (ThiI); InterPro: IPR020536 Thiamine pyrophosphate (TPP) is synthesized de novo in many bacteria and is a required cofactor for many enzymes in the cell Back     alignment and domain information
>PRK00876 nadE NAD synthetase; Reviewed Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK02628 nadE NAD synthetase; Reviewed Back     alignment and domain information
>KOG2805|consensus Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>KOG3886|consensus Back     alignment and domain information
>PRK00768 nadE NAD synthetase; Reviewed Back     alignment and domain information
>COG2117 Predicted subunit of tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>PF03144 GTP_EFTU_D2: Elongation factor Tu domain 2; InterPro: IPR004161 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03679 arCOG00187 arCOG00187 universal archaeal metal-binding-domain/4Fe-4S-binding-domain containing ABC transporter, ATP-binding protein Back     alignment and domain information
>KOG0393|consensus Back     alignment and domain information
>PRK05370 argininosuccinate synthase; Validated Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>PF14578 GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1G7R_A 1G7S_A 1G7T_A 1XE1_A Back     alignment and domain information
>KOG0448|consensus Back     alignment and domain information
>cd03690 Tet_II Tet_II: This subfamily represents domain II of ribosomal protection proteins Tet(M) and Tet(O) Back     alignment and domain information
>KOG1547|consensus Back     alignment and domain information
>PRK13981 NAD synthetase; Provisional Back     alignment and domain information
>KOG1673|consensus Back     alignment and domain information
>PF00764 Arginosuc_synth: Arginosuccinate synthase; InterPro: IPR001518 Argininosuccinate synthase (6 Back     alignment and domain information
>cd03699 lepA_II lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane Back     alignment and domain information
>cd04088 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes Back     alignment and domain information
>cd04092 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes Back     alignment and domain information
>KOG1954|consensus Back     alignment and domain information
>COG0171 NadE NAD synthase [Coenzyme metabolism] Back     alignment and domain information
>KOG3883|consensus Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>cd01991 Asn_Synthase_B_C The C-terminal domain of Asparagine Synthase B Back     alignment and domain information
>KOG1487|consensus Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>KOG2655|consensus Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>cd03689 RF3_II RF3_II: this subfamily represents the domain II of bacterial Release Factor 3 (RF3) Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG3905|consensus Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>cd03691 BipA_TypA_II BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>KOG0096|consensus Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>cd04091 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>COG0137 ArgG Argininosuccinate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query967
1zun_B434 Crystal Structure Of A Gtp-Regulated Atp Sulfurylas 1e-102
1zun_A325 Crystal Structure Of A Gtp-Regulated Atp Sulfurylas 3e-58
1jny_A435 Crystal Structure Of Sulfolobus Solfataricus Elonga 3e-56
3agj_A437 Crystal Structure Of Archaeal Pelota And Gtp-bound 3e-56
3vmf_A440 Archaeal Protein Length = 440 4e-56
1f60_A458 Crystal Structure Of The Yeast Elongation Factor Co 2e-45
3izq_1611 Structure Of The Dom34-Hbs1-Gdpnp Complex Bound To 4e-43
3p26_A483 Crystal Structure Of S. Cerevisiae Hbs1 Protein (Ap 2e-42
3p27_A483 Crystal Structure Of S. Cerevisiae Hbs1 Protein (Gd 6e-40
3mca_A592 Structure Of The Dom34-Hbs1 Complex And Implication 7e-37
1pjq_A457 Structure And Function Of Cysg, The Multifunctional 4e-36
1pjt_A457 The Structure Of The Ser128ala Point-mutant Variant 4e-36
1r5b_A467 Crystal Structure Analysis Of Sup35 Length = 467 2e-34
2ybq_A292 The X-Ray Structure Of The Sam-Dependent Uroporphyr 3e-34
2ybo_A294 The X-Ray Structure Of The Sam-Dependent Uroporphyr 3e-34
3j2k_7439 Cryo-Em Structure Of The Mammalian Erf1-Erf3-Associ 3e-34
1s4d_A280 Crystal Structure Analysis Of The S-adenosyl-l-meth 6e-25
1v9a_A239 Crystal Structure Of Uroporphyrin-Iii C-Methyl Tran 5e-23
1ve2_A235 Crystal Structure Of Uroporphyrin-Iii-C-Methyltrans 3e-21
4e16_A253 Precorrin-4 C(11)-Methyltransferase From Clostridiu 6e-19
1cbf_A285 The X-ray Structure Of A Cobalamin Biosynthetic Enz 1e-18
2cbf_A234 The X-Ray Structure Of A Cobalamin Biosynthetic Enz 2e-18
1d2e_A397 Crystal Structure Of Mitochondrial Ef-Tu In Complex 1e-17
1eft_A405 The Crystal Structure Of Elongation Factor Ef-Tu Fr 2e-17
1ttt_A405 Phe-Trna, Elongation Factor Ef-Tu:gdpnp Ternary Com 3e-17
4abr_Z405 Complex Of Smpb, A Tmrna Fragment And Ef-Tu-Gdp-Kir 3e-17
1exm_A405 Crystal Structure Of Thermus Thermophilus Elongatio 4e-17
2y0u_Z405 The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bou 7e-17
2c78_A405 Ef-Tu Complexed With A Gtp Analog And The Antibioti 8e-17
2c77_A405 Ef-Tu Complexed With A Gtp Analog And The Antibioti 1e-16
2y0y_Z405 The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bo 2e-16
2wrn_Z406 The Crystal Structure Of The 70s Ribosome Bound To 2e-16
1aip_A405 Ef-Tu Ef-Ts Complex From Thermus Thermophilus Lengt 2e-16
3agp_A 1289 Structure Of Viral Polymerase Form I Length = 1289 3e-16
1dg1_G394 Whole, Unmodified, Ef-Tu(Elongation Factor Tu). Len 6e-16
1efu_A385 Elongation Factor Complex Ef-TuEF-Ts From Escherich 7e-16
1efc_A393 Intact Elongation Factor From E.Coli Length = 393 7e-16
1d8t_A393 Crystal Structure Of Elongation Factor, Tu (Ef-Tu-M 7e-16
1ob2_A393 E. Coli Elongation Factor Ef-Tu Complexed With The 7e-16
3u6b_A394 Ef-Tu (Escherichia Coli) In Complex With Nvp-Ldi028 7e-16
3mmp_A678 Structure Of The Qb Replicase, An Rna-Dependent Rna 1e-15
1xb2_A409 Crystal Structure Of Bos Taurus Mitochondrial Elong 1e-15
1efm_A379 Structure Of The Gdp Domain Of Ef-Tu And Location O 5e-15
2hdn_B335 Trypsin-Modified Elongation Factor Tu In Complex Wi 6e-15
2hcj_B335 "trypsin-Modified Elongation Factor Tu In Complex W 6e-15
3ndc_A264 Crystal Structure Of Precorrin-4 C11-Methyltransfer 7e-14
3nei_A281 Crystal Structure Of Precorrin-4 C11-Methyltransfer 7e-14
1mj1_A405 Fitting The Ternary Complex Of Ef-TuTRNAGTP AND RIB 1e-13
4ac9_A482 Crystal Structure Of Translation Elongation Factor 2e-12
1kk3_A410 Structure Of The Wild-Type Large Gamma Subunit Of I 3e-11
1kjz_A410 Structure Of The Large Gamma Subunit Of Initiation 5e-11
2d74_A419 Crystal Structure Of Translation Initiation Factor 2e-10
1kk0_A410 Structure Of The Large Gamma Subunit Of Initiation 4e-10
1s0u_A408 Eif2gamma Apo Length = 408 5e-09
3pen_A403 Structure Of Archaeal Initiation Factor Aif2gamma S 9e-09
3sjz_A409 The Structure Of Aif2gamma Subunit Delta 41-45 From 1e-08
2pmd_A415 The Structures Of Aif2gamma Subunit From The Archae 1e-08
2aho_A414 Structure Of The Archaeal Initiation Factor Eif2 Al 1e-08
3j25_A638 Structural Basis For Tetm-Mediated Tetracycline Res 4e-05
3izy_P537 Mammalian Mitochondrial Translation Initiation Fact 5e-05
3vqt_A548 Crystal Structure Analysis Of The Translation Facto 1e-04
2ywe_A600 Crystal Structure Of Lepa From Aquifex Aeolicus Len 2e-04
2ywg_A600 Crystal Structure Of Gtp-Bound Lepa From Aquifex Ae 3e-04
2lkc_A178 Free B.St If2-G2 Length = 178 4e-04
>pdb|1ZUN|B Chain B, Crystal Structure Of A Gtp-Regulated Atp Sulfurylase Heterodimer From Pseudomonas Syringae Length = 434 Back     alignment and structure 
Iteration: 1

