Psyllid ID: psy3842

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14

MKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDIDFSGKRWGYLREKLFLSELSGKRESTCAPAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDIDFSGK

ccccEEEcccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEEccccccccccccccccHHHHHHHHcccccccccccccccc

ccccEEEcccHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHccccccEEEcccccccccccccccccccEcccccHHHHHHHccHHHHHHcccccccccccccccccHHHHHHHcccccccHHHHHcccc

mkgwrvktnSEMTRRAREGVMEFLLvnhpldcpicdqggecdlqdqsmafgsdrsrftdidfsgkrwGYLREKLFLSelsgkrestcaparEGVMEFLLvnhpldcpicdqggecdlqdqsmafgsdrsrftdidfsgk

mkgwrvktnsemtrrAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMafgsdrsrftdidfsgkrwGYLREKLFLSELSGKRESTCAPAREGVMEFLLVNHPLDCPICDQGGECDLQDQSmafgsdrsrftdidfsgk

MKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDIDFSGKRWGYLREKLFLSELSGKRESTCAPAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDIDFSGK

******************GVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDIDFSGKRWGYLREKLFLSELSGKRESTCAPAREGVMEFLLVNHPLDCPICDQGGECDL**********************

*KGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDIDFSGKRWGYLREKLFLSELSGKRESTCAPAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSR*********

MKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDIDFSGKRWGYLREKLFLSELSGKRESTCAPAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDIDFSGK

**GWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDIDFSGKRWGYLREKLFLSELSGKRESTCAPAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFG*DRSR*********

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDIDFSGKRWGYLREKLFLSELSGKRESTCAPAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDIDFSGK

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		139	2.2.26 [Sep-21-2011]
Q94511		731	NADH-ubiquinone oxidoredu	yes	N/A	0.474	0.090	0.863	3e-33
P15690		727	NADH-ubiquinone oxidoredu	yes	N/A	0.446	0.085	0.787	2e-26
Q66HF1		727	NADH-ubiquinone oxidoredu	yes	N/A	0.446	0.085	0.772	4e-26
Q91VD9		727	NADH-ubiquinone oxidoredu	yes	N/A	0.446	0.085	0.772	5e-26
P0CB68		727	NADH-ubiquinone oxidoredu	N/A	N/A	0.446	0.085	0.757	1e-25
Q4R6K9		727	NADH-ubiquinone oxidoredu	N/A	N/A	0.446	0.085	0.757	1e-25
P28331		727	NADH-ubiquinone oxidoredu	yes	N/A	0.446	0.085	0.757	1e-25
Q0MQG1		727	NADH-ubiquinone oxidoredu	N/A	N/A	0.446	0.085	0.757	1e-25
Q0MQG2		727	NADH-ubiquinone oxidoredu	yes	N/A	0.446	0.085	0.742	4e-25
P0CB67		727	NADH-ubiquinone oxidoredu	yes	N/A	0.446	0.085	0.742	6e-25

>sp\|Q94511\|NDUS1_DROME NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Drosophila melanogaster GN=ND75 PE=2 SV=3	Back alignment and function desciption

 Score =  140 bits (352), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 66/66 (100%)

Query: 1   MKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDI 60
           MKGWR+KTNS++TR+AREGVMEFLL+NHPLDCPICDQGGECDLQDQ+MAFGSDRSRFTDI
Sbjct: 107 MKGWRIKTNSDLTRKAREGVMEFLLMNHPLDCPICDQGGECDLQDQAMAFGSDRSRFTDI 166

Query: 61  DFSGKR 66
           +++GKR
Sbjct: 167 NYTGKR 172

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity). This is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 6EC: .EC: 9EC: 9EC: .EC: 3

>sp\|P15690\|NDUS1_BOVIN NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Bos taurus GN=NDUFS1 PE=1 SV=1	Back alignment and function description

>sp\|Q66HF1\|NDUS1_RAT NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Rattus norvegicus GN=Ndufs1 PE=1 SV=1	Back alignment and function description

>sp\|Q91VD9\|NDUS1_MOUSE NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Mus musculus GN=Ndufs1 PE=1 SV=2	Back alignment and function description

>sp\|P0CB68\|NDUS1_PONPY NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Pongo pygmaeus GN=NDUFS1 PE=2 SV=1	Back alignment and function description

>sp\|Q4R6K9\|NDUS1_MACFA NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Macaca fascicularis GN=NDUFS1 PE=2 SV=1	Back alignment and function description

>sp\|P28331\|NDUS1_HUMAN NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Homo sapiens GN=NDUFS1 PE=1 SV=3	Back alignment and function description

>sp\|Q0MQG1\|NDUS1_GORGO NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFS1 PE=2 SV=1	Back alignment and function description

>sp\|Q0MQG2\|NDUS1_PANTR NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Pan troglodytes GN=NDUFS1 PE=2 SV=1	Back alignment and function description

>sp\|P0CB67\|NDUS1_PONAB NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Pongo abelii GN=NDUFS1 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		139
91088235		727	PREDICTED: similar to NADH-ubiquinone ox	0.474	0.090	0.954	9e-34
242007132		729	NADH-ubiquinone oxidoreductase 75 kDa su	0.474	0.090	0.939	9e-33
157132899		730	NADH-ubiquinone oxidoreductase [Aedes ae	0.474	0.090	0.924	1e-32
170049925		729	NADH-ubiquinone oxidoreductase 75 kDa su	0.474	0.090	0.924	2e-32
170073711		729	NADH-ubiquinone oxidoreductase 75 kDa su	0.474	0.090	0.924	2e-32
380019063		727	PREDICTED: LOW QUALITY PROTEIN: NADH-ubi	0.474	0.090	0.909	3e-32
288872187		727	NADH-ubiquinone oxidoreductase 75 kDa su	0.474	0.090	0.909	3e-32
350405958		729	PREDICTED: NADH-ubiquinone oxidoreductas	0.474	0.090	0.909	3e-32
340711055		729	PREDICTED: NADH-ubiquinone oxidoreductas	0.474	0.090	0.909	3e-32
383865373		725	PREDICTED: NADH-ubiquinone oxidoreductas	0.474	0.091	0.909	5e-32

>gi\|91088235\|ref\|XP_973797.1\| PREDICTED: similar to NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursor (Complex I-75kD) (CI-75kD) [Tribolium castaneum] gi\|270012773\|gb\|EFA09221.1\| hypothetical protein TcasGA2_TC006252 [Tribolium castaneum]	Back alignment and taxonomy information

 Score =  147 bits (372), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 63/66 (95%), Positives = 66/66 (100%)

Query: 1   MKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDI 60
           MKGWR+KTNSEMT++AREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDI
Sbjct: 102 MKGWRIKTNSEMTKKAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDI 161

Query: 61  DFSGKR 66
           DFSGKR
Sbjct: 162 DFSGKR 167

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|242007132\|ref\|XP_002424396.1\| NADH-ubiquinone oxidoreductase 75 kDa subunit, putative [Pediculus humanus corporis] gi\|212507796\|gb\|EEB11658.1\| NADH-ubiquinone oxidoreductase 75 kDa subunit, putative [Pediculus humanus corporis]	Back alignment and taxonomy information

>gi\|157132899\|ref\|XP_001662693.1\| NADH-ubiquinone oxidoreductase [Aedes aegypti] gi\|108871047\|gb\|EAT35272.1\| AAEL012552-PA [Aedes aegypti]	Back alignment and taxonomy information

>gi\|170049925\|ref\|XP_001870962.1\| NADH-ubiquinone oxidoreductase 75 kDa subunit [Culex quinquefasciatus] gi\|167871585\|gb\|EDS34968.1\| NADH-ubiquinone oxidoreductase 75 kDa subunit [Culex quinquefasciatus]	Back alignment and taxonomy information

>gi\|170073711\|ref\|XP_001870420.1\| NADH-ubiquinone oxidoreductase 75 kDa subunit [Culex quinquefasciatus] gi\|167870367\|gb\|EDS33750.1\| NADH-ubiquinone oxidoreductase 75 kDa subunit [Culex quinquefasciatus]	Back alignment and taxonomy information