 Score =  371 bits (952), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 198/425 (46%), Positives = 273/425 (64%), Gaps = 13/425 (3%)
Query: 320 KKHSLLRFITAGSVDDGKSTLIGRLLFDSKNIFIDQLDAVSRTKYKRVMSGHNIDLSLLT 379
           ++   LRF+T G+VDDGKSTLIGRLL DSK I+ D L+A++R   K   +G ++DL+LL 
Sbjct: 20  ERKEXLRFLTCGNVDDGKSTLIGRLLHDSKXIYEDHLEAITRDSKKSGTTGDDVDLALLV 79
Query: 380 DGLESEREQGITIDVAYRYFNTPKRKFIIADTPGHEQYTRNMITGASTADAVIILIDASK 439
           DGL++EREQGITIDVAYRYF+T KRKFIIADTPGHEQYTRN  TGAST D  IIL+DA  
Sbjct: 80  DGLQAEREQGITIDVAYRYFSTAKRKFIIADTPGHEQYTRNXATGASTCDLAIILVDA-- 137
Query: 440 IKFNPSVNLLTQTKRHSIIAHLLRIKHIIIAVNKMDLINYNQIFYKRIVYAYKKFAEDIH 499
                   + TQT+RHS IA LL IKHI++A+NK DL  +++  ++ I   Y KFAE I 
Sbjct: 138 -----RYGVQTQTRRHSYIASLLGIKHIVVAINKXDLNGFDERVFESIKADYLKFAEGIA 192
Query: 500 FQNINT--IPISALNGDNIISASNNMLWYNGPTLISLLESLNTNEKIDKKPLRFPVQLVA 557
           F+      +P SAL GDN+++ S    WY G +L  +LE++      +   LRFPVQ V 
Sbjct: 193 FKPTTXAFVPXSALKGDNVVNKSERSPWYAGQSLXEILETVEIASDRNYTDLRFPVQYVN 252
Query: 558 RHCGHISKDFRGYMGRIESGIIKKNDCLIVEPSGKKATIKDIQMLNKSLDMAITGQSVTL 617
           R     + +FRG+ G + SGI+ K D ++V PSGK + +K I      L+ A  GQ+VTL
Sbjct: 253 RP----NLNFRGFAGTLASGIVHKGDEIVVLPSGKSSRVKSIVTFEGELEQAGPGQAVTL 308
Query: 618 IIKEYLDISRGNMLVSPFKRPVSLRSINANLCWLSEESLDLRRKYLLKHSTNQILSRILK 677
             ++ +DISRG++LV     P    + +A L W +EE     +KY +K +T+ +   I  
Sbjct: 309 TXEDEIDISRGDLLVHADNVPQVSDAFDAXLVWXAEEPXLPGKKYDIKRATSYVPGSIAS 368
Query: 678 INALLNINTQKWCPPKLLDLNDIGCVTINIYEPISVDSYDNIRSTGSFILIDEITFQTVA 737
           I   +++NT +  P   L LN+IG V +++  PI++D Y + R+TG+FI+ID +T  TVA
Sbjct: 369 ITHRVDVNTLEEGPASSLQLNEIGRVKVSLDAPIALDGYSSNRTTGAFIVIDRLTNGTVA 428
Query: 738 AVYII 742
           A  II
Sbjct: 429 AGXII 433
>pdb|1ZUN|A Chain A, Crystal Structure Of A Gtp-Regulated Atp Sulfurylase Heterodimer From Pseudomonas Syringae Length = 325 Back     alignment and structure
>pdb|1JNY|A Chain A, Crystal Structure Of Sulfolobus Solfataricus Elongation Factor 1 Alpha In Complex With Gdp Length = 435 Back     alignment and structure
>pdb|3AGJ|A Chain A, Crystal Structure Of Archaeal Pelota And Gtp-bound Ef1 Alpha Complex Length = 437 Back     alignment and structure
>pdb|3VMF|A Chain A, Archaeal Protein Length = 440 Back     alignment and structure
>pdb|1F60|A Chain A, Crystal Structure Of The Yeast Elongation Factor Complex Eef1a:eef1ba Length = 458 Back     alignment and structure
>pdb|3IZQ|1 Chain 1, Structure Of The Dom34-Hbs1-Gdpnp Complex Bound To A Translating Ribosome Length = 611 Back     alignment and structure
>pdb|3P26|A Chain A, Crystal Structure Of S. Cerevisiae Hbs1 Protein (Apo-Form), A Translational Gtpase Involved In Rna Quality Control Pathways And Interacting With Dom34PELOTA Length = 483 Back     alignment and structure
>pdb|3P27|A Chain A, Crystal Structure Of S. Cerevisiae Hbs1 Protein (Gdp-Bound Form), A Translational Gtpase Involved In Rna Quality Control Pathways And Interacting With Dom34PELOTA Length = 483 Back     alignment and structure
>pdb|3MCA|A Chain A, Structure Of The Dom34-Hbs1 Complex And Implications For Its Role In No-Go Decay Length = 592 Back     alignment and structure
>pdb|1PJQ|A Chain A, Structure And Function Of Cysg, The Multifunctional MethyltransferaseDEHYDROGENASEFERROCHELATASE FOR Siroheme Synthesis Length = 457 Back     alignment and structure
>pdb|1PJT|A Chain A, The Structure Of The Ser128ala Point-mutant Variant Of Cysg, The Multifunctional Methyltransferase/dehydrogenase/ferrochelatase For Siroheme Synthesis Length = 457 Back     alignment and structure
>pdb|1R5B|A Chain A, Crystal Structure Analysis Of Sup35 Length = 467 Back     alignment and structure
>pdb|2YBQ|A Chain A, The X-Ray Structure Of The Sam-Dependent Uroporphyrinogen Iii Methyltransferase Nire From Pseudomonas Aeruginosa In Complex With Sah And Uroporphyrinogen Iii Length = 292 Back     alignment and structure
>pdb|2YBO|A Chain A, The X-Ray Structure Of The Sam-Dependent Uroporphyrinogen Iii Methyltransferase Nire From Pseudomonas Aeruginosa In Complex With Sah Length = 294 Back     alignment and structure
>pdb|3J2K|7 Chain 7, Cryo-Em Structure Of The Mammalian Erf1-Erf3-Associated Termination Complex Length = 439 Back     alignment and structure
>pdb|1S4D|A Chain A, Crystal Structure Analysis Of The S-adenosyl-l-methionine Dependent Uroporphyrinogen-iii C-methyltransferase Sumt Length = 280 Back     alignment and structure
>pdb|1V9A|A Chain A, Crystal Structure Of Uroporphyrin-Iii C-Methyl Transferase From Thermus Thermophilus Complexed With S-Adenyl Homocysteine Length = 239 Back     alignment and structure
>pdb|1VE2|A Chain A, Crystal Structure Of Uroporphyrin-Iii-C-Methyltransferase From Thermus Thermophilus Length = 235 Back     alignment and structure
>pdb|4E16|A Chain A, Precorrin-4 C(11)-Methyltransferase From Clostridium Difficile Length = 253 Back     alignment and structure
>pdb|1CBF|A Chain A, The X-ray Structure Of A Cobalamin Biosynthetic Enzyme, Cobalt Precorrin-4 Methyltransferase, Cbif Length = 285 Back     alignment and structure
>pdb|2CBF|A Chain A, The X-Ray Structure Of A Cobalamin Biosynthetic Enzyme, Cobalt Precorrin-4 Methyltransferase, Cbif, From Bacillus Megaterium, With The His-Tag Cleaved Off Length = 234 Back     alignment and structure
>pdb|1D2E|A Chain A, Crystal Structure Of Mitochondrial Ef-Tu In Complex With Gdp Length = 397 Back     alignment and structure
>pdb|1EFT|A Chain A, The Crystal Structure Of Elongation Factor Ef-Tu From Thermus Aquaticus In The Gtp Conformation Length = 405 Back     alignment and structure
>pdb|1TTT|A Chain A, Phe-Trna, Elongation Factor Ef-Tu:gdpnp Ternary Complex Length = 405 Back     alignment and structure
>pdb|4ABR|Z Chain Z, Complex Of Smpb, A Tmrna Fragment And Ef-Tu-Gdp-Kirromycin With The 70s Ribosome Length = 405 Back     alignment and structure
>pdb|1EXM|A Chain A, Crystal Structure Of Thermus Thermophilus Elongation Factor Tu (Ef-Tu) In Complex With The Gtp Analogue Gppnhp. Length = 405 Back     alignment and structure
>pdb|2Y0U|Z Chain Z, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A Near-Cognate Codon On The 70s Ribosome Length = 405 Back     alignment and structure
>pdb|2C78|A Chain A, Ef-Tu Complexed With A Gtp Analog And The Antibiotic Pulvomycin Length = 405 Back     alignment and structure
>pdb|2C77|A Chain A, Ef-Tu Complexed With A Gtp Analog And The Antibiotic Ge2270 A Length = 405 Back     alignment and structure
>pdb|2Y0Y|Z Chain Z, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To A Near-Cognate Codon On The 70s Ribosome Length = 405 Back     alignment and structure
>pdb|2WRN|Z Chain Z, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu And Trna (Part 1 Of 4). Length = 406 Back     alignment and structure
>pdb|1AIP|A Chain A, Ef-Tu Ef-Ts Complex From Thermus Thermophilus Length = 405 Back     alignment and structure
>pdb|3AGP|A Chain A, Structure Of Viral Polymerase Form I Length = 1289 Back     alignment and structure
>pdb|1DG1|G Chain G, Whole, Unmodified, Ef-Tu(Elongation Factor Tu). Length = 394 Back     alignment and structure
>pdb|1EFU|A Chain A, Elongation Factor Complex Ef-TuEF-Ts From Escherichia Coli Length = 385 Back     alignment and structure
>pdb|1EFC|A Chain A, Intact Elongation Factor From E.Coli Length = 393 Back     alignment and structure
>pdb|1D8T|A Chain A, Crystal Structure Of Elongation Factor, Tu (Ef-Tu-Mggdp) Complexed With Ge2270a, A Thiazolyl Peptide Antibiotic Length = 393 Back     alignment and structure
>pdb|1OB2|A Chain A, E. Coli Elongation Factor Ef-Tu Complexed With The Antibiotic Kirromycin, A Gtp Analog, And Phe-Trna Length = 393 Back     alignment and structure
>pdb|3U6B|A Chain A, Ef-Tu (Escherichia Coli) In Complex With Nvp-Ldi028 Length = 394 Back     alignment and structure
>pdb|3MMP|A Chain A, Structure Of The Qb Replicase, An Rna-Dependent Rna Polymerase Consisting Of Viral And Host Proteins Length = 678 Back     alignment and structure
>pdb|1XB2|A Chain A, Crystal Structure Of Bos Taurus Mitochondrial Elongation Factor TuTS COMPLEX Length = 409 Back     alignment and structure
>pdb|1EFM|A Chain A, Structure Of The Gdp Domain Of Ef-Tu And Location Of The Amino Acids Homologous To Ras Oncogene Proteins Length = 379 Back     alignment and structure
>pdb|2HDN|B Chain B, Trypsin-Modified Elongation Factor Tu In Complex With Tetracycline At 2.8 Angstrom Resolution Length = 335 Back     alignment and structure
>pdb|2HCJ|B Chain B, "trypsin-Modified Elongation Factor Tu In Complex With Tetracycline" Length = 335 Back     alignment and structure
>pdb|3NDC|A Chain A, Crystal Structure Of Precorrin-4 C11-Methyltransferase From Rhodobacter Capsulatus Length = 264 Back     alignment and structure
>pdb|3NEI|A Chain A, Crystal Structure Of Precorrin-4 C11-Methyltransferase From Rhodobacter Capsulatus (No Sah Bound) Length = 281 Back     alignment and structure
>pdb|1MJ1|A Chain A, Fitting The Ternary Complex Of Ef-TuTRNAGTP AND RIBOSOMAL PROTEINS Into A 13 A Cryo-Em Map Of The Coli 70s Ribosome Length = 405 Back     alignment and structure
>pdb|4AC9|A Chain A, Crystal Structure Of Translation Elongation Factor Selb From Methanococcus Maripaludis In Complex With Gdp Length = 482 Back     alignment and structure
>pdb|1KK3|A Chain A, Structure Of The Wild-Type Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi Complexed With Gdp-Mg2+ Length = 410 Back     alignment and structure
>pdb|1KJZ|A Chain A, Structure Of The Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi-G235d Mutant Length = 410 Back     alignment and structure
>pdb|2D74|A Chain A, Crystal Structure Of Translation Initiation Factor Aif2betagamma Heterodimer Length = 419 Back     alignment and structure
>pdb|1KK0|A Chain A, Structure Of The Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi Length = 410 Back     alignment and structure
>pdb|1S0U|A Chain A, Eif2gamma Apo Length = 408 Back     alignment and structure
>pdb|3PEN|A Chain A, Structure Of Archaeal Initiation Factor Aif2gamma Subunit Delta 37-47 From Sulfolobus Solfataricus In The Gdp-Bound Form. Length = 403 Back     alignment and structure
>pdb|3SJZ|A Chain A, The Structure Of Aif2gamma Subunit Delta 41-45 From Archaeon Sulfolobus Solfataricus Complexed With Gdp And Gdpnp Length = 409 Back     alignment and structure
>pdb|2PMD|A Chain A, The Structures Of Aif2gamma Subunit From The Archaeon Sulfolobus Solfataricus In The Gdp-Bound Form. Length = 415 Back     alignment and structure
>pdb|2AHO|A Chain A, Structure Of The Archaeal Initiation Factor Eif2 Alpha- Gamma Heterodimer From Sulfolobus Solfataricus Complexed With Gdpnp Length = 414 Back     alignment and structure
>pdb|3J25|A Chain A, Structural Basis For Tetm-Mediated Tetracycline Resistance Length = 638 Back     alignment and structure
>pdb|3IZY|P Chain P, Mammalian Mitochondrial Translation Initiation Factor 2 Length = 537 Back     alignment and structure
>pdb|3VQT|A Chain A, Crystal Structure Analysis Of The Translation Factor Rf3 Length = 548 Back     alignment and structure
>pdb|2YWE|A Chain A, Crystal Structure Of Lepa From Aquifex Aeolicus Length = 600 Back     alignment and structure
>pdb|2YWG|A Chain A, Crystal Structure Of Gtp-Bound Lepa From Aquifex Aeolicus Length = 600 Back     alignment and structure
>pdb|2LKC|A Chain A, Free B.St If2-G2 Length = 178 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query967
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 0.0
1zun_A325 Sulfate adenylyltransferase subunit 2; beta barrel 1e-122
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 1e-79
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 1e-77
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 3e-77
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 5e-77
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 5e-73
1f60_A458 Elongation factor EEF1A; protein-protein complex, 8e-73
1ve2_A235 Uroporphyrin-III C-methyltransferase; heme, biosyn 5e-68
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 2e-67
2ybo_A294 Methyltransferase; SUMT, NIRE, heme D1 biosynthesi 3e-66
1s4d_A280 Uroporphyrin-III C-methyltransferase; tetrapyrrole 1e-65
1va0_A239 Uroporphyrin-III C-methyltransferase; structural g 2e-65
4e16_A253 Precorrin-4 C(11)-methyltransferase; structural ge 1e-58
1cbf_A285 Cobalt-precorrin-4 transmethylase; precorrin-4 met 8e-57
3ndc_A264 Precorrin-4 C(11)-methyltransferase; SAH; HET: SAH 1e-56
2e0n_A259 Precorrin-2 C20-methyltransferase; cobalt-factor I 6e-47
2qbu_A232 Precorrin-2 methyltransferase; HET: SAH; 2.10A {Me 2e-41
1wb1_A482 Translation elongation factor SELB; selenocysteine 4e-37
1vhv_A268 Diphthine synthase; structural genomics, transfera 8e-37
2z6r_A265 Diphthine synthase; methyltransferase, S-adenosyl- 3e-36
2elf_A370 Protein translation elongation factor 1A; tRNA, py 5e-36
3nut_A251 Precorrin-3 methylase; vitamin B12 pathway, cobala 3e-34
2zvb_A295 Precorrin-3 C17-methyltransferase; plasmid, struct 9e-34
1sur_A215 PAPS reductase; assimilatory sulfate reduction, 3- 1e-32
2npn_A251 Putative cobalamin synthesis related protein; COBF 8e-31
3i4t_A292 Diphthine synthase; niaid, ssgcid, infectious dise 1e-30
2oq2_A261 Phosphoadenosine phosphosulfate reductase; sulfate 3e-29
1wde_A294 Probable diphthine synthase; structural genomics, 3e-29
2o8v_A252 Phosphoadenosine phosphosulfate reductase; disulfi 4e-28
3nd1_A275 Precorrin-6A synthase/COBF protein; methyltransfer 1e-26
2wsi_A306 FAD synthetase; transferase, nucleotidyltransferas 1e-24
3fwk_A308 FMN adenylyltransferase; FAD biosynthesis, alpha/b 1e-22
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 6e-22
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 2e-21
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 3e-21
2goy_A275 Adenosine phosphosulfate reductase; iron sulfur cl 1e-20
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 2e-19
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 3e-19
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 4e-19
3e1y_E204 Eukaryotic peptide chain release factor GTP-bindi 5e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
1xe1_A116 Hypothetical protein PF0907; structural genomics, 7e-11
2bb3_A221 Cobalamin biosynthesis precorrin-6Y methylase (CB; 1e-08
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 3e-07
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 4e-07
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 6e-07
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 6e-07
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 2e-06
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 5e-06
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 5e-06
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 7e-06
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 8e-06
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 9e-06
2h5e_A529 Peptide chain release factor RF-3; beta barrel, tr 2e-05
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 2e-05
2wji_A165 Ferrous iron transport protein B homolog; membrane 5e-05
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 6e-05
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 6e-05
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 9e-05
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 3e-04
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 4e-04
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 434 Back     alignment and structure
 Score =  596 bits (1538), Expect = 0.0
 Identities = 200/426 (46%), Positives = 282/426 (66%), Gaps = 13/426 (3%)

Query: 320 KKHSLLRFITAGSVDDGKSTLIGRLLFDSKNIFIDQLDAVSRTKYKRVMSGHNIDLSLLT 379
           ++  +LRF+T G+VDDGKSTLIGRLL DSK I+ D L+A++R   K   +G ++DL+LL 
Sbjct: 20  ERKEMLRFLTCGNVDDGKSTLIGRLLHDSKMIYEDHLEAITRDSKKSGTTGDDVDLALLV 79

Query: 380 DGLESEREQGITIDVAYRYFNTPKRKFIIADTPGHEQYTRNMITGASTADAVIILIDASK 439
           DGL++EREQGITIDVAYRYF+T KRKFIIADTPGHEQYTRNM TGAST D  IIL+DA  
Sbjct: 80  DGLQAEREQGITIDVAYRYFSTAKRKFIIADTPGHEQYTRNMATGASTCDLAIILVDARY 139

Query: 440 IKFNPSVNLLTQTKRHSIIAHLLRIKHIIIAVNKMDLINYNQIFYKRIVYAYKKFAEDIH 499
                   + TQT+RHS IA LL IKHI++A+NKMDL  +++  ++ I   Y KFAE I 
Sbjct: 140 -------GVQTQTRRHSYIASLLGIKHIVVAINKMDLNGFDERVFESIKADYLKFAEGIA 192

Query: 500 FQ--NINTIPISALNGDNIISASNNMLWYNGPTLISLLESLNTNEKIDKKPLRFPVQLVA 557
           F+   +  +P+SAL GDN+++ S    WY G +L+ +LE++      +   LRFPVQ V 
Sbjct: 193 FKPTTMAFVPMSALKGDNVVNKSERSPWYAGQSLMEILETVEIASDRNYTDLRFPVQYVN 252

Query: 558 RHCGHISKDFRGYMGRIESGIIKKNDCLIVEPSGKKATIKDIQMLNKSLDMAITGQSVTL 617
           R     + +FRG+ G + SGI+ K D ++V PSGK + +K I      L+ A  GQ+VTL
Sbjct: 253 RP----NLNFRGFAGTLASGIVHKGDEIVVLPSGKSSRVKSIVTFEGELEQAGPGQAVTL 308

Query: 618 IIKEYLDISRGNMLVSPFKRPVSLRSINANLCWLSEESLDLRRKYLLKHSTNQILSRILK 677
            +++ +DISRG++LV     P    + +A L W++EE +   +KY +K +T+ +   I  
Sbjct: 309 TMEDEIDISRGDLLVHADNVPQVSDAFDAMLVWMAEEPMLPGKKYDIKRATSYVPGSIAS 368

Query: 678 INALLNINTQKWCPPKLLDLNDIGCVTINIYEPISVDSYDNIRSTGSFILIDEITFQTVA 737
           I   +++NT +  P   L LN+IG V +++  PI++D Y + R+TG+FI+ID +T  TVA
Sbjct: 369 ITHRVDVNTLEEGPASSLQLNEIGRVKVSLDAPIALDGYSSNRTTGAFIVIDRLTNGTVA 428