>gi\|380019063\|ref\|XP_003693436.1\| PREDICTED: LOW QUALITY PROTEIN: NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial-like [Apis florea]	Back alignment and taxonomy information

>gi\|288872187\|ref\|NP_001165875.1\| NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial [Apis mellifera]	Back alignment and taxonomy information

>gi\|350405958\|ref\|XP_003487608.1\| PREDICTED: NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial-like [Bombus impatiens]	Back alignment and taxonomy information

>gi\|340711055\|ref\|XP_003394097.1\| PREDICTED: NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial-like [Bombus terrestris]	Back alignment and taxonomy information

>gi\|383865373\|ref\|XP_003708148.1\| PREDICTED: NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial-like [Megachile rotundata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		139
FB\|FBgn0017566		731	ND75 "NADH:ubiquinone reductas	0.474	0.090	0.863	5.2e-29
ZFIN\|ZDB-GENE-030131-478		731	ndufs1 "NADH dehydrogenase (ub	0.446	0.084	0.803	4.8e-24
UNIPROTKB\|Q8W317		747	OSJNBa0014G15.3 "cDNA clone:J0	0.431	0.080	0.733	1.4e-23
UNIPROTKB\|P15690		727	NDUFS1 "NADH-ubiquinone oxidor	0.446	0.085	0.787	2.1e-23
TAIR\|locus:2169871		748	EMB1467 "AT5G37510" [Arabidops	0.431	0.080	0.733	2.2e-23
UNIPROTKB\|F1NXN8		728	NDUFS1 "Uncharacterized protei	0.446	0.085	0.787	2.7e-23
UNIPROTKB\|E2R4F8		727	NDUFS1 "Uncharacterized protei	0.446	0.085	0.772	5.7e-23
MGI\|MGI:2443241		727	Ndufs1 "NADH dehydrogenase (ub	0.446	0.085	0.772	5.7e-23
RGD\|1359670		727	Ndufs1 "NADH dehydrogenase (ub	0.446	0.085	0.772	5.7e-23
UNIPROTKB\|E2RD75		739	NDUFS1 "Uncharacterized protei	0.446	0.083	0.772	5.9e-23

FB\|FBgn0017566 ND75 "NADH:ubiquinone reductase 75kD subunit precursor" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 331 (121.6 bits), Expect = 5.2e-29, P = 5.2e-29
 Identities = 57/66 (86%), Positives = 66/66 (100%)

Query:     1 MKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDI 60
             MKGWR+KTNS++TR+AREGVMEFLL+NHPLDCPICDQGGECDLQDQ+MAFGSDRSRFTDI
Sbjct:   107 MKGWRIKTNSDLTRKAREGVMEFLLMNHPLDCPICDQGGECDLQDQAMAFGSDRSRFTDI 166

Query:    61 DFSGKR 66
             +++GKR
Sbjct:   167 NYTGKR 172

GO:0008137 "NADH dehydrogenase (ubiquinone) activity" evidence=ISS;IBA

GO:0005747 "mitochondrial respiratory chain complex I" evidence=ISS;IBA

GO:0005739 "mitochondrion" evidence=ISS

GO:0003954 "NADH dehydrogenase activity" evidence=ISS

GO:0042773 "ATP synthesis coupled electron transport" evidence=IEA

GO:0051536 "iron-sulfur cluster binding" evidence=IEA

GO:0009055 "electron carrier activity" evidence=IEA

GO:0045333 "cellular respiration" evidence=IBA

ZFIN\|ZDB-GENE-030131-478 ndufs1 "NADH dehydrogenase (ubiquinone) Fe-S protein 1" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8W317 OSJNBa0014G15.3 "cDNA clone:J023087M21, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

UNIPROTKB\|P15690 NDUFS1 "NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

TAIR\|locus:2169871 EMB1467 "AT5G37510" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NXN8 NDUFS1 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|E2R4F8 NDUFS1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

MGI\|MGI:2443241 Ndufs1 "NADH dehydrogenase (ubiquinone) Fe-S protein 1" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1359670 Ndufs1 "NADH dehydrogenase (ubiquinone) Fe-S protein 1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RD75 NDUFS1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q91VD9	NDUS1_MOUSE	1, ., 6, ., 9, 9, ., 3	0.7727	0.4460	0.0852	yes	N/A
Q0MQG2	NDUS1_PANTR	1, ., 6, ., 9, 9, ., 3	0.7424	0.4460	0.0852	yes	N/A
Q94511	NDUS1_DROME	1, ., 6, ., 9, 9, ., 3	0.8636	0.4748	0.0902	yes	N/A
Q9FGI6	NDUS1_ARATH	1, ., 6, ., 9, 9, ., 3	0.7142	0.4244	0.0788	yes	N/A
P28331	NDUS1_HUMAN	1, ., 6, ., 9, 9, ., 3	0.7575	0.4460	0.0852	yes	N/A
Q9ZCF6	NUOG_RICPR	1, ., 6, ., 9, 9, ., 5	0.6607	0.4028	0.0829	yes	N/A
P0CB67	NDUS1_PONAB	1, ., 6, ., 9, 9, ., 3	0.7424	0.4460	0.0852	yes	N/A
P15690	NDUS1_BOVIN	1, ., 6, ., 9, 9, ., 3	0.7878	0.4460	0.0852	yes	N/A
Q66HF1	NDUS1_RAT	1, ., 6, ., 9, 9, ., 3	0.7727	0.4460	0.0852	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		139
PRK09130		687	PRK09130, PRK09130, NADH dehydrogenase subunit G;	4e-38
TIGR01973		603	TIGR01973, NuoG, NADH-quinone oxidoreductase, chai	1e-34
PRK09130		687	PRK09130, PRK09130, NADH dehydrogenase subunit G;	3e-32
PRK09129		776	PRK09129, PRK09129, NADH dehydrogenase subunit G;	6e-30
TIGR01973		603	TIGR01973, NuoG, NADH-quinone oxidoreductase, chai	6e-28
COG1034		693	COG1034, NuoG, NADH dehydrogenase/NADH:ubiquinone	3e-26
PRK09129		776	PRK09129, PRK09129, NADH dehydrogenase subunit G;	4e-26
PRK07860		797	PRK07860, PRK07860, NADH dehydrogenase subunit G;	1e-24
PRK07860		797	PRK07860, PRK07860, NADH dehydrogenase subunit G;	1e-22
COG1034		693	COG1034, NuoG, NADH dehydrogenase/NADH:ubiquinone	1e-21
pfam10588		41	pfam10588, NADH-G_4Fe-4S_3, NADH-ubiquinone oxidor	2e-18
pfam10588		41	pfam10588, NADH-G_4Fe-4S_3, NADH-ubiquinone oxidor	2e-18
smart00929		41	smart00929, NADH-G_4Fe-4S_3, NADH-ubiquinone oxido	7e-17
smart00929		41	smart00929, NADH-G_4Fe-4S_3, NADH-ubiquinone oxido	7e-17
PTZ00305		297	PTZ00305, PTZ00305, NADH:ubiquinone oxidoreductase	4e-15
PRK08166		791	PRK08166, PRK08166, NADH dehydrogenase subunit G;	2e-13
PRK08166		791	PRK08166, PRK08166, NADH dehydrogenase subunit G;	8e-13
PTZ00305		297	PTZ00305, PTZ00305, NADH:ubiquinone oxidoreductase	3e-12
COG3383		978	COG3383, COG3383, Uncharacterized anaerobic dehydr	4e-12
PRK08493		819	PRK08493, PRK08493, NADH dehydrogenase subunit G;	3e-11
PRK08493		819	PRK08493, PRK08493, NADH dehydrogenase subunit G;	2e-10
COG3383		978	COG3383, COG3383, Uncharacterized anaerobic dehydr	2e-09
PRK07569		234	PRK07569, PRK07569, bidirectional hydrogenase comp	1e-05

>gnl\|CDD\|236387 PRK09130, PRK09130, NADH dehydrogenase subunit G; Validated	Back alignment and domain information

 Score =  136 bits (344), Expect = 4e-38
 Identities = 39/52 (75%), Positives = 47/52 (90%)