Query: 738 AVYIIG 743
           A  II 
Sbjct: 429 AGMIIA 434
>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2 Length = 325 Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Length = 467 Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Length = 483 Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Length = 435 Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Length = 611 Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Length = 592 Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Length = 458 Back     alignment and structure
>1ve2_A Uroporphyrin-III C-methyltransferase; heme, biosynthesis, structural genomics, NPPSFA; 1.80A {Thermus thermophilus} SCOP: c.90.1.1 Length = 235 Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Length = 457 Back     alignment and structure
>2ybo_A Methyltransferase; SUMT, NIRE, heme D1 biosynthesis; HET: SAH; 2.00A {Pseudomonas aeruginosa} PDB: 2ybq_A* Length = 294 Back     alignment and structure
>1s4d_A Uroporphyrin-III C-methyltransferase; tetrapyrrole biosynthesis, cobalamin, SAM, SAH, uroporphyrin methyltransferase; HET: SAH; 2.70A {Pseudomonas denitrificans} SCOP: c.90.1.1 Length = 280 Back     alignment and structure
>1va0_A Uroporphyrin-III C-methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.97A {Thermus thermophilus} SCOP: c.90.1.1 PDB: 1v9a_A Length = 239 Back     alignment and structure
>4e16_A Precorrin-4 C(11)-methyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.49A {Clostridium difficile} Length = 253 Back     alignment and structure
>1cbf_A Cobalt-precorrin-4 transmethylase; precorrin-4 methyltransferase, cobalamin biosynth methyltransferase; HET: SAH; 2.40A {Bacillus megaterium} SCOP: c.90.1.1 PDB: 2cbf_A* Length = 285 Back     alignment and structure
>3ndc_A Precorrin-4 C(11)-methyltransferase; SAH; HET: SAH; 2.00A {Rhodobacter capsulatus} PDB: 3nei_A Length = 264 Back     alignment and structure
>2e0n_A Precorrin-2 C20-methyltransferase; cobalt-factor II, tetrapyrrole, S-adenosylmethi transferase; HET: SAH; 2.00A {Chlorobaculum tepidum} PDB: 2e0k_A* Length = 259 Back     alignment and structure
>2qbu_A Precorrin-2 methyltransferase; HET: SAH; 2.10A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 232 Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Length = 482 Back     alignment and structure
>1vhv_A Diphthine synthase; structural genomics, transferase; HET: MSE; 1.75A {Archaeoglobus fulgidus} SCOP: c.90.1.1 Length = 268 Back     alignment and structure
>2z6r_A Diphthine synthase; methyltransferase, S-adenosyl-L-methionine, transferase; HET: SAH MES; 1.50A {Pyrococcus horikoshii} PDB: 2dek_A* 1wng_A* 1vce_A* 2ed3_A* 2e4r_A* 2owg_A* 2ek3_A* 2pcm_A* 2p5c_A* 2hut_A* 2emr_A* 2el3_A* 2el0_A* 2ejk_A* 2eld_A* 2el2_A* 2eka_A* 2eh5_A* 2pcg_A* 2el1_A* ... Length = 265 Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Length = 370 Back     alignment and structure
>3nut_A Precorrin-3 methylase; vitamin B12 pathway, cobalamin, methyltransferase, transfera; HET: SAH; 2.22A {Rhodobacter capsulatus} Length = 251 Back     alignment and structure
>2zvb_A Precorrin-3 C17-methyltransferase; plasmid, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SAH; 2.00A {Thermus thermophilus} PDB: 2zvc_A* Length = 295 Back     alignment and structure
>1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2 Length = 215 Back     alignment and structure
>2npn_A Putative cobalamin synthesis related protein; COBF, PSI-2, MAD, struc genomics, SAM, S-adenosylmethionine, MCSG; HET: MSE SAM; 1.60A {Corynebacterium diphtheriae} Length = 251 Back     alignment and structure
>3i4t_A Diphthine synthase; niaid, ssgcid, infectious disease, anaerobic parasitic protozoan, structural genomics, decode, UW, SBRI; 2.49A {Entamoeba histolytica} Length = 292 Back     alignment and structure
>2oq2_A Phosphoadenosine phosphosulfate reductase; sulfate reduction, PAPS reductase, oxidoreductase; HET: A3P; 2.10A {Saccharomyces cerevisiae} Length = 261 Back     alignment and structure
>1wde_A Probable diphthine synthase; structural genomics, conserved hypothetical protein, riken S genomics/proteomics initiative, RSGI, transferase; 2.00A {Aeropyrum pernix} SCOP: c.90.1.1 Length = 294 Back     alignment and structure
>2o8v_A Phosphoadenosine phosphosulfate reductase; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Length = 252 Back     alignment and structure
>3nd1_A Precorrin-6A synthase/COBF protein; methyltransferase, deacetylase, transferase; HET: SAH; 1.50A {Rhodobacter capsulatus} Length = 275 Back     alignment and structure
>2wsi_A FAD synthetase; transferase, nucleotidyltransferase, nucleotide-binding; HET: FAD; 1.90A {Saccharomyces cerevisiae} Length = 306 Back     alignment and structure
>3fwk_A FMN adenylyltransferase; FAD biosynthesis, alpha/beta protein, rossmann- like fold, APO-form, extended loop region; HET: BGC; 1.20A {Candida glabrata} PDB: 3g59_A* 3g5a_A* 3g6k_A* Length = 308 Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 408 Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Length = 410 Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Length = 403 Back     alignment and structure
>2goy_A Adenosine phosphosulfate reductase; iron sulfur cluster, nucleotide binding, thiosulfonate intermediate, oxidoreductase; HET: ADX; 2.70A {Pseudomonas aeruginosa} Length = 275 Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Length = 1289 Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Length = 397 Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Length = 405 Back     alignment and structure
>3e1y_E Eukaryotic peptide chain release factor GTP-bindi ERF3A; translation termination, peptide release, PTC, P biosynthesis, GTP-binding; HET: ATP; 3.80A {Homo sapiens} Length = 204 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1xe1_A Hypothetical protein PF0907; structural genomics, unknown function, protein structure INI secsg, conserved hypothetical protein; HET: MSE; 2.00A {Pyrococcus furiosus} SCOP: b.43.3.1 Length = 116 Back     alignment and structure
>2bb3_A Cobalamin biosynthesis precorrin-6Y methylase (CB; beta, alpha-beta-alpha sandwich, structural genomics, PSI, P structure initiative; HET: SAH; 2.27A {Archaeoglobus fulgidus} SCOP: c.90.1.1 Length = 221 Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Length = 842 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Length = 308 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Length = 228 Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Length = 178 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Length = 301 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Length = 271 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Length = 357 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Length = 423 Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Length = 301 Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Length = 528 Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Length = 529 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Length = 190 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Length = 165 Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Length = 262 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Length = 188 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Length = 258 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Length = 172 Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Length = 274 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query967
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 100.0
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 100.0
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 100.0
1f60_A458 Elongation factor EEF1A; protein-protein complex, 100.0
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 100.0
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 100.0
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 100.0
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 100.0
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 100.0
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 100.0
1wb1_A482 Translation elongation factor SELB; selenocysteine 100.0
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 100.0
2elf_A370 Protein translation elongation factor 1A; tRNA, py 100.0
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 100.0
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 100.0
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 100.0
1zun_A325 Sulfate adenylyltransferase subunit 2; beta barrel 100.0
2ybo_A294 Methyltransferase; SUMT, NIRE, heme D1 biosynthesi 100.0
1s4d_A280 Uroporphyrin-III C-methyltransferase; tetrapyrrole 100.0
4e16_A253 Precorrin-4 C(11)-methyltransferase; structural ge 100.0
1ve2_A235 Uroporphyrin-III C-methyltransferase; heme, biosyn 100.0
3ndc_A264 Precorrin-4 C(11)-methyltransferase; SAH; HET: SAH 100.0
1va0_A239 Uroporphyrin-III C-methyltransferase; structural g 100.0
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 100.0
1cbf_A285 Cobalt-precorrin-4 transmethylase; precorrin-4 met 100.0
2oq2_A261 Phosphoadenosine phosphosulfate reductase; sulfate 100.0
3e1y_E204 Eukaryotic peptide chain release factor GTP-bindi 100.0
2ywe_A600 GTP-binding protein LEPA; G domain, beta-barrel, f 100.0
3vqt_A548 RF-3, peptide chain release factor 3; translation, 100.0
3i4t_A292 Diphthine synthase; niaid, ssgcid, infectious dise 100.0
3kwp_A296 Predicted methyltransferase; putative methyltransf 100.0
3cb4_D599 GTP-binding protein LEPA; GTPase, OB-fold, membran 100.0
1wyz_A242 Putative S-adenosylmethionine-dependent methyltra; 99.98
3fwk_A308 FMN adenylyltransferase; FAD biosynthesis, alpha/b 99.98
2e0n_A259 Precorrin-2 C20-methyltransferase; cobalt-factor I 99.98
3nut_A251 Precorrin-3 methylase; vitamin B12 pathway, cobala 99.97
2o8v_A252 Phosphoadenosine phosphosulfate reductase; disulfi 99.97
2z6r_A265 Diphthine synthase; methyltransferase, S-adenosyl- 99.97
2qbu_A232 Precorrin-2 methyltransferase; HET: SAH; 2.10A {Me 99.97
2goy_A275 Adenosine phosphosulfate reductase; iron sulfur cl 99.97
1wde_A294 Probable diphthine synthase; structural genomics, 99.97
3j25_A638 Tetracycline resistance protein TETM; antibiotic r 99.97
4fn5_A709 EF-G 1, elongation factor G 1; translation, transl 99.97
2zvb_A295 Precorrin-3 C17-methyltransferase; plasmid, struct 99.97
1vhv_A268 Diphthine synthase; structural genomics, transfera 99.96
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 99.96
2rdo_7704 EF-G, elongation factor G; elongation factor G, EF 99.96
3nd1_A275 Precorrin-6A synthase/COBF protein; methyltransfer 99.96
2h5e_A529 Peptide chain release factor RF-3; beta barrel, tr 99.96
3izy_P537 Translation initiation factor IF-2, mitochondrial; 99.96
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 99.96
1sur_A215 PAPS reductase; assimilatory sulfate reduction, 3- 99.96
1dar_A691 EF-G, elongation factor G; ribosomal translocase, 99.95
2npn_A251 Putative cobalamin synthesis related protein; COBF 99.95
2wsi_A306 FAD synthetase; transferase, nucleotidyltransferas 99.95
2xex_A693 Elongation factor G; GTPase, translation, biosynth 99.95
2dy1_A665 Elongation factor G; translocation, GTP complex, s 99.95
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 99.94
2bb3_A221 Cobalamin biosynthesis precorrin-6Y methylase (CB; 99.93
1n0u_A842 EF-2, elongation factor 2; G-protein, CIS-proline, 99.91
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.79
3hh1_A117 Tetrapyrrole methylase family protein; chlorobium 99.78
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.77
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.75
1wy5_A317 TILS, hypothetical UPF0072 protein AQ_1887; N-type 99.74
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.72
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.71
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 99.71
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.7
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.7
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.7
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.69
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.68
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.68
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.67
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.67
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.67
3a2k_A464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, 99.67
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.67
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.67
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.66
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.66
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.66
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.66
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.66
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.66
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.66
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.66
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.66
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.66
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.66
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.66
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.66
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.65
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 99.65
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.65
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.65
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.65
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.65
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.65
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.65
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.65
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.65
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.65
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.65
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.65
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.65
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.64
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.64
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.64
1ni5_A433 Putative cell cycle protein MESJ; structural genom 99.64
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.64
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.64
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.64
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.64
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.64
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.64
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.63
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.63
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.63
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.63
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.63
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.63
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.63
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.63
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.63
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 99.63
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.63
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.62
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.62
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.62
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.62
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.62
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.62
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.62
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.62
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.62
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.62
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.62
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.61
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.61
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.61
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.61
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.61
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.61
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.61
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 99.61
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.61
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.61
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.61
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 99.61
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.6
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.6
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.6
2dpl_A308 GMP synthetase, GMP synthase [glutamine-hydrolyzin 99.6
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.6
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.6
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.6
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.59
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.59
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.59
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.59
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.58
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.58
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.58
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.58
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.58
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.58
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.58
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.58
2ywb_A503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 99.58
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.57
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.57
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.57
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.57
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.57
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.57
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.56
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.56
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.56
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.56
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.56
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.55
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.55
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.55
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.55
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.55
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.55
1kor_A400 Argininosuccinate synthetase; ligase, riken struct 99.54
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.54
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.54
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.53
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 99.53
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.53
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.53
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.26
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.5
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.49
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.48
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.48
3k32_A203 Uncharacterized protein MJ0690; predicted subunit 99.48
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.47
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.46
3bl5_A219 Queuosine biosynthesis protein QUEC; PREQ1 biosynt 99.45
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.45
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.44
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.44
3ffy_A115 Putative tetrapyrrole (corrin/porphyrin) methylas; 99.43
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 99.43
2hma_A376 Probable tRNA (5-methylaminomethyl-2-thiouridylat 99.43
3tqi_A527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 99.42
3dpu_A535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.41
2der_A380 TRNA-specific 2-thiouridylase MNMA; protein-RNA co 99.4
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.4
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.39
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.38
2j69_A695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.38
2pg3_A232 Queuosine biosynthesis protein QUEC; YP_049261.1, 99.38
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.36
3p52_A249 NH(3)-dependent NAD(+) synthetase; structural geno 99.36
3fiu_A249 NH(3)-dependent NAD(+) synthetase; rossman fold, a 99.35
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.35
2e18_A257 NH(3)-dependent NAD(+) synthetase; ligase, structu 99.34
1xng_A268 NH(3)-dependent NAD(+) synthetase; amidotransferas 99.34
1wxq_A397 GTP-binding protein; structural genomics, riken st 99.33
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 99.33
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 99.3
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.29
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 99.27
2c5s_A413 THII, probable thiamine biosynthesis protein THII; 99.27
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 99.27
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 99.27
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 99.27
1gpm_A525 GMP synthetase, XMP aminase; class I glutamine ami 99.27
2www_A349 Methylmalonic aciduria type A protein, mitochondri 99.26
2ged_A193 SR-beta, signal recognition particle receptor beta 99.24
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 99.22
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 99.2
1k92_A455 Argininosuccinate synthase, argininosuccinate SY; 99.19
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 99.19
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 99.18
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 99.12
2nz2_A413 Argininosuccinate synthase; amino-acid biosynthesi 99.11
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 99.11
3uow_A556 GMP synthetase; structural genomics consortium, SG 99.1
2vxo_A697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 99.09
1jal_A363 YCHF protein; nucleotide-binding fold, structural 99.05
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 98.99
1vl2_A421 Argininosuccinate synthase; TM1780, structural gen 98.98
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 98.95
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 98.92
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 98.92
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.91
1xe1_A116 Hypothetical protein PF0907; structural genomics, 98.77
2hf9_A226 Probable hydrogenase nickel incorporation protein 98.73
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 98.67
3q4g_A279 NH(3)-dependent NAD(+) synthetase; structural geno 98.62
1wxi_A275 NH(3)-dependent NAD(+) synthetase; NADE, E.coli, l 98.61
3n05_A590 NH(3)-dependent NAD(+) synthetase; ligase, structu 98.6
1kqp_A271 NAD+ synthase, NH(3)-dependent NAD(+) synthetase, 98.57
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 98.56
3dpi_A285 NAD+ synthetase; ssgcid, decode, structural genomi 98.55
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 98.53
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 98.48
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 98.48
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 98.45
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 98.43
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 98.43
1vbk_A307 Hypothetical protein PH1313; structural genomics, 98.37
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 98.33
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 98.29
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 98.21
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 98.16
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 98.16
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 98.16
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 98.1
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 98.08
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 98.03
3rjz_A237 N-type ATP pyrophosphatase superfamily; structural 98.02
3sdb_A680 Glutamine-dependent NAD(+) synthetase; glutamine-a 98.01
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 98.01
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 97.86
3ilv_A634 Glutamine-dependent NAD(+) synthetase; protein str 97.81
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 97.79
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 97.78
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 97.77
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 97.74
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 97.72
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 97.64
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 97.63
2xxa_A433 Signal recognition particle protein; protein trans 97.58
1d1n_A99 Initiation factor 2; beta-barrel, gene regulation; 97.55
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 97.52
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 97.52
3cnl_A262 YLQF, putative uncharacterized protein; circular p 97.5
3cnl_A262 YLQF, putative uncharacterized protein; circular p 97.38
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 97.36
2crv_A120 IF-2MT, translation initiation factor IF-2; riboso 97.35
1ct9_A553 Asparagine synthetase B; amidotransferase, substra 97.32
4f4h_A565 Glutamine dependent NAD+ synthetase; structural ge 97.29
1vma_A306 Cell division protein FTSY; TM0570, structural gen 97.21
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 97.21
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.19
1jgt_A513 Beta-lactam synthetase; asparagine synthetase, cla 97.18
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 97.12
1q15_A503 CARA; CMPR, (2S,5S)-5-carboxymethylproline, B-LS, 97.05
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 97.02
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 96.95
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 96.9
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 96.76
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 96.56
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 96.5
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 96.44
3q5d_A447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 96.43
2og2_A359 Putative signal recognition particle receptor; nuc 95.98
3izy_P537 Translation initiation factor IF-2, mitochondrial; 95.88
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 95.3
3cwq_A209 Para family chromosome partitioning protein; alpha 95.19
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 95.18
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 94.53
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 94.21
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 94.11
3end_A307 Light-independent protochlorophyllide reductase ir 94.07
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 93.42
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 93.29
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 93.02
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 92.75
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 92.49
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 92.42
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 92.38
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 92.3
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 92.28
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 92.14
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 92.08
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 92.07
4ido_A457 Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE 91.9
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 91.85
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 91.83
1kag_A173 SKI, shikimate kinase I; transferase, structural g 91.8
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 91.78
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 91.63
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 91.58
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 91.57
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 91.33
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 91.22
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 91.15
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 91.07
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 91.05
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 90.98
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 90.96
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 90.93
1sgw_A214 Putative ABC transporter; structural genomics, P p 90.89
1ihu_A589 Arsenical pump-driving ATPase; aluminum fluoride, 90.89
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 90.84
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 90.82
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 90.79
2eyu_A261 Twitching motility protein PILT; pilus retraction 90.76
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 90.76
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 90.76
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 90.74
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 90.74
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 90.68
1g6h_A257 High-affinity branched-chain amino acid transport 90.64
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 90.63
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 90.59
1b0u_A262 Histidine permease; ABC transporter, transport pro 90.57
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 90.52
1ji0_A240 ABC transporter; ATP binding protein, structural g 90.43
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 90.36
2ghi_A260 Transport protein; multidrug resistance protein, M 90.35
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 90.33
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 90.3
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 90.29
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 90.26
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 90.23
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 90.21
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 90.2
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 90.17
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 90.14
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 90.13
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 90.02
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 89.93
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 89.89
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 89.85
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 89.82
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 89.79
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 89.76
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 89.76
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 89.72
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 89.64
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 89.63
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 89.61
1xjc_A169 MOBB protein homolog; structural genomics, midwest 89.57
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 89.55
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 89.54
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 89.52
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 89.51
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 89.51
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 89.48
3vaa_A199 Shikimate kinase, SK; structural genomics, center 89.47
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 89.45
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 89.42
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 89.41
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 89.39
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 89.29
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 89.29
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 89.27
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 89.21
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 89.08
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 89.05
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 89.01
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 88.94
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 88.94
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 88.87
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 88.85
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 88.76
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 88.75
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 88.69
4a74_A231 DNA repair and recombination protein RADA; hydrola 88.68
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 88.64
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 88.63
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 88.59
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 88.57
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 88.56
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 88.52
3tlx_A243 Adenylate kinase 2; structural genomics, structura 88.51
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 88.4
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 88.37
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 88.31
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 88.21
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 88.15
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 88.13
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 88.08
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 88.07
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 88.02
2kjq_A149 DNAA-related protein; solution structure, NESG, st 88.01
2oap_1511 GSPE-2, type II secretion system protein; hexameri 88.0
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 87.97
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 87.89
2ewv_A372 Twitching motility protein PILT; pilus retraction 87.86
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 87.82
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 87.77
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 87.77
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 87.71
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 87.66
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 87.5
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 87.44
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 87.43
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 87.42
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 87.3
1via_A175 Shikimate kinase; structural genomics, transferase 87.29
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 87.22
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 87.14
1p9r_A418 General secretion pathway protein E; bacterial typ 87.13
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 87.01
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 86.95
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 86.85
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 86.82
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 86.75
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 86.73
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 86.65
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 86.49
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 86.47
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 86.43
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 86.34
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 86.33
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 86.27
2vli_A183 Antibiotic resistance protein; transferase, tunica 86.25
3kta_A182 Chromosome segregation protein SMC; structural mai 86.18
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 86.14
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 86.12
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 86.02
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 85.92
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 85.91
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 85.85
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 85.82
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 85.62
3r20_A233 Cytidylate kinase; structural genomics, seattle st 85.52
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 85.41
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 85.33
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 85.23
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 85.11
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 84.96
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 84.94
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 84.92
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 84.89
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 84.8
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 84.71
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 84.65
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 84.58
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 84.53
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 84.35
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 84.32
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 84.32
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 84.24
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 83.8
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 83.65
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 83.61
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 83.59
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 83.41
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
Probab=100.00  E-value=2.9e-68  Score=610.42  Aligned_cols=414  Identities=25%  Similarity=0.390  Sum_probs=387.4