Query: 6   VKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRF 57
           + TN+ M ++AREGVMEFLL+NHPLDCPICDQGGECDLQDQ+MA+G D SR+
Sbjct: 73  IFTNTPMVKKAREGVMEFLLINHPLDCPICDQGGECDLQDQAMAYGVDTSRY 124

Length = 687

>gnl\|CDD\|233662 TIGR01973, NuoG, NADH-quinone oxidoreductase, chain G	Back alignment and domain information

>gnl\|CDD\|236387 PRK09130, PRK09130, NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>gnl\|CDD\|236386 PRK09129, PRK09129, NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>gnl\|CDD\|233662 TIGR01973, NuoG, NADH-quinone oxidoreductase, chain G	Back alignment and domain information

>gnl\|CDD\|223965 COG1034, NuoG, NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|236386 PRK09129, PRK09129, NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>gnl\|CDD\|236118 PRK07860, PRK07860, NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>gnl\|CDD\|236118 PRK07860, PRK07860, NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>gnl\|CDD\|223965 COG1034, NuoG, NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|204520 pfam10588, NADH-G_4Fe-4S_3, NADH-ubiquinone oxidoreductase-G iron-sulfur binding region	Back alignment and domain information

>gnl\|CDD\|204520 pfam10588, NADH-G_4Fe-4S_3, NADH-ubiquinone oxidoreductase-G iron-sulfur binding region	Back alignment and domain information

>gnl\|CDD\|214918 smart00929, NADH-G_4Fe-4S_3, NADH-ubiquinone oxidoreductase-G iron-sulfur binding region	Back alignment and domain information

>gnl\|CDD\|214918 smart00929, NADH-G_4Fe-4S_3, NADH-ubiquinone oxidoreductase-G iron-sulfur binding region	Back alignment and domain information

>gnl\|CDD\|140326 PTZ00305, PTZ00305, NADH:ubiquinone oxidoreductase; Provisional	Back alignment and domain information

>gnl\|CDD\|236170 PRK08166, PRK08166, NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>gnl\|CDD\|236170 PRK08166, PRK08166, NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>gnl\|CDD\|140326 PTZ00305, PTZ00305, NADH:ubiquinone oxidoreductase; Provisional	Back alignment and domain information

>gnl\|CDD\|225918 COG3383, COG3383, Uncharacterized anaerobic dehydrogenase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|236277 PRK08493, PRK08493, NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>gnl\|CDD\|236277 PRK08493, PRK08493, NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>gnl\|CDD\|225918 COG3383, COG3383, Uncharacterized anaerobic dehydrogenase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|181037 PRK07569, PRK07569, bidirectional hydrogenase complex protein HoxU; Validated	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		139
COG1034		693	NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc	99.97
PRK09130		687	NADH dehydrogenase subunit G; Validated	99.97
TIGR01973		603	NuoG NADH-quinone oxidoreductase, chain G. This mo	99.96
PRK07860		797	NADH dehydrogenase subunit G; Validated	99.96
PRK09129		776	NADH dehydrogenase subunit G; Validated	99.96
PRK08166		847	NADH dehydrogenase subunit G; Validated	99.95
PRK08493		819	NADH dehydrogenase subunit G; Validated	99.95
PTZ00305		297	NADH:ubiquinone oxidoreductase; Provisional	99.92
COG3383		978	Uncharacterized anaerobic dehydrogenase [General f	99.91
KOG2282\|consensus		708		99.9
PRK07569		234	bidirectional hydrogenase complex protein HoxU; Va	99.84
PF10588		41	NADH-G_4Fe-4S_3: NADH-ubiquinone oxidoreductase-G	99.72
PF10588		41	NADH-G_4Fe-4S_3: NADH-ubiquinone oxidoreductase-G	99.07
COG1034		693	NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc	99.05
PTZ00305		297	NADH:ubiquinone oxidoreductase; Provisional	99.01
PRK09130		687	NADH dehydrogenase subunit G; Validated	98.87
TIGR01973		603	NuoG NADH-quinone oxidoreductase, chain G. This mo	98.73
PRK09129		776	NADH dehydrogenase subunit G; Validated	98.69
PRK08764		135	ferredoxin; Provisional	98.64
PRK07860		797	NADH dehydrogenase subunit G; Validated	98.61
KOG2282\|consensus		708		98.52
PRK07569		234	bidirectional hydrogenase complex protein HoxU; Va	98.49
PRK08493		819	NADH dehydrogenase subunit G; Validated	98.47
PRK08166		847	NADH dehydrogenase subunit G; Validated	98.38
COG3383		978	Uncharacterized anaerobic dehydrogenase [General f	98.27
PRK12814		652	putative NADPH-dependent glutamate synthase small	98.03
PRK05113		191	electron transport complex protein RnfB; Provision	97.89
PRK12814		652	putative NADPH-dependent glutamate synthase small	97.84
TIGR01944		165	rnfB electron transport complex, RnfABCDGE type, B	97.72
PRK06991		270	ferredoxin; Provisional	97.5
PF12798		15	Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450	97.44
PF00037		24	Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T	96.69
PF12837		24	Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450	96.59
COG1143		172	NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino	96.35
PF13187		55	Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_	96.31
PF13746		69	Fer4_18: 4Fe-4S dicluster domain	95.42
PF13484		67	Fer4_16: 4Fe-4S double cluster binding domain	95.33
PF12838		52	Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014	94.98
PF14697		59	Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE	94.84
PF12838		52	Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014	94.67
PF13237		52	Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A.	94.62
CHL00065		81	psaC photosystem I subunit VII	94.36
PRK08764		135	ferredoxin; Provisional	94.17
PF12800		17	Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450	93.99
PRK08222		181	hydrogenase 4 subunit H; Validated	93.91
PLN00071		81	photosystem I subunit VII; Provisional	93.69
PF13187		55	Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_	93.37
TIGR03048		80	PS_I_psaC photosystem I iron-sulfur protein PsaC.	93.34
KOG3256\|consensus		212		93.32
TIGR02936		91	fdxN_nitrog ferredoxin III, nif-specific. Members	93.23
COG1145		99	NapF Ferredoxin [Energy production and conversion]	93.07
COG1143		172	NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino	93.06
PRK02651		81	photosystem I subunit VII; Provisional	93.05
TIGR01971		122	NuoI NADH-quinone oxidoreductase, chain I. This mo	92.07
TIGR00403		183	ndhI NADH-plastoquinone oxidoreductase subunit I p	92.03
PRK05888		164	NADH dehydrogenase subunit I; Provisional	91.91
COG2221		317	DsrA Dissimilatory sulfite reductase (desulfovirid	91.65
PRK09626		103	oorD 2-oxoglutarate-acceptor oxidoreductase subuni	91.57
PRK06273		165	ferredoxin; Provisional	91.5
TIGR01971		122	NuoI NADH-quinone oxidoreductase, chain I. This mo	91.32
TIGR00402		101	napF ferredoxin-type protein NapF. The gene codes	91.23
PRK08348		120	NADH-plastoquinone oxidoreductase subunit; Provisi	90.99
PRK08348		120	NADH-plastoquinone oxidoreductase subunit; Provisi	90.96
PRK09477		271	napH quinol dehydrogenase membrane component; Prov	90.58
PRK08222		181	hydrogenase 4 subunit H; Validated	90.49
PRK06273		165	ferredoxin; Provisional	90.08
PF14697		59	Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE	90.06
PRK09626		103	oorD 2-oxoglutarate-acceptor oxidoreductase subuni	89.98
CHL00014		167	ndhI NADH dehydrogenase subunit I	89.96
TIGR03048		80	PS_I_psaC photosystem I iron-sulfur protein PsaC.	89.94
PRK10194		163	ferredoxin-type protein; Provisional	89.75
PRK09898		208	hypothetical protein; Provisional	89.72
PRK09624		105	porD pyuvate ferredoxin oxidoreductase subunit del	89.59
TIGR02936		91	fdxN_nitrog ferredoxin III, nif-specific. Members	89.58
PRK02651		81	photosystem I subunit VII; Provisional	89.56
PRK09625		133	porD pyruvate flavodoxin oxidoreductase subunit de	89.38
TIGR02163		255	napH_ ferredoxin-type protein, NapH/MauN family. M	89.34
COG1146		68	Ferredoxin [Energy production and conversion]	89.27
TIGR02179		78	PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta	89.16
TIGR02912		314	sulfite_red_C sulfite reductase, subunit C. Member	88.42
COG1600		337	Uncharacterized Fe-S protein [Energy production an	88.32
PRK05888		164	NADH dehydrogenase subunit I; Provisional	88.17
PRK12387		180	formate hydrogenlyase complex iron-sulfur subunit;	88.1
PRK12387		180	formate hydrogenlyase complex iron-sulfur subunit;	87.92
TIGR00402		101	napF ferredoxin-type protein NapF. The gene codes	87.89
PRK09623		105	vorD 2-ketoisovalerate ferredoxin oxidoreductase s	87.84
PRK14028		312	pyruvate ferredoxin oxidoreductase subunit gamma/d	87.77
COG1145		99	NapF Ferredoxin [Energy production and conversion]	87.66
TIGR00397		213	mauM_napG MauM/NapG family ferredoxin-type protein	87.42
PRK06991		270	ferredoxin; Provisional	87.38
TIGR02486		314	RDH reductive dehalogenase. This model represents	87.13
TIGR00276		282	iron-sulfur cluster binding protein, putative. Thi	87.12
TIGR02494		295	PFLE_PFLC glycyl-radical enzyme activating protein	86.95
COG1144		91	Pyruvate:ferredoxin oxidoreductase and related 2-o	86.76
PLN00071		81	photosystem I subunit VII; Provisional	86.24
PF13183		57	Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_	85.8
PRK09476		254	napG quinol dehydrogenase periplasmic component; P	85.73
TIGR02700		234	flavo_MJ0208 archaeoflavoprotein, MJ0208 family. T	85.45
PRK07118		280	ferredoxin; Validated	85.4
TIGR02910		334	sulfite_red_A sulfite reductase, subunit A. Member	85.29
PRK10194		163	ferredoxin-type protein; Provisional	85.05
PRK10330		181	formate dehydrogenase-H ferredoxin subunit; Provis	84.99
TIGR02060		132	aprB adenosine phosphosulphate reductase, beta sub	83.98
TIGR03290		144	CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, s	83.86
TIGR00397		213	mauM_napG MauM/NapG family ferredoxin-type protein	83.72
TIGR03149		225	cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S	83.6
TIGR02494		295	PFLE_PFLC glycyl-radical enzyme activating protein	83.47
TIGR03149		225	cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S	83.29
PRK09624		105	porD pyuvate ferredoxin oxidoreductase subunit del	82.57
TIGR02176		1165	pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid	82.22
TIGR02512		374	Fe_only_hydrog hydrogenases, Fe-only. This model d	82.18
PF12797		22	Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450	82.16
PRK09625		133	porD pyruvate flavodoxin oxidoreductase subunit de	82.0
TIGR02512		374	Fe_only_hydrog hydrogenases, Fe-only. This model d	81.99
PRK15055		344	anaerobic sulfite reductase subunit A; Provisional	81.88
TIGR01660		492	narH nitrate reductase, beta subunit. The Nitrate	80.41
PRK13795		636	hypothetical protein; Provisional	80.36
PRK10330		181	formate dehydrogenase-H ferredoxin subunit; Provis	80.25
TIGR00403		183	ndhI NADH-plastoquinone oxidoreductase subunit I p	80.24
CHL00014		167	ndhI NADH dehydrogenase subunit I	80.24
PRK07118		280	ferredoxin; Validated	80.15
PF13247		98	Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX	80.02