Q ss_pred             cCCCeeEEEEEecCCCChHHHHhHHHhccCCCChHHHHHHhHHHhhcccCCCceeeeeccCCchhhhccceeEeeceeee
Q psy3751         320 KKHSLLRFITAGSVDDGKSTLIGRLLFDSKNIFIDQLDAVSRTKYKRVMSGHNIDLSLLTDGLESEREQGITIDVAYRYF  399 (967)
Q Consensus       320 ~~~~~~~v~ivG~~~~GKSTLi~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~e~~~g~Ti~~~~~~~  399 (967)
                      ..++.+||+++||+|+|||||+|+|++.++.+.++.+.++.+++...|+  ++++++|++|.+++|+++|+|++..+..+
T Consensus        13 ~~k~~~~i~iiG~~d~GKSTL~~~Ll~~~~~i~~~~~~~~~~~~~~~g~--~~~~~a~~~d~~~~er~~GiTid~~~~~~   90 (439)
T 3j2k_7           13 PKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNR--ETWYLSWALDTNQEERDKGKTVEVGRAYF   90 (439)
T ss_pred             CCCceeEEEEEeCCCCCHHHHHHHHHHHcCCCchHHHHHHHHHHHhccc--cchhhhhhhccchhHhhcCceEEEeEEEE
Confidence            4567899999999999999999999999999999999999999999888  78999999999999999999999999999