>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion]	Back alignment and domain information

Probab=99.97  E-value=7.4e-32  Score=229.06  Aligned_cols=134  Identities=37%  Similarity=0.685  Sum_probs=112.8

Q ss_pred             CCCCEEEcCCHHHHHHHHHHHHHHHHhCCCCCCCcCCCCcchhHHHHHHhCCCCccccccc-------------cCCCcc
Q psy3842           1 MKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDID-------------FSGKRW   67 (139)
Q Consensus         1 ~~Gm~V~T~s~~v~~~r~~~lelll~~h~~~C~~C~~~g~C~Lq~l~~~~g~~~~r~~~~~-------------~~~~r~   67 (139)
                      +|||+|.|+||+|+++|+.+|||||.|||+|||+|+++|+|+|||++..||+..+||.+..             ++-+||
T Consensus        67 ~dGM~I~T~s~~vk~~R~~vmE~LLiNHPlDCpiCD~gGeCeLQD~a~~~G~~~sr~~~~kr~~~~~~~gp~v~~dm~RC  146 (693)
T COG1034          67 TDGMVISTNSEEVKKAREGVMEFLLINHPLDCPVCDKGGECELQDLAVKYGVSHSRYRETKRTHRDKDLGPLVKYDMNRC  146 (693)
T ss_pred             CCCeEEecCCHHHHHHHHHHHHHHHhcCCCCCCccCCCCCchhHHHHHHhCCCcccccccccccccccccchhhcccccc
Confidence            5899999999999999999999999999999999999999999999999999999986531             122333


Q ss_pred             ------------------------------ccccccceeecccCceecccCCcccccc-------eeeeccccccCCCCC
Q psy3842          68 ------------------------------GYLREKLFLSELSGKRESTCAPAREGVM-------EFLLVNHPLDCPICD  110 (139)
Q Consensus        68 ------------------------------~t~~~~~~~~~~~g~~~~~CPtgal~~~-------e~~l~~~~~~C~~C~  110 (139)
                                                    +|+.+++...+.||+|+++||||||+.+       .|.+...+++|.+|+
T Consensus       147 I~C~RCVR~c~eiaG~~~l~~~~rg~~~~i~t~~~~~l~se~cGncv~vCPvGALt~K~~~~~ar~wEl~k~~si~~~~a  226 (693)
T COG1034         147 ILCTRCVRFCKEIAGTHELGVIKRGENSEIGTYLDQPLESELCGNCVDVCPVGALTSKPFAFTARKWELKKTPSICVHCA  226 (693)
T ss_pred             eechhhHHhhhhhcCccccceeecCCCceeecccccccccccccceeeeccccccccChHHhhhccchhccCceeeccCc
Confidence                                          4555677788999999999999999865       577888999999999


Q ss_pred             CCCcchhHH---------------HHHHhCCCCCCCCCC
Q psy3842         111 QGGECDLQD---------------QSMAFGSDRSRFTDI  134 (139)
Q Consensus       111 ~g~~~eL~~---------------~~~~~gv~~~rf~~~  134 (139)
                      +||......               ...+|..+++||...
T Consensus       227 ~g~~i~~d~r~~ev~ri~~r~n~~vNe~~~~d~~RF~~d  265 (693)
T COG1034         227 VGCNIRVDERYGEVRRILPRYNEVVNEEWLCDKGRFAYD  265 (693)
T ss_pred             cccceeecccccchhhhcccchhHHHHHHhccccccccc
Confidence            999776533               345677888888654

>PRK09130 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G	Back alignment and domain information

>PRK07860 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>PRK09129 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>PRK08166 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>PRK08493 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional	Back alignment and domain information

>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only]	Back alignment and domain information

>KOG2282\|consensus	Back alignment and domain information

>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated	Back alignment and domain information

>PF10588 NADH-G_4Fe-4S_3: NADH-ubiquinone oxidoreductase-G iron-sulfur binding region; InterPro: IPR019574 NADH:ubiquinone oxidoreductase (complex I) (1	Back alignment and domain information

>PF10588 NADH-G_4Fe-4S_3: NADH-ubiquinone oxidoreductase-G iron-sulfur binding region; InterPro: IPR019574 NADH:ubiquinone oxidoreductase (complex I) (1	Back alignment and domain information

>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion]	Back alignment and domain information

>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional	Back alignment and domain information

>PRK09130 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G	Back alignment and domain information

>PRK09129 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>PRK08764 ferredoxin; Provisional	Back alignment and domain information

>PRK07860 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>KOG2282\|consensus	Back alignment and domain information

>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated	Back alignment and domain information

>PRK08493 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>PRK08166 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only]	Back alignment and domain information

>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional	Back alignment and domain information

>PRK05113 electron transport complex protein RnfB; Provisional	Back alignment and domain information

>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional	Back alignment and domain information

>TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit	Back alignment and domain information

>PRK06991 ferredoxin; Provisional	Back alignment and domain information

>PF12798 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion]	Back alignment and domain information

>PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J	Back alignment and domain information

>PF13746 Fer4_18: 4Fe-4S dicluster domain	Back alignment and domain information

>PF13484 Fer4_16: 4Fe-4S double cluster binding domain	Back alignment and domain information

>PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B	Back alignment and domain information

>PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A	Back alignment and domain information

>CHL00065 psaC photosystem I subunit VII	Back alignment and domain information

>PRK08764 ferredoxin; Provisional	Back alignment and domain information

>PF12800 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PRK08222 hydrogenase 4 subunit H; Validated	Back alignment and domain information

>PLN00071 photosystem I subunit VII; Provisional	Back alignment and domain information

>PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J	Back alignment and domain information

>TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC	Back alignment and domain information

>KOG3256\|consensus	Back alignment and domain information

>TIGR02936 fdxN_nitrog ferredoxin III, nif-specific	Back alignment and domain information

>COG1145 NapF Ferredoxin [Energy production and conversion]	Back alignment and domain information

>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion]	Back alignment and domain information

>PRK02651 photosystem I subunit VII; Provisional	Back alignment and domain information

>TIGR01971 NuoI NADH-quinone oxidoreductase, chain I	Back alignment and domain information

>TIGR00403 ndhI NADH-plastoquinone oxidoreductase subunit I protein	Back alignment and domain information

>PRK05888 NADH dehydrogenase subunit I; Provisional	Back alignment and domain information

>COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion]	Back alignment and domain information

>PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed	Back alignment and domain information

>PRK06273 ferredoxin; Provisional	Back alignment and domain information

>TIGR01971 NuoI NADH-quinone oxidoreductase, chain I	Back alignment and domain information

>TIGR00402 napF ferredoxin-type protein NapF	Back alignment and domain information

>PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional	Back alignment and domain information

>PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional	Back alignment and domain information

>PRK09477 napH quinol dehydrogenase membrane component; Provisional	Back alignment and domain information

>PRK08222 hydrogenase 4 subunit H; Validated	Back alignment and domain information

>PRK06273 ferredoxin; Provisional	Back alignment and domain information

>PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B	Back alignment and domain information

>PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed	Back alignment and domain information

>CHL00014 ndhI NADH dehydrogenase subunit I	Back alignment and domain information

>TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC	Back alignment and domain information

>PRK10194 ferredoxin-type protein; Provisional	Back alignment and domain information

>PRK09898 hypothetical protein; Provisional	Back alignment and domain information

>PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>TIGR02936 fdxN_nitrog ferredoxin III, nif-specific	Back alignment and domain information

>PRK02651 photosystem I subunit VII; Provisional	Back alignment and domain information

>PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family	Back alignment and domain information

>COG1146 Ferredoxin [Energy production and conversion]	Back alignment and domain information

>TIGR02179 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family	Back alignment and domain information

>TIGR02912 sulfite_red_C sulfite reductase, subunit C	Back alignment and domain information

>COG1600 Uncharacterized Fe-S protein [Energy production and conversion]	Back alignment and domain information

>PRK05888 NADH dehydrogenase subunit I; Provisional	Back alignment and domain information

>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional	Back alignment and domain information

>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional	Back alignment and domain information

>TIGR00402 napF ferredoxin-type protein NapF	Back alignment and domain information

>PRK09623 vorD 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>PRK14028 pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional	Back alignment and domain information

>COG1145 NapF Ferredoxin [Energy production and conversion]	Back alignment and domain information

>TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein	Back alignment and domain information

>PRK06991 ferredoxin; Provisional	Back alignment and domain information

>TIGR02486 RDH reductive dehalogenase	Back alignment and domain information

>TIGR00276 iron-sulfur cluster binding protein, putative	Back alignment and domain information

>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family	Back alignment and domain information

>COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion]	Back alignment and domain information

>PLN00071 photosystem I subunit VII; Provisional	Back alignment and domain information

>PF13183 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_B 2BS3_B 1QLB_B 2BS2_B 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N	Back alignment and domain information

>PRK09476 napG quinol dehydrogenase periplasmic component; Provisional	Back alignment and domain information

>TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family	Back alignment and domain information

>PRK07118 ferredoxin; Validated	Back alignment and domain information

>TIGR02910 sulfite_red_A sulfite reductase, subunit A	Back alignment and domain information

>PRK10194 ferredoxin-type protein; Provisional	Back alignment and domain information

>PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional	Back alignment and domain information

>TIGR02060 aprB adenosine phosphosulphate reductase, beta subunit	Back alignment and domain information

>TIGR03290 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subunit C	Back alignment and domain information

>TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein	Back alignment and domain information

>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein	Back alignment and domain information

>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family	Back alignment and domain information

>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein	Back alignment and domain information

>PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric	Back alignment and domain information

>TIGR02512 Fe_only_hydrog hydrogenases, Fe-only	Back alignment and domain information

>PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>TIGR02512 Fe_only_hydrog hydrogenases, Fe-only	Back alignment and domain information

>PRK15055 anaerobic sulfite reductase subunit A; Provisional	Back alignment and domain information

>TIGR01660 narH nitrate reductase, beta subunit	Back alignment and domain information

>PRK13795 hypothetical protein; Provisional	Back alignment and domain information

>PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional	Back alignment and domain information

>TIGR00403 ndhI NADH-plastoquinone oxidoreductase subunit I protein	Back alignment and domain information

>CHL00014 ndhI NADH dehydrogenase subunit I	Back alignment and domain information

>PRK07118 ferredoxin; Validated	Back alignment and domain information

>PF13247 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX_B 2VPZ_B 2VPW_F 3IR7_B 1Y5N_B 1R27_D 3EGW_B 1Y5I_B 1Q16_B	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		139
2fug_3		783	Crystal Structure Of The Hydrophilic Domain Of Resp		3e-12
2fug_3		783	Crystal Structure Of The Hydrophilic Domain Of Resp		5e-10

>pdb|2FUG|3 Chain 3, Crystal Structure Of The Hydrophilic Domain Of Respiratory Complex I From Thermus Thermophilus Length = 783

Back alignment and structure

Iteration: 1
 Score = 67.0 bits (162), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 38/49 (77%)
Query: 3   GWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFG 51
           G  V T S++ R A+ G++EF L+NHPLDCP CD+GG C+LQD+++ +G
Sbjct: 90  GMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYG 138

PyMOL of 2fug

>pdb|2FUG|3 Chain 3, Crystal Structure Of The Hydrophilic Domain Of Respiratory Complex I From Thermus Thermophilus Length = 783

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		139
3i9v_3		783	NADH-quinone oxidoreductase subunit 3; electron tr	3e-35
3i9v_3		783	NADH-quinone oxidoreductase subunit 3; electron tr	6e-28
3c8y_A		574	Iron hydrogenase 1; dithiomethylether, H-cluster,	3e-12
3c8y_A		574	Iron hydrogenase 1; dithiomethylether, H-cluster,	1e-07

>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* Length = 783	Back alignment and structure

 Score =  127 bits (320), Expect = 3e-35
 Identities = 26/72 (36%), Positives = 40/72 (55%)

Query: 1   MKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDI 60
             G  V T S++ R A+ G++EF L+NHPLDCP CD+GG C+LQD+++ +G     +   
Sbjct: 88  ADGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKG 147

Query: 61  DFSGKRWGYLRE 72
                 +     
Sbjct: 148 PLELPVYTRFEF 159

PyMOL of 3i9v

>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* Length = 783	Back alignment and structure

>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Length = 574	Back alignment and structure

>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Length = 574	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		139
3i9v_3		783	NADH-quinone oxidoreductase subunit 3; electron tr	99.92
3c8y_A		574	Iron hydrogenase 1; dithiomethylether, H-cluster,	99.56
3i9v_3		783	NADH-quinone oxidoreductase subunit 3; electron tr	98.16
2c42_A		1231	Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron,	97.61
1kf6_B		243	Fumarate reductase iron-sulfur protein; respiratio	97.39
3c8y_A		574	Iron hydrogenase 1; dithiomethylether, H-cluster,	97.34
2wdq_B		238	Succinate dehydrogenase iron-sulfur subunit; succi	96.63
3cf4_A		807	Acetyl-COA decarboxylase/synthase alpha subunit; m	96.62
2fgo_A		82	Ferredoxin; allochromatium vinosum, [4Fe-4S] clust	96.04
2zvs_A		85	Uncharacterized ferredoxin-like protein YFHL; elec	95.86
1rgv_A		80	Ferredoxin; electron transport; 2.90A {Thauera aro	95.83
2fdn_A		55	Ferredoxin; electron transport, iron-sulfur, 4Fe-4	95.82
3eun_A		82	Ferredoxin; electron transport, [4Fe-4S] cluster,	95.82
1bc6_A		77	7-Fe ferredoxin; electron transport, iron-sulfur;	95.12
1jb0_C		80	Photosystem I iron-sulfur center; membrane protein	94.84
1dwl_A		59	Ferredoxin I; electron transfer, model, heteronucl	94.7
1h98_A		78	Ferredoxin; electron transport, thermophilic, iron	94.36
1h98_A		78	Ferredoxin; electron transport, thermophilic, iron	94.3
7fd1_A		106	FD1, protein (7-Fe ferredoxin I); electron transpo	94.29
2fdn_A		55	Ferredoxin; electron transport, iron-sulfur, 4Fe-4	94.24
1f2g_A		58	Ferredoxin II; electron transport, FDII desulfovib	94.22
1jb0_C		80	Photosystem I iron-sulfur center; membrane protein	94.14
7fd1_A		106	FD1, protein (7-Fe ferredoxin I); electron transpo	94.11
1xer_A		103	Ferredoxin; electron transport, iron-sulfur, dupli	94.1
1dax_A		64	Ferredoxin I; electron transport, electron-transfe	94.09
1xer_A		103	Ferredoxin; electron transport, iron-sulfur, dupli	94.06
3i9v_9		182	NADH-quinone oxidoreductase subunit 9; electron tr	93.86
1bc6_A		77	7-Fe ferredoxin; electron transport, iron-sulfur;	93.77
1rof_A		60	Ferredoxin; electron transport, iron-sulfur; NMR {	93.76
2v2k_A		105	Ferredoxin; iron, transport, iron-sulfur, mycobact	93.61
2v2k_A		105	Ferredoxin; iron, transport, iron-sulfur, mycobact	93.31
3i9v_9		182	NADH-quinone oxidoreductase subunit 9; electron tr	93.1
1sj1_A		66	Ferredoxin; thermostability, iron-sulfur cluster,	92.52
1iqz_A		81	Ferredoxin; iron-sulfer protein, ultlahigh resolut	92.34
1rgv_A		80	Ferredoxin; electron transport; 2.90A {Thauera aro	91.99
1jnr_B		150	Adenylylsulfate reductase; oxidoreductase; HET: FA	91.58
2fgo_A		82	Ferredoxin; allochromatium vinosum, [4Fe-4S] clust	91.52
3eun_A		82	Ferredoxin; electron transport, [4Fe-4S] cluster,	90.96
3gyx_B		166	Adenylylsulfate reductase; oxidoreductase; HET: FA	90.77
1hfe_L		421	Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larg	90.12
1hfe_L		421	Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larg	89.83
2zvs_A		85	Uncharacterized ferredoxin-like protein YFHL; elec	88.68
1gte_A		1025	Dihydropyrimidine dehydrogenase; electron transfer	88.68
2vpz_B		195	NRFC protein; oxidoreductase, molybdopterin guanin	88.15
1jnr_B		150	Adenylylsulfate reductase; oxidoreductase; HET: FA	87.34
2wdq_B		238	Succinate dehydrogenase iron-sulfur subunit; succi	87.28
3gyx_B		166	Adenylylsulfate reductase; oxidoreductase; HET: FA	87.18
2ivf_B		352	Ethylbenzene dehydrogenase beta-subunit; anaerobic	86.2
2vpz_B		195	NRFC protein; oxidoreductase, molybdopterin guanin	85.6
3mm5_A		418	Sulfite reductase, dissimilatory-type subunit ALP;	85.24
3mm5_B		366	Sulfite reductase, dissimilatory-type subunit BET;	84.07
3or1_B		386	Sulfite reductase beta; dissimilatory sulfite redu	83.64
2c42_A		1231	Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron,	82.74
1ti6_B		274	Pyrogallol hydroxytransferase small subunit; molyb	82.66
1q16_B		512	Respiratory nitrate reductase 1 beta chain; membra	81.8
2ivf_B		352	Ethylbenzene dehydrogenase beta-subunit; anaerobic	80.51

>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3*	Back alignment and structure

Probab=99.92  E-value=1.5e-25  Score=193.49  Aligned_cols=119  Identities=32%  Similarity=0.601  Sum_probs=94.2

Q ss_pred             CCCCEEEcCCHHHHHHHHHHHHHHHHhCCCCCCCcCCCCcchhHHHHHHhCCC-------------Ccccccc-------
Q psy3842           1 MKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSD-------------RSRFTDI-------   60 (139)
Q Consensus         1 ~~Gm~V~T~s~~v~~~r~~~lelll~~h~~~C~~C~~~g~C~Lq~l~~~~g~~-------------~~r~~~~-------   60 (139)
                      ++||+|+|+||+++++||.+|||||+|||+||++|+++|+|+||+++..||+.             ..+|...       
T Consensus        88 ~~gm~v~t~~~~~~~~r~~~le~ll~nhp~dC~~C~~~g~C~Lq~~~~~~g~~~~~~~~~~~~~p~~~r~~~~k~~~~~~  167 (783)
T 3i9v_3           88 ADGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKGPLELPVYTRFEFTRRHVDKH  167 (783)
T ss_dssp             CSSEEEESSSHHHHHHHHHHHHHHHTSCCCCTTTCTTGGGCHHHHHHHHHCSCCCC------CCCCCCCCCSCCCCCCCS
T ss_pred             CCCCEEEECCHHHHHHHHHHHHHHHhcCCCCCccCCCCCCCHHHHHHHHhCCccccccccccccccccccccccccCCcc
Confidence            58999999999999999999999999999999999999999999999999993             2344321       


Q ss_pred             -------ccCCCcc--------------cc------------cc---ccceeecccCceecccCCcccccce-------e
Q psy3842          61 -------DFSGKRW--------------GY------------LR---EKLFLSELSGKRESTCAPAREGVME-------F   97 (139)
Q Consensus        61 -------~~~~~r~--------------~t------------~~---~~~~~~~~~g~~~~~CPtgal~~~e-------~   97 (139)
                             .++.+||              +.            .+   +....|+.||+|+++||||||+.++       |
T Consensus       168 ~~~~p~i~~d~~~CI~C~~Cv~~C~~~~~~~~i~~~~~g~~~~i~~~~~~~~C~~CG~Cv~vCP~gAl~~~~~~~~~r~w  247 (783)
T 3i9v_3          168 HPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSGFSGNITDICPVGALLDLTARFRARNW  247 (783)
T ss_dssp             EEEETTEEECTTTCCCCCHHHHHHHHTTCCCCCEECSCTTSCCEECSSTTCCSTTTTTHHHHCSSSSEEEGGGTTSCCTT
T ss_pred             cCCCccEEEchhhCCCccHHHHHhhhhcCCceeeeecCCCccEEccCCCCCCCccchhHHhhcccCceeccccccccccc
Confidence                   0122333              00            01   1223699999999999999997553       5


Q ss_pred             eeccccccCCCCCCCCcchhHH
Q psy3842          98 LLVNHPLDCPICDQGGECDLQD  119 (139)
Q Consensus        98 ~l~~~~~~C~~C~~g~~~eL~~  119 (139)
                      .++..+++|++|+.||+..++.
T Consensus       248 ~~~~~~s~C~~C~~gC~i~v~v  269 (783)
T 3i9v_3          248 EMEETPTTCALCPVGCGITADT  269 (783)
T ss_dssp             TSEEEEEECCSSSSCCEEEEEE
T ss_pred             cceEEEEeCCCCCCcccceeee
Confidence            6677889999999999987743

PyMOL of 3i9v

>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A*	Back alignment and structure

>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3*	Back alignment and structure

>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A*	Back alignment and structure

>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B*	Back alignment and structure

>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A*	Back alignment and structure

>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B*	Back alignment and structure

>3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri}	Back alignment and structure

>2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa}	Back alignment and structure

>2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron-SULF clusters, reduction potential; 1.65A {Escherichia coli}	Back alignment and structure

>1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica} SCOP: d.58.1.1	Back alignment and structure

>2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A	Back alignment and structure

>3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} SCOP: d.58.1.1 PDB: 1blu_A 3exy_A	Back alignment and structure

>1bc6_A 7-Fe ferredoxin; electron transport, iron-sulfur; NMR {Bacillus schlegelii} SCOP: d.58.1.2 PDB: 1bd6_A 1bqx_A 1bwe_A	Back alignment and structure

>1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C*	Back alignment and structure

>1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1	Back alignment and structure

>1h98_A Ferredoxin; electron transport, thermophilic, iron-sulfur, azotobacter, hydrogen bonds, stability, high resolution; 1.64A {Thermus aquaticus} SCOP: d.58.1.2	Back alignment and structure

>1h98_A Ferredoxin; electron transport, thermophilic, iron-sulfur, azotobacter, hydrogen bonds, stability, high resolution; 1.64A {Thermus aquaticus} SCOP: d.58.1.2	Back alignment and structure

>7fd1_A FD1, protein (7-Fe ferredoxin I); electron transport, iron-sulfur; 1.30A {Azotobacter vinelandii} SCOP: d.58.1.2 PDB: 1fda_A 1fdb_A 1fer_A 1axq_A 5fd1_A 6fdr_A 6fd1_A 7fdr_A 1frh_A 1fri_A 1fdd_A 1frl_A 1d3w_A 1frm_A 1frx_A 1g6b_A 1pc4_A 1frj_A 2fd2_A 1fd2_A ...	Back alignment and structure

>2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A	Back alignment and structure

>1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A	Back alignment and structure

>1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C*	Back alignment and structure

>7fd1_A FD1, protein (7-Fe ferredoxin I); electron transport, iron-sulfur; 1.30A {Azotobacter vinelandii} SCOP: d.58.1.2 PDB: 1fda_A 1fdb_A 1fer_A 1axq_A 5fd1_A 6fdr_A 6fd1_A 7fdr_A 1frh_A 1fri_A 1fdd_A 1frl_A 1d3w_A 1frm_A 1frx_A 1g6b_A 1pc4_A 1frj_A 2fd2_A 1fd2_A ...	Back alignment and structure

>1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A	Back alignment and structure

>1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A	Back alignment and structure

>1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A	Back alignment and structure

>3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_8* 2fug_9* 3iam_9* 3ias_9* 3m9s_9*	Back alignment and structure

>1bc6_A 7-Fe ferredoxin; electron transport, iron-sulfur; NMR {Bacillus schlegelii} SCOP: d.58.1.2 PDB: 1bd6_A 1bqx_A 1bwe_A	Back alignment and structure

>1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A	Back alignment and structure

>2v2k_A Ferredoxin; iron, transport, iron-sulfur, mycobacterium tuberculosis, Fe cluster, metal-binding, electron transfer, transport; 1.6A {Mycobacterium smegmatis}	Back alignment and structure

>2v2k_A Ferredoxin; iron, transport, iron-sulfur, mycobacterium tuberculosis, Fe cluster, metal-binding, electron transfer, transport; 1.6A {Mycobacterium smegmatis}	Back alignment and structure

>3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_8* 2fug_9* 3iam_9* 3ias_9* 3m9s_9*	Back alignment and structure

>1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A 3pni_A	Back alignment and structure

>1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A*	Back alignment and structure

>1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica} SCOP: d.58.1.1	Back alignment and structure

>1jnr_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.1.5 PDB: 1jnz_B* 2fja_B* 2fjb_B* 2fjd_B* 2fje_B*	Back alignment and structure

>2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa}	Back alignment and structure

>3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} SCOP: d.58.1.1 PDB: 1blu_A 3exy_A	Back alignment and structure

>3gyx_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas}	Back alignment and structure

>1hfe_L Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larger subunit)); hydrogene metabolism, periplasm; 1.60A {Desulfovibrio vulgaris subsp} SCOP: c.96.1.1 d.58.1.5 PDB: 1e08_A* 1gx7_A*	Back alignment and structure

>1hfe_L Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larger subunit)); hydrogene metabolism, periplasm; 1.60A {Desulfovibrio vulgaris subsp} SCOP: c.96.1.1 d.58.1.5 PDB: 1e08_A* 1gx7_A*	Back alignment and structure

>2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron-SULF clusters, reduction potential; 1.65A {Escherichia coli}	Back alignment and structure

>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A*	Back alignment and structure

>2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B*	Back alignment and structure

>1jnr_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.1.5 PDB: 1jnz_B* 2fja_B* 2fjb_B* 2fjd_B* 2fje_B*	Back alignment and structure

>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B*	Back alignment and structure

>3gyx_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas}	Back alignment and structure

>2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum}	Back alignment and structure

>2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B*	Back alignment and structure

>3mm5_A Sulfite reductase, dissimilatory-type subunit ALP; alpha-beta-protein, oxidoreductase; HET: SRM; 1.80A {Archaeoglobus fulgidus} PDB: 3mm6_A* 3mm7_A* 3mm8_A* 3mm9_A* 3mma_A* 3mmb_A* 3mmc_A* 3c7b_A*	Back alignment and structure

>3mm5_B Sulfite reductase, dissimilatory-type subunit BET; alpha-beta-protein, oxidoreductase; HET: SRM; 1.80A {Archaeoglobus fulgidus} PDB: 3c7b_B* 3mm6_B* 3mm7_B* 3mm8_B* 3mm9_B* 3mma_B* 3mmb_B* 3mmc_B*	Back alignment and structure

>3or1_B Sulfite reductase beta; dissimilatory sulfite reductase, sulfate reduction, oxidored sulfite reduction; HET: SRM; 1.76A {Desulfovibrio gigas} PDB: 3or2_B* 2v4j_B* 2xsj_B*	Back alignment and structure

>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A*	Back alignment and structure

>1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N*	Back alignment and structure

>1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B*	Back alignment and structure

>2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		139
d3c8ya2		126	d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal	2e-21
d3c8ya2		126	d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal	9e-18
d2fug34		151	d.58.1.5 (3:96-246) NADH-quinone oxidoreductase ch	4e-14
d2fug34		151	d.58.1.5 (3:96-246) NADH-quinone oxidoreductase ch	5e-12

>d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} Length = 126	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin domains from multidomain proteins
domain: Fe-only hydrogenase, N-terminal domain
species: Clostridium pasteurianum [TaxId: 1501]

 Score = 81.5 bits (201), Expect = 2e-21
 Identities = 11/57 (19%), Positives = 22/57 (38%)

Query: 1   MKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRF 57
             G  + TNS+      +  +  LL  H   C  C++   C+     + + +  S+ 
Sbjct: 67  EDGMIINTNSDAVNEKIKSRISQLLDIHEFKCGPCNRRENCEFLKLVIKYKARASKP 123

PyMOL of d3c8ya2

>d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} Length = 126	Back information, alignment and structure

>d2fug34 d.58.1.5 (3:96-246) NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 {Thermus thermophilus [TaxId: 274]} Length = 151	Back information, alignment and structure

>d2fug34 d.58.1.5 (3:96-246) NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 {Thermus thermophilus [TaxId: 274]} Length = 151	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		139
d2fug34		151	NADH-quinone oxidoreductase chain 3, Nqo3, domain	99.92
d3c8ya2		126	Fe-only hydrogenase, N-terminal domain {Clostridiu	99.84
d3c8ya2		126	Fe-only hydrogenase, N-terminal domain {Clostridiu	99.16
d2fug34		151	NADH-quinone oxidoreductase chain 3, Nqo3, domain	98.35
d3c8ya3		83	Fe-only hydrogenase, second domain {Clostridium pa	97.37
d2fdna_		55	Ferredoxin II {Clostridium acidurici [TaxId: 1556]	96.86
d1jb0c_		80	Photosystem I iron-sulfur protein PsaC {Synechococ	96.46
d1blua_		80	Ferredoxin II {Chromatium vinosum [TaxId: 1049]}	96.43
d1bc6a_		77	Ferredoxin {Bacillus schlegelii [TaxId: 1484]}	96.33
d1rgva_		80	Ferredoxin II {Thauera aromatica [TaxId: 59405]}	96.29
d1hfel2		85	Fe-only hydrogenase larger subunit, N-domain {Desu	96.06
d2fug91		154	NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus	96.02
d1hfel2		85	Fe-only hydrogenase larger subunit, N-domain {Desu	95.81
d1dura_		55	Ferredoxin II {Peptostreptococcus asaccharolyticus	95.72
d1xera_		103	Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]}	95.69
d1h98a_		77	Ferredoxin {Thermus thermophilus [TaxId: 274]}	95.38
d1dura_		55	Ferredoxin II {Peptostreptococcus asaccharolyticus	95.33
d7fd1a_		106	Ferredoxin {Azotobacter vinelandii [TaxId: 354]}	95.23
d2fdna_		55	Ferredoxin II {Clostridium acidurici [TaxId: 1556]	95.13
d1bc6a_		77	Ferredoxin {Bacillus schlegelii [TaxId: 1484]}	95.08
d1h98a_		77	Ferredoxin {Thermus thermophilus [TaxId: 274]}	94.94
d1xera_		103	Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]}	94.86
d2c42a5		117	Pyruvate-ferredoxin oxidoreductase, PFOR, domain V	94.73
d1jb0c_		80	Photosystem I iron-sulfur protein PsaC {Synechococ	94.64
d1sj1a_		66	Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxI	94.56
d3c7bb1		65	DsrB insert domain {Archaeoglobus fulgidus [TaxId:	93.6
d1vjwa_		59	Ferredoxin A {Thermotoga maritima [TaxId: 2336]}	93.27
d7fd1a_		106	Ferredoxin {Azotobacter vinelandii [TaxId: 354]}	93.25
d1rgva_		80	Ferredoxin II {Thauera aromatica [TaxId: 59405]}	92.71
d1blua_		80	Ferredoxin II {Chromatium vinosum [TaxId: 1049]}	92.7
d1fxra_		64	Ferredoxin I {Sulfate-reducing bacteria (Desulfovi	91.9
d1gtea5		173	Dihydropyrimidine dehydrogenase, C-terminal domain	91.63
d1fxda_		58	Ferredoxin I {Desulfovibrio gigas [TaxId: 879]}	91.54
d2fug91		154	NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus	90.32
d2bs2b1		133	Fumarate reductase {Wolinella succinogenes [TaxId:	90.18
d1jnrb_		149	Adenylylsulfate reductase B subunit {Archaeon Arch	89.49
d1jnrb_		149	Adenylylsulfate reductase B subunit {Archaeon Arch	89.35
d1gtea5		173	Dihydropyrimidine dehydrogenase, C-terminal domain	88.35
d2c42a5		117	Pyruvate-ferredoxin oxidoreductase, PFOR, domain V	87.36
d1iqza_		81	Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1	87.15
d1nekb1		132	Succinate dehydogenase {Escherichia coli [TaxId: 5	86.21
d1vlfn2		195	Transhydroxylase beta subunit, BthL, N-terminal do	85.69
d1kf6b1		138	Fumarate reductase {Escherichia coli [TaxId: 562]}	84.14
d1h0hb_		214	Tungsten containing formate dehydrogenase, small s	80.67

>d2fug34 d.58.1.5 (3:96-246) NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: 4Fe-4S ferredoxins
family: Ferredoxin domains from multidomain proteins
domain: NADH-quinone oxidoreductase chain 3, Nqo3, domain 2
species: Thermus thermophilus [TaxId: 274]

Probab=99.92  E-value=7.9e-26  Score=159.13  Aligned_cols=92  Identities=32%  Similarity=0.589  Sum_probs=70.6

Q ss_pred             CHHHHHHHHHHHHHHHHhCCCCCCCcCCCCcchhHHHHHHhCCCCcccccc---------------------------cc
Q psy3842          10 SEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDI---------------------------DF   62 (139)
Q Consensus        10 s~~v~~~r~~~lelll~~h~~~C~~C~~~g~C~Lq~l~~~~g~~~~r~~~~---------------------------~~   62 (139)
                      ||+|+++||.+|||||++||++|++|+++|+|+||+++++||+...+|...                           .+
T Consensus         2 S~~v~~~Rk~ilelll~~Hp~dC~~C~~~g~C~LQ~~a~~~gv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~i~~   81 (151)
T d2fug34           2 SDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKGPLELPVYTRFEFTRRHVDKHHPLSPFVIL   81 (151)
T ss_dssp             CHHHHHHHHHHHHHHHHTCCCCTTTCTTGGGCHHHHHHHHTCCCCC--------CCCSCCCCBCCCCCCCCEESSSSSCE
T ss_pred             CHHHHHHHHHHHHHHHcCCCCcCCcccccCchHHHHHHHHhCCCccccccccccccccccccccccccCcccCCCCeEEe
Confidence            899999999999999999999999999999999999999999987666320                           01


Q ss_pred             CCCcc------------------------c--ccc---ccceeecccCceecccCCcccccceeeecc
Q psy3842          63 SGKRW------------------------G--YLR---EKLFLSELSGKRESTCAPAREGVMEFLLVN  101 (139)
Q Consensus        63 ~~~r~------------------------~--t~~---~~~~~~~~~g~~~~~CPtgal~~~e~~l~~  101 (139)
                      +.+|+                        |  +.+   +....|++||+|+++||||||+.+.+.++.
T Consensus        82 d~~kCI~C~rCvr~C~ev~g~~~l~~~~rG~~~~i~~~~~~~~c~~cG~Cv~vCPtGAL~ek~~r~k~  149 (151)
T d2fug34          82 DRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSGFSGNITDICPVGALLDLTARFRA  149 (151)
T ss_dssp             ECSCCCCCCHHHHHHHHTTCCCCCCCBSCGGGCBCCCSSTTCCSSCCTHHHHHCSSSSSBCGGGSSSC
T ss_pred             cCCCCCcCchHHhhhhhccCCceEEEeccccceEEccCCCCCCChhhcCHHhcCcccccccCCccccC
Confidence            22222                        1  112   122368999999999999999988776553

PyMOL of d2fug34

>d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]}	Back information, alignment and structure

>d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]}	Back information, alignment and structure

>d2fug34 d.58.1.5 (3:96-246) NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]}	Back information, alignment and structure

>d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]}	Back information, alignment and structure

>d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]}	Back information, alignment and structure

>d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]}	Back information, alignment and structure

>d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]}	Back information, alignment and structure

>d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]}	Back information, alignment and structure

>d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]}	Back information, alignment and structure

>d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]}	Back information, alignment and structure

>d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]}	Back information, alignment and structure

>d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]}	Back information, alignment and structure

>d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]}	Back information, alignment and structure

>d7fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]}	Back information, alignment and structure

>d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]}	Back information, alignment and structure

>d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]}	Back information, alignment and structure

>d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]}	Back information, alignment and structure

>d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]}	Back information, alignment and structure

>d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d3c7bb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d7fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]}	Back information, alignment and structure

>d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]}	Back information, alignment and structure

>d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]}	Back information, alignment and structure

>d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]}	Back information, alignment and structure

>d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}	Back information, alignment and structure

>d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]}	Back information, alignment and structure

>d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]}	Back information, alignment and structure

>d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vlfn2 d.58.1.5 (N:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]}	Back information, alignment and structure

>d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1h0hb_ d.58.1.5 (B:) Tungsten containing formate dehydrogenase, small subunit {Desulfovibrio gigas [TaxId: 879]}	Back information, alignment and structure