Q ss_pred             ecCCceEEEeeChhhHHHHHHHHhhcccCCEEEEEEeCCCCCCCCCCCchhhHHHHHHHHHHcCCCeEEEEEecCCcc--
Q psy3751         400 NTPKRKFIIADTPGHEQYTRNMITGASTADAVIILIDASKIKFNPSVNLLTQTKRHSIIAHLLRIKHIIIAVNKMDLI--  477 (967)
Q Consensus       400 ~~~~~~~~liDtpG~~~~~~~~~~~~~~aD~~ilVvda~~~~~~~~~g~~~~t~~~~~~~~~~~~~~iivviNK~D~~--  477 (967)
                      ++++++++|||||||++|.++|..+++.+|++|||||++++.+++++...+|+++|+.++..++++++|+|+||||+.  
T Consensus        91 ~~~~~~~~iiDTPGh~~f~~~~~~~~~~aD~~ilVVDa~~g~~e~~~~~~~qt~e~l~~~~~~~v~~iIvviNK~Dl~~~  170 (439)
T 3j2k_7           91 ETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTV  170 (439)
T ss_pred             ecCCeEEEEEECCChHHHHHHHHhhHhhCCEEEEEEECCCCccccccCCCchHHHHHHHHHHcCCCeEEEEeecCCCccc
Confidence            999999999999999999999999999999999999999977766666678999999999999999999999999994  


Q ss_pred             CcCHHHHHHHHHHHHHHHHHcCCc---cceEEeccccCCCcccccccCCCCCCCCcHHHHhhcccCCCcCCCCCceeeEE
Q psy3751         478 NYNQIFYKRIVYAYKKFAEDIHFQ---NINTIPISALNGDNIISASNNMLWYNGPTLISLLESLNTNEKIDKKPLRFPVQ  554 (967)
Q Consensus       478 ~~~~~~~~~i~~~~~~~~~~~~~~---~~~ii~iSa~~g~gi~~l~~~~~w~~~~~L~~~l~~~~~~~~~~~~~~~~~i~  554 (967)
                      ++++.+++++.+++..+++.+++.   +++++|+||++|.|++++.+.++||.|++|++.|+.++++....++|++++|+
T Consensus       171 ~~~~~~~~~i~~~~~~~l~~~g~~~~~~~~~i~iSA~~G~ni~~l~~~~~w~~g~~L~~~l~~i~~~~~~~~~p~r~~v~  250 (439)
T 3j2k_7          171 NWSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYIGLPFIPYLDNLPNFNRSVDGPIRLPIV  250 (439)
T ss_pred             chHHHHHHHHHHHHHHHHHHhcccccCCeeEEEeeccCCcccccccccccccCchHHHHHHHhCCCCccCCCCCeEEEEE
Confidence            467788899999999999999884   57899999999999999999999999999999999999888888899999999


Q ss_pred             EeecCCCccCCCceEEEEEEEeeeecCCCEEEEecCCcEEEEEEEEeCccccceeecCCeEEEEEc--cccCCCCCcccc
Q psy3751         555 LVARHCGHISKDFRGYMGRIESGIIKKNDCLIVEPSGKKATIKDIQMLNKSLDMAITGQSVTLIIK--EYLDISRGNMLV  632 (967)
Q Consensus       555 ~v~~~~~~~~~~~~v~~G~v~~G~l~~g~~v~i~p~~~~~~V~~i~~~~~~v~~a~~G~~v~l~l~--~~~~i~~G~vl~  632 (967)
                      ++++  +.|    ++++|+|++|+|++||.|.+.|.+.+++|++|++++.++++|.|||+|+++|+  +..+++|||+|+
T Consensus       251 ~~~~--~~G----~v~~G~v~~G~l~~Gd~v~~~p~~~~~~V~~i~~~~~~~~~a~aG~~v~~~l~gi~~~~i~rG~vl~  324 (439)
T 3j2k_7          251 DKYK--DMG----TVVLGKLESGSIFKGQQLVMMPNKHNVEVLGILSDDTETDFVAPGENLKIRLKGIEEEEILPGFILC  324 (439)
T ss_pred             EEEc--CCC----eEEEEEEEeeEEecCCEEEEccCCceEEEEEEEECCeEcCEecCCCcceEEEeccchhhcCCcEEec
Confidence            9986  344    89999999999999999999999999999999999999999999999999998  467899999999


Q ss_pred             cCCCCccccceeEEEEEEeccc-cccCCceEEEEEeeeEEEEEEeeeeeeeecCCCccC--CCccccCCCEEEEEEeecC
Q psy3751         633 SPFKRPVSLRSINANLCWLSEE-SLDLRRKYLLKHSTNQILSRILKINALLNINTQKWC--PPKLLDLNDIGCVTINIYE  709 (967)
Q Consensus       633 ~~~~~~~~~~~f~a~i~~~~~~-~i~~g~~~~~~~~~~~~~~~i~~i~~~~d~~~~~~~--~~~~l~~g~~a~v~l~l~~  709 (967)
                      ++++++..+..|+|+|.||++. ++.+|+++++|+|+.+++|+|.+|.+++|.+|++..  +|++|+.||.+.|+|++.+
T Consensus       325 ~~~~~~~~~~~f~a~v~~l~~~~~i~~g~~~~~~~~t~~~~~~i~~i~~~~d~~t~~~~~~~~~~l~~~~~~~v~~~~~~  404 (439)
T 3j2k_7          325 DPSNLCHSGRTFDVQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALISLVDKKSGEKSKTRPRFVKQDQVCIARLRTAG  404 (439)
T ss_pred             CCCCCCceeeEEEEEEEEeCCCCcCCCCCEEEEEEeceEEEEEEEEEEEeecCCchhhhccCcceecCCcEEEEEEEeCC
Confidence            9988888999999999999984 699999999999999999999999999999998754  6789999999999999999


Q ss_pred             ceeeccccCccCCccceeecccccccceEEEEEe
Q psy3751         710 PISVDSYDNIRSTGSFILIDEITFQTVAAVYIIG  743 (967)
Q Consensus       710 pi~~~~~~~~~~~grfil~d~~~~~~~~~~~~vg  743 (967)
                      |+|+|+|++++.+|||+|||+  ++|+|.|.++.
T Consensus       405 p~~~e~~~~~~~~g~f~l~d~--~~tv~~G~i~~  436 (439)
T 3j2k_7          405 TICLETFKDFPQMGRFTLRDE--GKTIAIGKVLK  436 (439)
T ss_pred             eEEEeeccccccCCCEEEEEC--CceEEEEEEEE
Confidence            999999999999999999995  79999888764
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2 Back     alignment and structure
>2ybo_A Methyltransferase; SUMT, NIRE, heme D1 biosynthesis; HET: SAH; 2.00A {Pseudomonas aeruginosa} PDB: 2ybq_A* Back     alignment and structure
>1s4d_A Uroporphyrin-III C-methyltransferase; tetrapyrrole biosynthesis, cobalamin, SAM, SAH, uroporphyrin methyltransferase; HET: SAH; 2.70A {Pseudomonas denitrificans} SCOP: c.90.1.1 Back     alignment and structure
>4e16_A Precorrin-4 C(11)-methyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.49A {Clostridium difficile} Back     alignment and structure
>1ve2_A Uroporphyrin-III C-methyltransferase; heme, biosynthesis, structural genomics, NPPSFA; 1.80A {Thermus thermophilus} SCOP: c.90.1.1 Back     alignment and structure
>3ndc_A Precorrin-4 C(11)-methyltransferase; SAH; HET: SAH; 2.00A {Rhodobacter capsulatus} PDB: 3nei_A Back     alignment and structure
>1va0_A Uroporphyrin-III C-methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.97A {Thermus thermophilus} SCOP: c.90.1.1 PDB: 1v9a_A Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>1cbf_A Cobalt-precorrin-4 transmethylase; precorrin-4 methyltransferase, cobalamin biosynth methyltransferase; HET: SAH; 2.40A {Bacillus megaterium} SCOP: c.90.1.1 PDB: 2cbf_A* Back     alignment and structure
>2oq2_A Phosphoadenosine phosphosulfate reductase; sulfate reduction, PAPS reductase, oxidoreductase; HET: A3P; 2.10A {Saccharomyces cerevisiae} Back     alignment and structure
>3e1y_E Eukaryotic peptide chain release factor GTP-bindi ERF3A; translation termination, peptide release, PTC, P biosynthesis, GTP-binding; HET: ATP; 3.80A {Homo sapiens} Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>3i4t_A Diphthine synthase; niaid, ssgcid, infectious disease, anaerobic parasitic protozoan, structural genomics, decode, UW, SBRI; 2.49A {Entamoeba histolytica} Back     alignment and structure
>3kwp_A Predicted methyltransferase; putative methyltransferase, MCSG, STRU genomics, PSI-2, protein structure initiative; 2.29A {Lactobacillus brevis atcc 367} Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>1wyz_A Putative S-adenosylmethionine-dependent methyltra; northeast structural genomics consortium, BTR28, methyltrans PSI; 2.50A {Bacteroides thetaiotaomicron} SCOP: c.90.1.1 Back     alignment and structure
>3fwk_A FMN adenylyltransferase; FAD biosynthesis, alpha/beta protein, rossmann- like fold, APO-form, extended loop region; HET: BGC; 1.20A {Candida glabrata} PDB: 3g59_A* 3g5a_A* 3g6k_A* Back     alignment and structure
>2e0n_A Precorrin-2 C20-methyltransferase; cobalt-factor II, tetrapyrrole, S-adenosylmethi transferase; HET: SAH; 2.00A {Chlorobaculum tepidum} PDB: 2e0k_A* Back     alignment and structure
>3nut_A Precorrin-3 methylase; vitamin B12 pathway, cobalamin, methyltransferase, transfera; HET: SAH; 2.22A {Rhodobacter capsulatus} Back     alignment and structure
>2o8v_A Phosphoadenosine phosphosulfate reductase; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>2z6r_A Diphthine synthase; methyltransferase, S-adenosyl-L-methionine, transferase; HET: SAH MES; 1.50A {Pyrococcus horikoshii} PDB: 2dek_A* 1wng_A* 1vce_A* 2ed3_A* 2e4r_A* 2owg_A* 2ek3_A* 2pcm_A* 2p5c_A* 2hut_A* 2emr_A* 2el3_A* 2el0_A* 2ejk_A* 2eld_A* 2el2_A* 2eka_A* 2eh5_A* 2pcg_A* 2el1_A* ... Back     alignment and structure
>2qbu_A Precorrin-2 methyltransferase; HET: SAH; 2.10A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2goy_A Adenosine phosphosulfate reductase; iron sulfur cluster, nucleotide binding, thiosulfonate intermediate, oxidoreductase; HET: ADX; 2.70A {Pseudomonas aeruginosa} Back     alignment and structure
>1wde_A Probable diphthine synthase; structural genomics, conserved hypothetical protein, riken S genomics/proteomics initiative, RSGI, transferase; 2.00A {Aeropyrum pernix} SCOP: c.90.1.1 Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2zvb_A Precorrin-3 C17-methyltransferase; plasmid, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SAH; 2.00A {Thermus thermophilus} PDB: 2zvc_A* Back     alignment and structure
>1vhv_A Diphthine synthase; structural genomics, transferase; HET: MSE; 1.75A {Archaeoglobus fulgidus} SCOP: c.90.1.1 Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>3nd1_A Precorrin-6A synthase/COBF protein; methyltransferase, deacetylase, transferase; HET: SAH; 1.50A {Rhodobacter capsulatus} Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2 Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2npn_A Putative cobalamin synthesis related protein; COBF, PSI-2, MAD, struc genomics, SAM, S-adenosylmethionine, MCSG; HET: MSE SAM; 1.60A {Corynebacterium diphtheriae} Back     alignment and structure
>2wsi_A FAD synthetase; transferase, nucleotidyltransferase, nucleotide-binding; HET: FAD; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>2bb3_A Cobalamin biosynthesis precorrin-6Y methylase (CB; beta, alpha-beta-alpha sandwich, structural genomics, PSI, P structure initiative; HET: SAH; 2.27A {Archaeoglobus fulgidus} SCOP: c.90.1.1 Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATPase, PP-type, putative cell cycle PR PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2dpl_A GMP synthetase, GMP synthase [glutamine-hydrolyzing] subunit B; pyrococcus horikoshii OT3, structural genomics, NPPSFA; 1.43A {Pyrococcus horikoshii} PDB: 2z0c_A 3a4i_A Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>1kor_A Argininosuccinate synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: ANP ARG; 1.95A {Thermus thermophilus} SCOP: c.26.2.1 d.210.1.1 PDB: 1j1z_A* 1j21_A* 1kh1_A 1kh2_A* 1kh3_A* 1j20_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3k32_A Uncharacterized protein MJ0690; predicted subunit of tRNA methyltransferase, methanocaldococcus jannaschii DSM , PSI- 2; 2.50A {Methanocaldococcus jannaschii} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3bl5_A Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis, RNA modification, tRNA, hydrolase; 2.95A {Bacillus subtilis} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3ffy_A Putative tetrapyrrole (corrin/porphyrin) methylas; structural genomics, APC62130.1, methyltransferase, PSI-2, P structure initiative; 2.00A {Bacteroides fragilis} PDB: 3fq6_A Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2hma_A Probable tRNA (5-methylaminomethyl-2-thiouridylat methyltransferase; alpha-beta, beta barrel, structural genomics, PSI-2; HET: MSE SAM; 2.41A {Streptococcus pneumoniae} Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2der_A TRNA-specific 2-thiouridylase MNMA; protein-RNA complex, transferase/RNA complex; 3.10A {Escherichia coli} PDB: 2det_A 2deu_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>2pg3_A Queuosine biosynthesis protein QUEC; YP_049261.1, hypothetical protein, structural genomics, JOIN for structural genomics; 2.40A {Pectobacterium atrosepticum SCRI1043} SCOP: c.26.2.1 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3p52_A NH(3)-dependent NAD(+) synthetase; structural genomics, center for structural genomics of infec diseases, NADE, CSGI; 2.74A {Campylobacter jejuni} SCOP: c.26.2.0 Back     alignment and structure
>3fiu_A NH(3)-dependent NAD(+) synthetase; rossman fold, adenine nucleotide alpha hydrolase-like, ATP- binding, ligase, nucleotide-binding; HET: AMP; 1.85A {Francisella tularensis subsp} Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2e18_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, NPPSFA, national project on Pro structural and functional analyses; 2.10A {Pyrococcus horikoshii} Back     alignment and structure
>1xng_A NH(3)-dependent NAD(+) synthetase; amidotransferase, ligase; HET: DND ATP; 1.70A {Helicobacter pylori} SCOP: c.26.2.1 PDB: 1xnh_A Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2c5s_A THII, probable thiamine biosynthesis protein THII; RNA-binding protein, RNA binding protein, tRNA modification, 4-thiouridine synthase; HET: AMP; 2.5A {Bacillus anthracis} SCOP: c.26.2.6 d.308.1.1 Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1k92_A Argininosuccinate synthase, argininosuccinate SY; N-type ATP pyrophosphatase, ligase; 1.60A {Escherichia coli} SCOP: c.26.2.1 d.210.1.1 PDB: 1k97_A* 1kp2_A* 1kp3_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2nz2_A Argininosuccinate synthase; amino-acid biosynthesis, aspartate, citrulline, ST genomics, structural genomics consortium, SGC, ligase; HET: CIR; 2.40A {Homo sapiens} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1vl2_A Argininosuccinate synthase; TM1780, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics, ligase; 1.65A {Thermotoga maritima} SCOP: c.26.2.1 d.210.1.1 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1xe1_A Hypothetical protein PF0907; structural genomics, unknown function, protein structure INI secsg, conserved hypothetical protein; HET: MSE; 2.00A {Pyrococcus furiosus} SCOP: b.43.3.1 Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3q4g_A NH(3)-dependent NAD(+) synthetase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; 2.40A {Vibrio cholerae} SCOP: c.26.2.0 Back     alignment and structure
>1wxi_A NH(3)-dependent NAD(+) synthetase; NADE, E.coli, ligase; HET: AMP; 1.70A {Escherichia coli} SCOP: c.26.2.1 PDB: 1wxf_A 1wxg_A* 1wxh_A* 1wxe_A* 3hmq_A* Back     alignment and structure
>3n05_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, protein structure initiative, P nysgrc; 2.35A {Streptomyces avermitilis} Back     alignment and structure
>1kqp_A NAD+ synthase, NH(3)-dependent NAD(+) synthetase, SPOR; ligase, amidotransferase, ATP pyrophosphatase, NAD-adenylate; HET: ADJ; 1.03A {Bacillus subtilis} SCOP: c.26.2.1 PDB: 1fyd_A* 1ifx_A* 1ee1_A* 1ih8_A* 1nsy_A* 2nsy_A* 2pzb_A 2pza_A* 2pz8_A Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3dpi_A NAD+ synthetase; ssgcid, decode, structural genomics, PSI, protein structure initiative; 2.20A {Burkholderia pseudomallei} SCOP: c.26.2.0 Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1vbk_A Hypothetical protein PH1313; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 1.90A {Pyrococcus horikoshii} SCOP: c.26.2.6 d.308.1.1 Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3rjz_A N-type ATP pyrophosphatase superfamily; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein; 2.30A {Pyrococcus furiosus} SCOP: c.26.2.1 PDB: 3h7e_A 3rk0_A* 3rk1_A* 1ru8_A 2d13_A Back     alignment and structure
>3sdb_A Glutamine-dependent NAD(+) synthetase; glutamine-amidotransferase, glutaminase, glutamine-dependent synthetase, ligase; 2.00A {Mycobacterium tuberculosis} PDB: 3seq_A* 3sez_A* 3szg_A* 3dla_A* 3syt_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>3ilv_A Glutamine-dependent NAD(+) synthetase; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.79A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1d1n_A Initiation factor 2; beta-barrel, gene regulation; NMR {Geobacillus stearothermophilus} SCOP: b.43.3.1 Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2crv_A IF-2MT, translation initiation factor IF-2; ribosome, beta barrel, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1ct9_A Asparagine synthetase B; amidotransferase, substrate channeling, asparagine biosynthesis, ligase; HET: AMP GLN; 2.00A {Escherichia coli} SCOP: c.26.2.1 d.153.1.1 Back     alignment and structure
>4f4h_A Glutamine dependent NAD+ synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ligase; 1.75A {Burkholderia thailandensis} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1jgt_A Beta-lactam synthetase; asparagine synthetase, clavulanic AC AMPCPP, CEA, carboxyethylarginine, hydrolase; HET: APC CMA; 1.95A {Streptomyces clavuligerus} SCOP: c.26.2.1 d.153.1.1 PDB: 1m1z_A 1mb9_A* 1mbz_A* 1mc1_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1q15_A CARA; CMPR, (2S,5S)-5-carboxymethylproline, B-LS, B-lactam synthetase, AS-B, class B asparagine synthetase, AMP-CPP; 2.30A {Pectobacterium carotovorum} SCOP: c.26.2.1 d.153.1.1 PDB: 1q19_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 967
d1f60a3239 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N 8e-64
d1zuna1211 c.26.2.2 (A:1-211) Sulfate adenylyltransferase sub 2e-53
d1jnya3224 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N 6e-53
d1zunb3222 c.37.1.8 (B:16-237) Sulfate adenylate transferase 3e-51
d1r5ba3245 c.37.1.8 (A:215-459) Eukaryotic peptide chain rele 6e-45
d2c78a3204 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N 1e-41
d1vhva_251 c.90.1.1 (A:) Diphthine synthase, DphB {Archaeon A 3e-38
d1s4da_265 c.90.1.1 (A:) Uroporphyrin-III C-methyltransferase 4e-36
d2deka1265 c.90.1.1 (A:1-265) Diphthine synthase, DphB {Pyroc 1e-35
d1d2ea3196 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), 7e-35
d1va0a1225 c.90.1.1 (A:2-226) Hypothetical protein TTHA0667 { 7e-35
d1pjqa2242 c.90.1.1 (A:216-457) Siroheme synthase CysG, domai 2e-34
d1wdea_289 c.90.1.1 (A:) Diphthine synthase, DphB {Aeropyrum 3e-34
d1ve2a1235 c.90.1.1 (A:1-235) Uroporphyrin-III C-methyltransf 2e-33
d1cbfa_239 c.90.1.1 (A:) Cobalt precorrin-4 methyltransferase 3e-25
d2qn6a3205 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma su 2e-24
d1sura_215 c.26.2.2 (A:) Phosphoadenylyl sulphate (PAPS) redu 4e-24
d1zunb192 b.43.3.1 (B:238-329) Sulfate adenylate transferase 2e-23
d1zunb2105 b.44.1.1 (B:330-434) Sulfate adenylate transferase 4e-23
d2bb3a1195 c.90.1.1 (A:1-195) Precorrin-6y methylase CbiE {Ar 7e-22
d2bv3a2276 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-t 1e-18
d1kk1a3195 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma su 3e-18
d1r5ba195 b.43.3.1 (A:460-554) Eukaryotic peptide chain rele 1e-16
d1f60a194 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, 1e-16
d1jnya195 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, 2e-16
d2c78a1100 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), 3e-15
d1n0ua2341 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N- 6e-15
d1efca192 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), 9e-13
d1wyza1233 c.90.1.1 (A:2-234) Putative methytransferase BT419 2e-12
d1wb1a192 b.43.3.1 (A:180-271) Elongation factor SelB, domai 2e-12
d1yrba1244 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB09 7e-12
d1xe1a_91 b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococ 6e-11
d2qn6a1114 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma 1e-10
d1kk1a1121 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma 1e-10
d1g7sa2128 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, 1e-10
d1s0ua1118 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma 1e-09
d1d2ea198 b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), 1e-09
d2dy1a2267 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-t 8e-08
d1g7sa4227 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N- 1e-07
d1wb1a4179 c.37.1.8 (A:1-179) Elongation factor SelB, N-termi 3e-06
d1mkya2186 c.37.1.8 (A:173-358) Probable GTPase Der, N-termin 5e-06
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 3e-04
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 4e-04
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 5e-04
d1jnya2107 b.44.1.1 (A:323-429) Elongation factor eEF-1alpha, 5e-04
d1udxa2180 c.37.1.8 (A:157-336) Obg GTP-binding protein middl 0.001
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 0.002
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 0.002
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 239 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor eEF-1alpha, N-terminal (G) domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score =  213 bits (543), Expect = 8e-64
 Identities = 72/233 (30%), Positives = 124/233 (53%), Gaps = 18/233 (7%)

Query: 320 KKHSLLRFITAGSVDDGKSTLIGRLLFDSKNIFIDQLDAVSRTKYKRVMSGHNIDLSLLT 379
           K H  +  +  G VD GKST  G L++    I    ++   +   +  +   +   + + 
Sbjct: 4   KSH--INVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAE--LGKGSFKYAWVL 59

Query: 380 DGLESEREQGITIDVAYRYFNTPKRKFIIADTPGHEQYTRNMITGASTADAVIILIDASK 439
           D L++ERE+GITID+A   F TPK +  + D PGH  + +NMITG S AD  I++I    
Sbjct: 60  DKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGV 119

Query: 440 IKFNPSVNLLTQTKRHSIIAHLLRIKHIIIAVNKMDLINYNQIFYKRIVYAYKKFAEDIH 499
            +F   ++   QT+ H+++A  L ++ +I+AVNKMD + +++  ++ IV     F + + 
Sbjct: 120 GEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIVKETSNFIKKVG 179

Query: 500 F--QNINTIPISALNGDNIISASNNMLWY------------NGPTLISLLESL 538
           +  + +  +PIS  NGDN+I A+ N  WY             G TL+  ++++
Sbjct: 180 YNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAI 232
>d1zuna1 c.26.2.2 (A:1-211) Sulfate adenylyltransferase subunit 2, CysD {Pseudomonas syringae pv. tomato [TaxId: 323]} Length = 211 Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 224 Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Length = 222 Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 245 Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 204 Back     information, alignment and structure
>d1vhva_ c.90.1.1 (A:) Diphthine synthase, DphB {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 251 Back     information, alignment and structure
>d1s4da_ c.90.1.1 (A:) Uroporphyrin-III C-methyltransferase (SUMT, UROM, CobA) {Pseudomonas denitrificans [TaxId: 43306]} Length = 265 Back     information, alignment and structure
>d2deka1 c.90.1.1 (A:1-265) Diphthine synthase, DphB {Pyrococcus horikoshii [TaxId: 53953]} Length = 265 Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 196 Back     information, alignment and structure
>d1va0a1 c.90.1.1 (A:2-226) Hypothetical protein TTHA0667 {Thermus thermophilus [TaxId: 274]} Length = 225 Back     information, alignment and structure
>d1pjqa2 c.90.1.1 (A:216-457) Siroheme synthase CysG, domains 4 and 5 {Salmonella typhimurium [TaxId: 90371]} Length = 242 Back     information, alignment and structure
>d1wdea_ c.90.1.1 (A:) Diphthine synthase, DphB {Aeropyrum pernix [TaxId: 56636]} Length = 289 Back     information, alignment and structure
>d1ve2a1 c.90.1.1 (A:1-235) Uroporphyrin-III C-methyltransferase (SUMT, UROM, CobA) {Thermus thermophilus [TaxId: 274]} Length = 235 Back     information, alignment and structure
>d1cbfa_ c.90.1.1 (A:) Cobalt precorrin-4 methyltransferase CbiF {Bacillus megaterium [TaxId: 1404]} Length = 239 Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 205 Back     information, alignment and structure
>d1sura_ c.26.2.2 (A:) Phosphoadenylyl sulphate (PAPS) reductase {Escherichia coli [TaxId: 562]} Length = 215 Back     information, alignment and structure
>d1zunb1 b.43.3.1 (B:238-329) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 2-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Length = 92 Back     information, alignment and structure
>d1zunb2 b.44.1.1 (B:330-434) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 3-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Length = 105 Back     information, alignment and structure
>d2bb3a1 c.90.1.1 (A:1-195) Precorrin-6y methylase CbiE {Archaeoglobus fulgidus [TaxId: 2234]} Length = 195 Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 276 Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 195 Back     information, alignment and structure
>d1r5ba1 b.43.3.1 (A:460-554) Eukaryotic peptide chain release factor ERF2, post-G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 95 Back     information, alignment and structure
>d1f60a1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 94 Back     information, alignment and structure
>d1jnya1 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, domain 2 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 95 Back     information, alignment and structure
>d2c78a1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]} Length = 100 Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 341 Back     information, alignment and structure
>d1efca1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]} Length = 92 Back     information, alignment and structure
>d1wyza1 c.90.1.1 (A:2-234) Putative methytransferase BT4190 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 233 Back     information, alignment and structure
>d1wb1a1 b.43.3.1 (A:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]} Length = 92 Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Length = 244 Back     information, alignment and structure
>d1xe1a_ b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococcus furiosus [TaxId: 2261]} Length = 91 Back     information, alignment and structure
>d2qn6a1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]} Length = 114 Back     information, alignment and structure
>d1kk1a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 121 Back     information, alignment and structure
>d1g7sa2 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 128 Back     information, alignment and structure
>d1s0ua1 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma subunit, domain II {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 118 Back     information, alignment and structure
>d1d2ea1 b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Length = 267 Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 227 Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Length = 179 Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 186 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d1jnya2 b.44.1.1 (A:323-429) Elongation factor eEF-1alpha, C-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 107 Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Length = 180 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure