Psyllid ID: psy3850

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-----

MQSRYCGRFLSTSIDGRKFRQFDYGKDENLHIYNSTFPPKYDLKFISTKVAFFYADNDLLTNEQDVKELYTLLPNPVGLFKVNFTYFNHLDFLWAKDVKALVYNDLLLVLKTFSKTRARSEVLTVTNVIPQNPSLISDTDQGSPWERYLQMTMTERSLYATEKRLSTKRSDQTFMQKISAFPGDFSRKMERKWNNSTMREMLNHWIRPEPTPVPT

ccHHHHHHHHHHHHccccccccccccHHHHHcccccccccccccccccEEEEEEccccccccHHHHHHHHHHcccccEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHcccccccEEEEccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccc

ccHHHHHHHHHHHHHcccccEEccccHHHHHHHcccccccccccccEEEEEEEEccccccccHHHHHHHHHHcccHHHHHccccccccccHEEEcccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHEccccccHHHHHHHHHccHHHHHHHHHccccccccccc

mqsrycgrflstsidgrkfrqfdygkdenlhiynstfppkydlkfISTKVAFFyadndlltneQDVKELYTllpnpvglfkvnFTYFNHLDFLWAKDVKALVYNDLLLVLKTFSKTRARSEVLTVtnvipqnpslisdtdqgspwERYLQMTMTERSLYATEKRLSTKRSDQTFMQKIsafpgdfsrKMERKWNNSTMREMLNhwirpeptpvpt

mqsrycgrflstsidgrkfRQFDYGKDENLHIYNSTFPPKYDLKFISTKVAFFYADNDLLTNEQDVKELYTLLPNPVGLFKVNFTYFNHLDFLWAKDVKALVYNDLLLVLKTFsktrarsevltvtnvipqnpslisdtdqgsPWERYLQMTMTERSLYATEKRlstkrsdqtfmqkisafpgdfsrkmERKWNNSTMremlnhwirpeptpvpt

****YCGRFLSTSIDGRKFRQFDYGKDENLHIYNSTFPPKYDLKFISTKVAFFYADNDLLTNEQDVKELYTLLPNPVGLFKVNFTYFNHLDFLWAKDVKALVYNDLLLVLKTFSKTRARSEVLTVTNVIPQ***************RYL******************************************************************

*QSRYCGRFLSTSIDGRKFRQFDYGKDENLHIYNSTFPPKYDLKFISTKVAFFYADNDLLTNEQDVKELYTLLPNPVGLFKVNFTYFNHLDFLWAKDVKALVYNDLLLVLKT**********************************RYL****************************ISAFPGDFSRKMERKWNNSTMREMLNHWIRPEP*****

*QSRYCGRFLSTSIDGRKFRQFDYGKDENLHIYNSTFPPKYDLKFISTKVAFFYADNDLLTNEQDVKELYTLLPNPVGLFKVNFTYFNHLDFLWAKDVKALVYNDLLLVLKTFSK******************SLI****QGSPWERYLQMTMTERSLYATEKRLSTKRSDQTFMQKISAFPGDFSRKMERKWNNSTMREMLNHWIRPEP*****

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		215	2.2.26 [Sep-21-2011]
O46107		439	Lipase 1 OS=Drosophila me	no	N/A	0.451	0.220	0.350	3e-13
O46108		394	Lipase 3 OS=Drosophila me	no	N/A	0.446	0.243	0.364	4e-12
P80035		398	Gastric triacylglycerol l	yes	N/A	0.479	0.258	0.339	7e-11
Q29458		397	Gastric triacylglycerol l	yes	N/A	0.446	0.241	0.363	2e-10
P04634		395	Gastric triacylglycerol l	yes	N/A	0.409	0.222	0.384	3e-10
P07098		398	Gastric triacylglycerol l	yes	N/A	0.455	0.246	0.316	3e-09
Q9Z0M5		397	Lysosomal acid lipase/cho	yes	N/A	0.441	0.239	0.316	2e-08
Q9CPP7		395	Gastric triacylglycerol l	no	N/A	0.423	0.230	0.329	2e-08
Q3U4B4		400	Lipase member N OS=Mus mu	no	N/A	0.437	0.235	0.319	2e-08
Q5VXI9		398	Lipase member N OS=Homo s	no	N/A	0.432	0.233	0.33	4e-08

>sp\|O46107\|LIP1_DROME Lipase 1 OS=Drosophila melanogaster GN=Lip1 PE=2 SV=2	Back alignment and function desciption

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 56/97 (57%)

Query: 14  IDGRKFRQFDYGKDENLHIYNSTFPPKYDLKFISTKVAFFYADNDLLTNEQDVKELYTLL 73
           I   +F  + Y  ++N+ +Y    PP+Y+L  ++     +Y+ NDLL + +DV+ +   L
Sbjct: 318 IKSGRFAPYSYSSNKNMQLYRDHLPPRYNLSLVTVPTFVYYSTNDLLCHPKDVESMCDDL 377

Query: 74  PNPVGLFKVNFTYFNHLDFLWAKDVKALVYNDLLLVL 110
            N  G + V    FNH+DFLWA DV+ ++Y  +L VL
Sbjct: 378 GNVTGKYLVPQKEFNHMDFLWAIDVRKMLYRRMLQVL 414

Could be a digestive enzyme.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: -

>sp\|O46108\|LIP3_DROME Lipase 3 OS=Drosophila melanogaster GN=Lip3 PE=2 SV=1	Back alignment and function description

>sp\|P80035\|LIPG_CANFA Gastric triacylglycerol lipase OS=Canis familiaris GN=LIPF PE=1 SV=2	Back alignment and function description

>sp\|Q29458\|LIPG_BOVIN Gastric triacylglycerol lipase OS=Bos taurus GN=LIPF PE=1 SV=1	Back alignment and function description

>sp\|P04634\|LIPG_RAT Gastric triacylglycerol lipase OS=Rattus norvegicus GN=Lipf PE=2 SV=1	Back alignment and function description

>sp\|P07098\|LIPG_HUMAN Gastric triacylglycerol lipase OS=Homo sapiens GN=LIPF PE=1 SV=1	Back alignment and function description

>sp\|Q9Z0M5\|LICH_MOUSE Lysosomal acid lipase/cholesteryl ester hydrolase OS=Mus musculus GN=Lipa PE=2 SV=2	Back alignment and function description

>sp\|Q9CPP7\|LIPG_MOUSE Gastric triacylglycerol lipase OS=Mus musculus GN=Lipf PE=2 SV=1	Back alignment and function description

>sp\|Q3U4B4\|LIPN_MOUSE Lipase member N OS=Mus musculus GN=Lipn PE=2 SV=1	Back alignment and function description

>sp\|Q5VXI9\|LIPN_HUMAN Lipase member N OS=Homo sapiens GN=LIPN PE=2 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		215
332030606		601	Lipase 3 [Acromyrmex echinatior]	0.460	0.164	0.534	1e-21
380023946		391	PREDICTED: lipase 3-like [Apis florea]	0.479	0.263	0.495	4e-21
307187507		376	Lipase 3 [Camponotus floridanus]	0.493	0.281	0.471	2e-20
307183093		424	Lipase 3 [Camponotus floridanus]	0.441	0.224	0.505	2e-20
307170415		355	Lipase 1 [Camponotus floridanus]	0.451	0.273	0.494	2e-20
332030605		421	Lipase 3 [Acromyrmex echinatior]	0.437	0.223	0.563	2e-20
307175214		395	Lipase 3 [Camponotus floridanus]	0.432	0.235	0.516	3e-20
307166065		415	Lipase 3 [Camponotus floridanus]	0.455	0.236	0.469	6e-20
383853876		399	PREDICTED: lipase 3-like [Megachile rotu	0.465	0.250	0.51	2e-19
332030056		371	Lipase 3 [Acromyrmex echinatior]	0.455	0.264	0.530	2e-19

>gi\|332030606\|gb\|EGI70294.1\| Lipase 3 [Acromyrmex echinatior]	Back alignment and taxonomy information

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 67/101 (66%), Gaps = 2/101 (1%)

Query: 11  STSIDGRKFRQFDYGKDENLHIYNSTFPPKYDLKFISTKVAFFYADNDLLTNEQDVKELY 70
           S  I   KFRQ+DYG+  NL IYN+T PP YDL  I+  +A FY DND L N  DVK+LY
Sbjct: 488 SQEIKSGKFRQYDYGRKNNLLIYNATEPPDYDLGNITLPIAIFYGDNDWLANSVDVKKLY 547

Query: 71  TLLPNPVGLFKVNFTYFNHLDFLWAKDVKALVYNDLLLVLK 111
            LLPN + +++V    FNHLDF+W KD   LVY  LL ++K
Sbjct: 548 HLLPNILDMYRV--PKFNHLDFIWGKDAPKLVYKRLLEIMK 586

Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|380023946\|ref\|XP_003695770.1\| PREDICTED: lipase 3-like [Apis florea]	Back alignment and taxonomy information

>gi\|307187507\|gb\|EFN72560.1\| Lipase 3 [Camponotus floridanus]	Back alignment and taxonomy information

>gi\|307183093\|gb\|EFN70010.1\| Lipase 3 [Camponotus floridanus]	Back alignment and taxonomy information

>gi\|307170415\|gb\|EFN62712.1\| Lipase 1 [Camponotus floridanus]	Back alignment and taxonomy information

>gi\|332030605\|gb\|EGI70293.1\| Lipase 3 [Acromyrmex echinatior]	Back alignment and taxonomy information

>gi\|307175214\|gb\|EFN65283.1\| Lipase 3 [Camponotus floridanus]	Back alignment and taxonomy information

>gi\|307166065\|gb\|EFN60337.1\| Lipase 3 [Camponotus floridanus]	Back alignment and taxonomy information

>gi\|383853876\|ref\|XP_003702448.1\| PREDICTED: lipase 3-like [Megachile rotundata]	Back alignment and taxonomy information

>gi\|332030056\|gb\|EGI69881.1\| Lipase 3 [Acromyrmex echinatior]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		215
FB\|FBgn0032265		422	CG18301 [Drosophila melanogast	0.511	0.260	0.378	1.3e-15
FB\|FBgn0051871		531	CG31871 [Drosophila melanogast	0.469	0.190	0.445	1.7e-15
FB\|FBgn0032264		434	Lip4 "Lipase 4" [Drosophila me	0.432	0.214	0.397	6.1e-14
FB\|FBgn0023496		439	Lip1 "Lipase 1" [Drosophila me	0.469	0.230	0.352	6.3e-14
FB\|FBgn0038070		405	CG6753 [Drosophila melanogaste	0.460	0.244	0.346	8.5e-14
FB\|FBgn0032981		425	CG3635 [Drosophila melanogaste	0.446	0.225	0.350	9.6e-14
FB\|FBgn0023495		394	Lip3 "Lip3" [Drosophila melano	0.446	0.243	0.364	1.6e-12
FB\|FBgn0033999		398	CG8093 [Drosophila melanogaste	0.413	0.223	0.362	1.7e-12
WB\|WBGene00021963		562	lipl-6 [Caenorhabditis elegans	0.441	0.169	0.354	2e-12
UNIPROTKB\|P80035		398	LIPF "Gastric triacylglycerol	0.479	0.258	0.349	2.2e-12

FB\|FBgn0032265 CG18301 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 202 (76.2 bits), Expect = 1.3e-15, P = 1.3e-15
 Identities = 42/111 (37%), Positives = 65/111 (58%)

Query:    18 KFRQFDYGKDENLHIYNSTFPPKYDLKFISTKVAFFYADNDLLTNEQDVKELYTLLPNPV 77
             KF+QFDYG    LH Y S  PP Y+L+ +  KVA +YA ND +   +DV  L+  LPN V
Sbjct:   308 KFQQFDYGLLNFLH-YGSLSPPPYELEKVKAKVAIYYAKNDWIAPPEDVDMLFNRLPNVV 366

Query:    78 GLFKVNFTYFNHLDFLWAKDVKALVYNDLLLVLKTFSKTRARSEVLTVTNV 128
               + V    FNH D +W +D K +++N +L V+++     + ++  ++T V
Sbjct:   367 EKYLVPNENFNHFDLVWGRDAKRILWNRMLGVMQSVVPYSSYNDGDSITTV 417

GO:0006629 "lipid metabolic process" evidence=IEA

GO:0016788 "hydrolase activity, acting on ester bonds" evidence=IEA

FB\|FBgn0051871 CG31871 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0032264 Lip4 "Lipase 4" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0023496 Lip1 "Lipase 1" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0038070 CG6753 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0032981 CG3635 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0023495 Lip3 "Lip3" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0033999 CG8093 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

WB\|WBGene00021963 lipl-6 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

UNIPROTKB\|P80035 LIPF "Gastric triacylglycerol lipase" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		215
PLN02872		395	PLN02872, PLN02872, triacylglycerol lipase	7e-07

>gnl\|CDD\|215470 PLN02872, PLN02872, triacylglycerol lipase	Back alignment and domain information

 Score = 48.3 bits (115), Expect = 7e-07
 Identities = 34/112 (30%), Positives = 52/112 (46%), Gaps = 6/112 (5%)

Query: 8   RFLSTSIDGRKFRQFDYGKDENLHIYNSTFPPKYDLKFISTKVAFF--YADNDLLTNEQD 65
           R L   I    F  +DYG  +NL +Y    PP +DL  I   +  +  Y   D L +  D
Sbjct: 284 RHLFQMIRKGTFAHYDYGIFKNLKLYGQVNPPAFDLSLIPKSLPLWMGYGGTDGLADVTD 343

Query: 66  VKELYTLLPN-PVGLFKVNFTYFNHLDFLWAKDVKALVYNDLLLVLKTFSKT 116
           V+     LP+ P  L+  N   + H+DFL +   K  VYN ++   ++  K+
Sbjct: 344 VEHTLAELPSKPELLYLEN---YGHIDFLLSTSAKEDVYNHMIQFFRSLGKS 392

Length = 395

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		215
KOG2624\|consensus		403		100.0
PLN02872		395	triacylglycerol lipase	99.96
TIGR01836		350	PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth	98.03
PRK07868		994	acyl-CoA synthetase; Validated	97.7
PF00561		230	Abhydrolase_1: alpha/beta hydrolase fold A web pag	97.58
PHA02857		276	monoglyceride lipase; Provisional	97.21
TIGR01738		245	bioH putative pimeloyl-BioC--CoA transferase BioH.	97.16
TIGR02240		276	PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer	97.13
PLN02385		349	hydrolase; alpha/beta fold family protein	97.04
PLN02298		330	hydrolase, alpha/beta fold family protein	97.03
PF00326		213	Peptidase_S9: Prolyl oligopeptidase family This fa	96.95
TIGR02427		251	protocat_pcaD 3-oxoadipate enol-lactonase. Members	96.87
TIGR03611		257	RutD pyrimidine utilization protein D. This protei	96.85
PRK10749		330	lysophospholipase L2; Provisional	96.75
PRK07581		339	hypothetical protein; Validated	96.62
TIGR01392		351	homoserO_Ac_trn homoserine O-acetyltransferase. Th	96.57
PRK00870		302	haloalkane dehalogenase; Provisional	96.55
TIGR03343		282	biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die	96.53
TIGR03056		278	bchO_mg_che_rel putative magnesium chelatase acces	96.46
PLN02652		395	hydrolase; alpha/beta fold family protein	96.45
PLN02824		294	hydrolase, alpha/beta fold family protein	96.44
TIGR01250		288	pro_imino_pep_2 proline-specific peptidases, Bacil	96.3
PLN02965		255	Probable pheophorbidase	96.22
PRK00175		379	metX homoserine O-acetyltransferase; Provisional	96.13
TIGR01849		406	PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase,	96.12
PF01738		218	DLH: Dienelactone hydrolase family; InterPro: IPR0	96.06
PRK08775		343	homoserine O-acetyltransferase; Provisional	96.05
PRK10349		256	carboxylesterase BioH; Provisional	95.95
PLN03087		481	BODYGUARD 1 domain containing hydrolase; Provision	95.92
PRK06765		389	homoserine O-acetyltransferase; Provisional	95.85
PF12697		228	Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3	95.85
PRK10985		324	putative hydrolase; Provisional	95.84
PRK06489		360	hypothetical protein; Provisional	95.68
PLN02679		360	hydrolase, alpha/beta fold family protein	95.63
PLN02578		354	hydrolase	95.41
PRK03592		295	haloalkane dehalogenase; Provisional	95.33
PRK10673		255	acyl-CoA esterase; Provisional	95.25
TIGR01249		306	pro_imino_pep_1 proline iminopeptidase, Neisseria-	94.92
COG0429		345	Predicted hydrolase of the alpha/beta-hydrolase fo	94.77
PLN02511		388	hydrolase	94.62
PF12695		145	Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3	94.48
PF11339		581	DUF3141: Protein of unknown function (DUF3141); In	94.38
PRK10566		249	esterase; Provisional	94.13
TIGR01607		332	PST-A Plasmodium subtelomeric family (PST-A). Thes	94.04
KOG1455\|consensus		313		94.0
PLN02894		402	hydrolase, alpha/beta fold family protein	93.98
PRK03204		286	haloalkane dehalogenase; Provisional	93.86
KOG1454\|consensus		326		93.73
COG1506		620	DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept	93.65
TIGR03695		251	menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene	93.65
COG2267		298	PldB Lysophospholipase [Lipid metabolism]	93.18
COG3243		445	PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me	92.68
TIGR03100		274	hydr1_PEP hydrolase, ortholog 1, exosortase system	92.57
PRK05077		414	frsA fermentation/respiration switch protein; Revi	92.4
KOG3043\|consensus		242		91.6
PRK13604		307	luxD acyl transferase; Provisional	91.44
COG1073		299	Hydrolases of the alpha/beta superfamily [General	91.12
PRK14875		371	acetoin dehydrogenase E2 subunit dihydrolipoyllysi	90.56
PLN03084		383	alpha/beta hydrolase fold protein; Provisional	90.27
COG2021		368	MET2 Homoserine acetyltransferase [Amino acid tran	90.2
COG0412		236	Dienelactone hydrolase and related enzymes [Second	89.94
PLN02980		1655	2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi	89.73
TIGR01838		532	PHA_synth_I poly(R)-hydroxyalkanoic acid synthase,	89.47
PRK05855		582	short chain dehydrogenase; Validated	89.25
PRK11126		242	2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl	86.59
PRK05371		767	x-prolyl-dipeptidyl aminopeptidase; Provisional	86.3
COG0596		282	MhpC Predicted hydrolases or acyltransferases (alp	86.03
PLN02211		273	methyl indole-3-acetate methyltransferase	85.22
TIGR01839		560	PHA_synth_II poly(R)-hydroxyalkanoic acid synthase	85.14
PF08840		213	BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term	84.85
COG1647		243	Esterase/lipase [General function prediction only]	84.72
KOG4178\|consensus		322		83.41
PF08386		103	Abhydrolase_4: TAP-like protein; InterPro: IPR0135	82.55
PF02230		216	Abhydrolase_2: Phospholipase/Carboxylesterase; Int	82.34
PF10142		367	PhoPQ_related: PhoPQ-activated pathogenicity-relat	81.05

>KOG2624\|consensus	Back alignment and domain information

Probab=100.00  E-value=7.4e-34  Score=265.30  Aligned_cols=114  Identities=37%  Similarity=0.647  Sum_probs=109.1

Q ss_pred             chhhhHHHHHHHHhCCCccccccCCcccccccCCccCccccccccCceEEEEeeCCCccCchHhHHHHHhhCCCceeeeE
Q psy3850           2 QSRYCGRFLSTSIDGRKFRQFDYGKDENLHIYNSTFPPKYDLKFISTKVAFFYADNDLLTNEQDVKELYTLLPNPVGLFK   81 (215)
Q Consensus         2 TSvK~l~H~~Q~i~Sg~Fq~YDYG~~~Nl~~YGq~tPP~YnLsnItvPV~LfyG~nD~La~p~DV~~L~~~LpNv~~~~~   81 (215)
                      ||+||++||+|+++||+|++||||..+|+++|||.+||+|++++|++||+||||++|+|++++||+.++..++|....+.
T Consensus       287 tSvk~~~H~~Q~~~s~~f~~yD~G~~~N~~~Y~q~~pP~Y~l~~i~~P~~l~~g~~D~l~~~~DV~~~~~~~~~~~~~~~  366 (403)
T KOG2624|consen  287 TSVKNIVHWAQIVRSGKFRKYDYGSKRNLKHYGQSTPPEYDLTNIKVPTALYYGDNDWLADPEDVLILLLVLPNSVIKYI  366 (403)
T ss_pred             ccHHHHHHHHHHhcCCCccccCCCccccHhhcCCCCCCCCCccccccCEEEEecCCcccCCHHHHHHHHHhccccccccc
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999998776666


Q ss_pred             eeCCCCcccchhhcccchhHHHHHHHHHHHhccc
Q psy3850          82 VNFTYFNHLDFLWAKDVKALVYNDLLLVLKTFSK  115 (215)
Q Consensus        82 v~~~~fnHLDFIwg~da~~~VY~~II~iL~k~~~  115 (215)
                      +++++|||+||+||.+|+++||++||++|++++.
T Consensus       367 ~~~~~ynHlDFi~g~da~~~vy~~vi~~~~~~~~  400 (403)
T KOG2624|consen  367 VPIPEYNHLDFIWGLDAKEEVYDPVIERLRLFER  400 (403)
T ss_pred             ccCCCccceeeeeccCcHHHHHHHHHHHHHhhhc
Confidence            7799999999999999999999999999998873

>PLN02872 triacylglycerol lipase	Back alignment and domain information

>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit	Back alignment and domain information

>PRK07868 acyl-CoA synthetase; Validated	Back alignment and domain information

>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases	Back alignment and domain information

>PHA02857 monoglyceride lipase; Provisional	Back alignment and domain information

>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH	Back alignment and domain information

>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase	Back alignment and domain information

>PLN02385 hydrolase; alpha/beta fold family protein	Back alignment and domain information

>PLN02298 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification	Back alignment and domain information

>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase	Back alignment and domain information

>TIGR03611 RutD pyrimidine utilization protein D	Back alignment and domain information

>PRK10749 lysophospholipase L2; Provisional	Back alignment and domain information

>PRK07581 hypothetical protein; Validated	Back alignment and domain information

>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase	Back alignment and domain information

>PRK00870 haloalkane dehalogenase; Provisional	Back alignment and domain information

>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase	Back alignment and domain information

>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein	Back alignment and domain information

>PLN02652 hydrolase; alpha/beta fold family protein	Back alignment and domain information

>PLN02824 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily	Back alignment and domain information

>PLN02965 Probable pheophorbidase	Back alignment and domain information

>PRK00175 metX homoserine O-acetyltransferase; Provisional	Back alignment and domain information

>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular	Back alignment and domain information

>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway	Back alignment and domain information

>PRK08775 homoserine O-acetyltransferase; Provisional	Back alignment and domain information

>PRK10349 carboxylesterase BioH; Provisional	Back alignment and domain information

>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional	Back alignment and domain information

>PRK06765 homoserine O-acetyltransferase; Provisional	Back alignment and domain information

>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A	Back alignment and domain information

>PRK10985 putative hydrolase; Provisional	Back alignment and domain information

>PRK06489 hypothetical protein; Provisional	Back alignment and domain information

>PLN02679 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>PLN02578 hydrolase	Back alignment and domain information

>PRK03592 haloalkane dehalogenase; Provisional	Back alignment and domain information

>PRK10673 acyl-CoA esterase; Provisional	Back alignment and domain information

>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily	Back alignment and domain information

>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only]	Back alignment and domain information

>PLN02511 hydrolase	Back alignment and domain information

>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A	Back alignment and domain information

>PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria	Back alignment and domain information

>PRK10566 esterase; Provisional	Back alignment and domain information

>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A)	Back alignment and domain information

>KOG1455\|consensus	Back alignment and domain information

>PLN02894 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>PRK03204 haloalkane dehalogenase; Provisional	Back alignment and domain information

>KOG1454\|consensus	Back alignment and domain information

>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase	Back alignment and domain information

>COG2267 PldB Lysophospholipase [Lipid metabolism]	Back alignment and domain information

>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism]	Back alignment and domain information

>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated	Back alignment and domain information

>PRK05077 frsA fermentation/respiration switch protein; Reviewed	Back alignment and domain information

>KOG3043\|consensus	Back alignment and domain information

>PRK13604 luxD acyl transferase; Provisional	Back alignment and domain information

>COG1073 Hydrolases of the alpha/beta superfamily [General function prediction only]	Back alignment and domain information

>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional	Back alignment and domain information

>PLN03084 alpha/beta hydrolase fold protein; Provisional	Back alignment and domain information

>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding	Back alignment and domain information

>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I	Back alignment and domain information

>PRK05855 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional	Back alignment and domain information

>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional	Back alignment and domain information

>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only]	Back alignment and domain information

>PLN02211 methyl indole-3-acetate methyltransferase	Back alignment and domain information

>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II	Back alignment and domain information

>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH	Back alignment and domain information

>COG1647 Esterase/lipase [General function prediction only]	Back alignment and domain information

>KOG4178\|consensus	Back alignment and domain information

>PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases	Back alignment and domain information

>PF10142 PhoPQ_related: PhoPQ-activated pathogenicity-related protein; InterPro: IPR009199 Proteins in this entry are believed to play a role in virulence/pathogenicity in Salmonella	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		215
1k8q_A		377	Crystal Structure Of Dog Gastric Lipase In Complex		7e-12
1hlg_A		371	Crystal Structure Of Human Gastric Lipase Length =		3e-10

>pdb|1K8Q|A Chain A, Crystal Structure Of Dog Gastric Lipase In Complex With A Phosphonate Inhibitor Length = 377

Back alignment and structure

Iteration: 1

Score = 67.0 bits (162), Expect = 7e-12, Method: Compositional matrix adjust. Identities = 35/103 (33%), Positives = 58/103 (56%), Gaps = 3/103 (2%) Query: 11 STSIDGRKFRQFDYGKD-ENLHIYNSTFPPKYDLKFISTKVAFFYADNDLLTNEQDVKEL 69 S ++ KF+ FD+G +N+ Y+ + PP Y+L + +A + NDLL + DV L Sbjct: 276 SQAVKSGKFQAFDWGSPVQNMMHYHQSMPPYYNLTDMHVPIAVWNGGNDLLADPHDVDLL 335 Query: 70 YTLLPNPVGLFKVNFTYFNHLDFLWAKDVKALVYNDLLLVLKT 112 + LPN + + +NHLDF+WA D VYN+++ ++ T Sbjct: 336 LSKLPNLI--YHRKIPPYNHLDFIWAMDAPQAVYNEIVSMMGT 376

PyMOL of 1k8q

>pdb|1HLG|A Chain A, Crystal Structure Of Human Gastric Lipase Length = 371

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		215
1k8q_A		377	Triacylglycerol lipase, gastric; APHA beta hydrola	7e-25

>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Length = 377	Back alignment and structure

 Score = 99.3 bits (247), Expect = 7e-25
 Identities = 35/96 (36%), Positives = 56/96 (58%), Gaps = 3/96 (3%)

Query: 18  KFRQFDYG-KDENLHIYNSTFPPKYDLKFISTKVAFFYADNDLLTNEQDVKELYTLLPNP 76
           KF+ FD+G   +N+  Y+ + PP Y+L  +   +A +   NDLL +  DV  L + LPN 
Sbjct: 283 KFQAFDWGSPVQNMMHYHQSMPPYYNLTDMHVPIAVWNGGNDLLADPHDVDLLLSKLPNL 342

Query: 77  VGLFKVNFTYFNHLDFLWAKDVKALVYNDLLLVLKT 112
           +   K+    +NHLDF+WA D    VYN+++ ++ T
Sbjct: 343 IYHRKIP--PYNHLDFIWAMDAPQAVYNEIVSMMGT 376

PyMOL of 1k8q

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		215
1k8q_A		377	Triacylglycerol lipase, gastric; APHA beta hydrola	99.45
4fbl_A		281	LIPS lipolytic enzyme; thermostable, structural ge	97.87
3fsg_A		272	Alpha/beta superfamily hydrolase; PF00561, MCSG, P	97.67
3dkr_A		251	Esterase D; alpha beta hydrolase, mechanism, catal	97.51
3pe6_A		303	Monoglyceride lipase; alpha-beta hydrolase fold, 2	97.41
3h04_A		275	Uncharacterized protein; protein with unknown func	97.33
3llc_A		270	Putative hydrolase; structural genomics, joint cen	97.31
3hss_A		293	Putative bromoperoxidase; alpha beta hydrolase, ox	97.29
3u1t_A		309	DMMA haloalkane dehalogenase; alpha/beta-hydrolase	97.28
3qvm_A		282	OLEI00960; structural genomics, PSI-biology, midwe	97.25
3hju_A		342	Monoglyceride lipase; alpha/beta hydrolase, hydrol	97.25
1jfr_A		262	Lipase; serine hydrolase; 1.90A {Streptomyces exfo	97.2
3pfb_A		270	Cinnamoyl esterase; alpha/beta hydrolase fold, hyd	97.19
2pl5_A		366	Homoserine O-acetyltransferase; alpha/beta hydrola	97.19
3r0v_A		262	Alpha/beta hydrolase fold protein; structural geno	97.18
3f67_A		241	Putative dienelactone hydrolase; alpha-beta-alpha	97.18
1zi8_A		236	Carboxymethylenebutenolidase; alpha and beta prote	97.16
4dnp_A		269	DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu	97.15
3rm3_A		270	MGLP, thermostable monoacylglycerol lipase; alpha/	97.14
3i1i_A		377	Homoserine O-acetyltransferase; structural genomic	97.13
1tqh_A		247	Carboxylesterase precursor; tetrahedral intermedia	97.1
1brt_A		277	Bromoperoxidase A2; haloperoxidase, oxidoreductase	97.1
3bdi_A		207	Uncharacterized protein TA0194; NP_393672.1, predi	97.09
1q0r_A		298	RDMC, aclacinomycin methylesterase; anthracycline,	97.08
3fnb_A		405	Acylaminoacyl peptidase SMU_737; alpha-beta-alpha	97.07
2wtm_A		251	EST1E; hydrolase; 1.60A {Clostridium proteoclastic	97.07
4f0j_A		315	Probable hydrolytic enzyme; alpha/beta hydrolase f	97.07
2ocg_A		254	Valacyclovir hydrolase; alpha beta hydrolase fold;	97.06
2b61_A		377	Homoserine O-acetyltransferase; acyl-enzyme, aspar	97.06
3ksr_A		290	Putative serine hydrolase; catalytic triad, struct	97.05
1c4x_A		285	BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di	97.04
3e0x_A		245	Lipase-esterase related protein; APC60309, clostri	97.03
1u2e_A		289	2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase	97.03
3p2m_A		330	Possible hydrolase; alpha/beta hydrolase superfami	97.01
2y6u_A		398	Peroxisomal membrane protein LPX1; hydrolase, puta	97.01
1j1i_A		296	META cleavage compound hydrolase; carbazole degrad	96.97
3hxk_A		276	Sugar hydrolase; alpha-beta protein., structural g	96.96
4g9e_A		279	AHL-lactonase, alpha/beta hydrolase fold protein;	96.94
2puj_A		286	2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola;	96.93
1mtz_A		293	Proline iminopeptidase; alpha-beta hydrolase, CAP	96.92
3bdv_A		191	Uncharacterized protein DUF1234; DUF1234 family pr	96.91
3v48_A		268	Aminohydrolase, putative aminoacrylate hydrolase R	96.91
2vat_A		444	Acetyl-COA--deacetylcephalosporin C acetyltransfer	96.91
3kxp_A		314	Alpha-(N-acetylaminomethylene)succinic acid hydrol	96.88
3vis_A		306	Esterase; alpha/beta-hydrolase fold, polyethylene	96.86
3dqz_A		258	Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl	96.86
1iup_A		282	META-cleavage product hydrolase; aromatic compound	96.86
2xua_A		266	PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate	96.84
1wm1_A		317	Proline iminopeptidase; complex with inhibitor, hy	96.82
3oos_A		278	Alpha/beta hydrolase family protein; APC67239.0, p	96.82
1uxo_A		192	YDEN protein; hydrolase, A/B hydrolase, esterase,	96.79
3g9x_A		299	Haloalkane dehalogenase; alpha/beta hydrolase, hel	96.79
1wom_A		271	RSBQ, sigma factor SIGB regulation protein RSBQ; a	96.77
3sty_A		267	Methylketone synthase 1; alpha/beta hydrolase, dec	96.74
3i28_A		555	Epoxide hydrolase 2; aromatic hydrocarbons catabol	96.74
2wue_A		291	2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas	96.71
3fcy_A		346	Xylan esterase 1; alpha/beta hydrolase, carbohydra	96.7
3ia2_A		271	Arylesterase; alpha-beta hydrolase fold, transitio	96.69
2i3d_A		249	AGR_C_3351P, hypothetical protein ATU1826; structu	96.67
3fla_A		267	RIFR; alpha-beta hydrolase thioesterase, hydrolase	96.66
1l7a_A		318	Cephalosporin C deacetylase; structural genomics,	96.65
3bf7_A		255	Esterase YBFF; thioesterase, helical CAP, hydrolas	96.64
3fob_A		281	Bromoperoxidase; structural genomics, IDP00046, ba	96.64
1m33_A		258	BIOH protein; alpha-betta-alpha sandwich, structur	96.61
2xmz_A		269	Hydrolase, alpha/beta hydrolase fold family; menaq	96.59
1a8s_A		273	Chloroperoxidase F; haloperoxidase, oxidoreductase	96.58
1a8q_A		274	Bromoperoxidase A1; haloperoxidase, oxidoreductase	96.54
2qvb_A		297	Haloalkane dehalogenase 3; RV2579, alpha-beta hydr	96.53
3bxp_A		277	Putative lipase/esterase; putative carboxylesteras	96.48
2yys_A		286	Proline iminopeptidase-related protein; TTHA1809,	96.38
2o2g_A		223	Dienelactone hydrolase; YP_324580.1, structural ge	96.38
3qit_A		286	CURM TE, polyketide synthase; thioesterase, alpha/	96.37
2r11_A		306	Carboxylesterase NP; 2632844, putative hydrolase,	96.37
1mj5_A		302	1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase;	96.36
1ufo_A		238	Hypothetical protein TT1662; alpha-beta fold, hydr	96.31
1a88_A		275	Chloroperoxidase L; haloperoxidase, oxidoreductase	96.3
1zoi_A		276	Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo	96.29
1azw_A		313	Proline iminopeptidase; aminopeptidase, serine pro	96.28
3vdx_A		456	Designed 16NM tetrahedral protein CAGE containing	96.28
1hkh_A		279	Gamma lactamase; hydrolase, alpha/beta hydrolase,	96.25
3kda_A		301	CFTR inhibitory factor (CIF); alpha/beta hydrolase	96.23
3om8_A		266	Probable hydrolase; structural genomics, PSI-2, pr	96.23
1b6g_A		310	Haloalkane dehalogenase; hydrolase, alpha/beta-hyd	96.21
3trd_A		208	Alpha/beta hydrolase; cellular processes; 1.50A {C	96.21
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	96.19
2fx5_A		258	Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse	96.19
1imj_A		210	CIB, CCG1-interacting factor B; alpha/beta hydrola	96.18
2e3j_A		356	Epoxide hydrolase EPHB; epoxide hydrolase B, struc	96.09
3afi_E		316	Haloalkane dehalogenase; A/B-hydrolase, hydrolase;	96.08
3bjr_A		283	Putative carboxylesterase; structural genomics, jo	96.07
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	96.05
3nwo_A		330	PIP, proline iminopeptidase; structural genomics,	96.03
2qjw_A		176	Uncharacterized protein XCC1541; putative hydrolas	96.03
1auo_A		218	Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl	96.0
1fj2_A		232	Protein (acyl protein thioesterase 1); alpha/beta	95.97
2jbw_A		386	Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine	95.97
2pbl_A		262	Putative esterase/lipase/thioesterase; alpha/beta-	95.97
2hdw_A		367	Hypothetical protein PA2218; alpha/beta hydrolase	95.92
3r40_A		306	Fluoroacetate dehalogenase; FACD, defluorinase, al	95.87
2rau_A		354	Putative esterase; NP_343859.1, putative lipase, s	95.82
4ao6_A		259	Esterase; hydrolase, thermo label; 1.60A {Unidenti	95.75
1vlq_A		337	Acetyl xylan esterase; TM0077, structural genomics	95.73
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	95.7
2xt0_A		297	Haloalkane dehalogenase; hydrolase, alpha-beta hyd	95.66
1tht_A		305	Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.	95.65
2fuk_A		220	XC6422 protein; A/B hydrolase, structural genomics	95.65
1vkh_A		273	Putative serine hydrolase; structural genomics, jo	95.64
2qmq_A		286	Protein NDRG2, protein NDR2; alpha/beta-hydrolases	95.55
2cjp_A		328	Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu	95.5
4fle_A		202	Esterase; structural genomics, PSI-biology, northe	95.43
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	95.39
2qs9_A		194	Retinoblastoma-binding protein 9; B5T overexpresse	95.37
2h1i_A		226	Carboxylesterase; structural genomics, PSI-2, prot	95.34
3c6x_A		257	Hydroxynitrilase; atomic resolution, hydroxynitril	95.14
3bwx_A		285	Alpha/beta hydrolase; YP_496220.1, joint center fo	95.13
1z68_A		719	Fibroblast activation protein, alpha subunit; sepr	95.13
1ehy_A		294	Protein (soluble epoxide hydrolase); alpha/beta hy	95.12
1ycd_A		243	Hypothetical 27.3 kDa protein in AAP1-SMF2 interge	95.04
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	94.9
3cn9_A		226	Carboxylesterase; alpha/beta hydrolase fold super-	94.87
3hlk_A		446	Acyl-coenzyme A thioesterase 2, mitochondrial; alp	94.71
2r8b_A		251	AGR_C_4453P, uncharacterized protein ATU2452; APC6	94.63
3k2i_A		422	Acyl-coenzyme A thioesterase 4; alpha/beta hydrola	94.61
3mve_A		415	FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/	94.55
3b12_A		304	Fluoroacetate dehalogenase; dehalogease, hydrolase	93.45
2q0x_A		335	Protein DUF1749, uncharacterized protein; alpha/be	94.39
3l80_A		292	Putative uncharacterized protein SMU.1393C; alpha/	94.31
1qlw_A		328	Esterase; anisotropic refinement, atomic resolutio	94.3
2qru_A		274	Uncharacterized protein; alpha/beta-hydrolase, str	94.29
3qmv_A		280	Thioesterase, REDJ; alpha/beta hydrolase fold, hyd	94.25
1lns_A		763	X-prolyl dipeptidyl aminopetidase; alpha beta hydr	94.18
4a5s_A		740	Dipeptidyl peptidase 4 soluble form; hydrolase, ty	94.18
2psd_A		318	Renilla-luciferin 2-monooxygenase; alpha/beta-hydr	94.11
1xkl_A		273	SABP2, salicylic acid-binding protein 2; alpha-bet	94.05
3og9_A		209	Protein YAHD A copper inducible hydrolase; alpha/b	93.98
3u0v_A		239	Lysophospholipase-like protein 1; alpha, beta hydr	93.65
1pja_A		302	Palmitoyl-protein thioesterase 2 precursor; hydrol	93.32
3ibt_A		264	1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO,	93.26
2wfl_A		264	Polyneuridine-aldehyde esterase; alkaloid metaboli	93.24
2k2q_B		242	Surfactin synthetase thioesterase subunit; A/B-hyd	93.24
2zsh_A		351	Probable gibberellin receptor GID1L1; plant hormon	92.48
2o7r_A		338	CXE carboxylesterase; alpha/beta hydrolase; 1.40A	92.2
4ezi_A		377	Uncharacterized protein; alpha-beta hydrolases fol	92.1
1kez_A		300	Erythronolide synthase; polyketide synthase, modul	91.96
3guu_A		462	Lipase A; protein structure, hydrolase; HET: 1PE;	91.86
3iuj_A		693	Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas	91.82
1isp_A		181	Lipase; alpha/beta hydrolase fold, hydrolase; 1.30	91.82
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	91.58
2bkl_A		695	Prolyl endopeptidase; mechanistic study, celiac sp	91.42
4f21_A		246	Carboxylesterase/phospholipase family protein; str	91.33
4fhz_A		285	Phospholipase/carboxylesterase; alpha/beta hydrola	91.32
1jmk_C		230	SRFTE, surfactin synthetase; thioesterase, non-rib	91.21
4e15_A		303	Kynurenine formamidase; alpha/beta hydrolase fold,	91.17
2xe4_A		751	Oligopeptidase B; hydrolase-inhibitor complex, hyd	90.87
1jkm_A		361	Brefeldin A esterase; serine hydrolase, degradatio	90.82
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	90.55
2c7b_A		311	Carboxylesterase, ESTE1; carboxyesterase, thermoph	90.53
4hvt_A		711	Ritya.17583.B, post-proline cleaving enzyme; ssgci	89.98
3b5e_A		223	MLL8374 protein; NP_108484.1, carboxylesterase, st	89.69
3doh_A		380	Esterase; alpha-beta hydrolase, beta sheet; 2.60A	89.55
3ga7_A		326	Acetyl esterase; phosphoserine, IDP00896, hydrolas	89.49
4h0c_A		210	Phospholipase/carboxylesterase; PSI-biology, midwe	89.2
3ds8_A		254	LIN2722 protein; unkonwn function, structural geno	89.1
2cb9_A		244	Fengycin synthetase; thioesterase, non-ribosomal p	88.67
2d81_A		318	PHB depolymerase; alpha/beta hydrolase fold, circu	88.43
1lzl_A		323	Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod	88.31
3d7r_A		326	Esterase; alpha/beta fold, hydrolase; 2.01A {Staph	87.81
2hfk_A		319	Pikromycin, type I polyketide synthase pikaiv; alp	87.34
3ain_A		323	303AA long hypothetical esterase; carboxylesterase	87.27
3k6k_A		322	Esterase/lipase; alpha/beta hydrolase fold; 2.20A	86.89
3d59_A		383	Platelet-activating factor acetylhydrolase; secret	86.85
2hm7_A		310	Carboxylesterase; alpha/beta hydrolase fold, hydro	86.2
3c5v_A		316	PME-1, protein phosphatase methylesterase 1; demet	86.12
3qyj_A		291	ALR0039 protein; alpha/beta fold, hydrolase; 1.78A	85.98
3ebl_A		365	Gibberellin receptor GID1; alpha/beta hydrolase, l	85.83
3fak_A		322	Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc	85.82
1r3d_A		264	Conserved hypothetical protein VC1974; structural	85.36
3i6y_A		280	Esterase APC40077; lipase, structural genomics, PS	85.03
3lp5_A		250	Putative cell surface hydrolase; structural genom	83.56
3fcx_A		282	FGH, esterase D, S-formylglutathione hydrolase; re	82.2
2uz0_A		263	Esterase, tributyrin esterase; alpha/beta hydrolas	81.72
3fle_A		249	SE_1780 protein; structural genomics, APC61035.1,	80.92
3h2g_A		397	Esterase; xanthomonas oryzae PV. oryzae, cell WALL	80.82
3lcr_A		319	Tautomycetin biosynthetic PKS; alpha-beta hydrolas	80.1

>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A*	Back alignment and structure

Probab=99.45  E-value=1.7e-13  Score=114.51  Aligned_cols=109  Identities=33%  Similarity=0.603  Sum_probs=99.7

Q ss_pred             hhhhHHHHHHHHhCCCccccccCCcc-cccccCCccCccccccccCceEEEEeeCCCccCchHhHHHHHhhCCCceeeeE
Q psy3850           3 SRYCGRFLSTSIDGRKFRQFDYGKDE-NLHIYNSTFPPKYDLKFISTKVAFFYADNDLLTNEQDVKELYTLLPNPVGLFK   81 (215)
Q Consensus         3 SvK~l~H~~Q~i~Sg~Fq~YDYG~~~-Nl~~YGq~tPP~YnLsnItvPV~LfyG~nD~La~p~DV~~L~~~LpNv~~~~~   81 (215)
                      +.+.+.||.|.+.++.|+.||||... |+..|++..||.+.+.+|++||.+++|.+|.+++++.++.+.+.+++..  ..
T Consensus       268 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~lii~G~~D~~~~~~~~~~~~~~~~~~~--~~  345 (377)
T 1k8q_A          268 SVQNVLHWSQAVKSGKFQAFDWGSPVQNMMHYHQSMPPYYNLTDMHVPIAVWNGGNDLLADPHDVDLLLSKLPNLI--YH  345 (377)
T ss_dssp             EHHHHHHHHHHHHHCSCBCCCCSSHHHHHHHHSSSSCCBCCGGGCCSCEEEEEETTCSSSCHHHHHHHHTTCTTEE--EE
T ss_pred             cHHHHHHHHHHHhcCCeeeccCCcchhhHHHcCCCCCcccCHhhCCCCEEEEEeCCCcccCHHHHHHHHHhCcCcc--cE
Confidence            56789999999999999999999887 9999999999999999999999999999999999999999999999854  23


Q ss_pred             eeCCCCcccchhhcccchhHHHHHHHHHHHhc
Q psy3850          82 VNFTYFNHLDFLWAKDVKALVYNDLLLVLKTF  113 (215)
Q Consensus        82 v~~~~fnHLDFIwg~da~~~VY~~II~iL~k~  113 (215)
                      +.+++.+|..++++.+..+.+++.|+++|+++
T Consensus       346 ~~~~~~gH~~~~~~~~~~~~~~~~i~~fl~~~  377 (377)
T 1k8q_A          346 RKIPPYNHLDFIWAMDAPQAVYNEIVSMMGTD  377 (377)
T ss_dssp             EEETTCCTTHHHHCTTHHHHTHHHHHHHHHTC
T ss_pred             EecCCCCceEEEecCCcHHHHHHHHHHHhccC
Confidence            45689999999999999999999999999764

PyMOL of 1k8q

>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A	Back alignment and structure

>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni}	Back alignment and structure

>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A	Back alignment and structure

>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A*	Back alignment and structure

>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp}	Back alignment and structure

>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis}	Back alignment and structure

>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A	Back alignment and structure

>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified}	Back alignment and structure

>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica}	Back alignment and structure

>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens}	Back alignment and structure

>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16	Back alignment and structure

>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A*	Back alignment and structure

>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40	Back alignment and structure

>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus}	Back alignment and structure

>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp}	Back alignment and structure

>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A*	Back alignment and structure

>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A	Back alignment and structure

>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A	Back alignment and structure

>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str}	Back alignment and structure

>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A	Back alignment and structure

>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A	Back alignment and structure

>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728}	Back alignment and structure

>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A*	Back alignment and structure

>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans}	Back alignment and structure

>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A*	Back alignment and structure

>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa}	Back alignment and structure

>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A	Back alignment and structure

>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40	Back alignment and structure

>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV}	Back alignment and structure

>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10	Back alignment and structure

>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum}	Back alignment and structure

>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli}	Back alignment and structure

>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis}	Back alignment and structure

>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A*	Back alignment and structure

>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10	Back alignment and structure

>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp}	Back alignment and structure

>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A	Back alignment and structure

>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A	Back alignment and structure

>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A	Back alignment and structure

>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043}	Back alignment and structure

>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11}	Back alignment and structure

>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A*	Back alignment and structure

>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti}	Back alignment and structure

>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba}	Back alignment and structure

>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0	Back alignment and structure

>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A	Back alignment and structure

>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans}	Back alignment and structure

>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A*	Back alignment and structure

>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis}	Back alignment and structure

>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31	Back alignment and structure

>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A	Back alignment and structure

>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A*	Back alignment and structure

>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A*	Back alignment and structure

>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A*	Back alignment and structure

>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A	Back alignment and structure

>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP}	Back alignment and structure

>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A	Back alignment and structure

>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36	Back alignment and structure

>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A*	Back alignment and structure

>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B*	Back alignment and structure

>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A	Back alignment and structure

>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0	Back alignment and structure

>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26	Back alignment and structure

>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus}	Back alignment and structure

>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12	Back alignment and structure

>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12	Back alignment and structure

>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A	Back alignment and structure

>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A*	Back alignment and structure

>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus}	Back alignment and structure

>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis}	Back alignment and structure

>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L}	Back alignment and structure

>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis}	Back alignment and structure

>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A	Back alignment and structure

>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27	Back alignment and structure

>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12	Back alignment and structure

>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A	Back alignment and structure

>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7	Back alignment and structure

>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A	Back alignment and structure

>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A*	Back alignment and structure

>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A	Back alignment and structure

>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0	Back alignment and structure

>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A	Back alignment and structure

>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii}	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina}	Back alignment and structure

>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23	Back alignment and structure

>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A*	Back alignment and structure

>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A*	Back alignment and structure

>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1}	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis}	Back alignment and structure

>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV}	Back alignment and structure

>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A*	Back alignment and structure

>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14	Back alignment and structure

>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41	Back alignment and structure

>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2	Back alignment and structure

>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa}	Back alignment and structure

>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A	Back alignment and structure

>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2}	Back alignment and structure

>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A	Back alignment and structure

>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A*	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica}	Back alignment and structure

>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13	Back alignment and structure

>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36	Back alignment and structure

>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32	Back alignment and structure

>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A	Back alignment and structure

>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A*	Back alignment and structure

>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp}	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens}	Back alignment and structure

>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14	Back alignment and structure

>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ...	Back alignment and structure

>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans}	Back alignment and structure

>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens}	Back alignment and structure

>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11	Back alignment and structure

>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24	Back alignment and structure

>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A*	Back alignment and structure

>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens}	Back alignment and structure

>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14	Back alignment and structure

>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens}	Back alignment and structure

>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A	Back alignment and structure

>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A	Back alignment and structure

>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei}	Back alignment and structure

>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans}	Back alignment and structure

>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A*	Back alignment and structure

>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis}	Back alignment and structure

>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A*	Back alignment and structure

>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21	Back alignment and structure

>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ...	Back alignment and structure

>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A	Back alignment and structure

>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A*	Back alignment and structure

>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0	Back alignment and structure

>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens}	Back alignment and structure

>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13	Back alignment and structure

>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida}	Back alignment and structure

>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A*	Back alignment and structure

>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A	Back alignment and structure

>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A*	Back alignment and structure

>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A	Back alignment and structure

>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp}	Back alignment and structure

>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A	Back alignment and structure

>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A*	Back alignment and structure

>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A*	Back alignment and structure

>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus}	Back alignment and structure

>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp}	Back alignment and structure

>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A*	Back alignment and structure

>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22	Back alignment and structure

>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A	Back alignment and structure

>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major}	Back alignment and structure

>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon}	Back alignment and structure

>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi}	Back alignment and structure

>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14	Back alignment and structure

>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A	Back alignment and structure

>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium}	Back alignment and structure

>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans}	Back alignment and structure

>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua}	Back alignment and structure

>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A*	Back alignment and structure

>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A*	Back alignment and structure

>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A	Back alignment and structure

>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp}	Back alignment and structure

>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A	Back alignment and structure

>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A	Back alignment and structure

>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A	Back alignment and structure

>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A*	Back alignment and structure

>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A	Back alignment and structure

>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P	Back alignment and structure

>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP}	Back alignment and structure

>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A*	Back alignment and structure

>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A	Back alignment and structure

>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35	Back alignment and structure

>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A	Back alignment and structure

>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum}	Back alignment and structure

>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0	Back alignment and structure

>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae}	Back alignment and structure

>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis}	Back alignment and structure

>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A	Back alignment and structure

>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		215
d1k8qa_		377	c.69.1.6 (A:) Gastric lipase {Dog (Canis familiari	1e-16

>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Length = 377	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Gastric lipase
domain: Gastric lipase
species: Dog (Canis familiaris) [TaxId: 9615]

 Score = 75.1 bits (183), Expect = 1e-16
 Identities = 37/111 (33%), Positives = 60/111 (54%), Gaps = 3/111 (2%)

Query: 3   SRYCGRFLSTSIDGRKFRQFDYG-KDENLHIYNSTFPPKYDLKFISTKVAFFYADNDLLT 61
           S       S ++   KF+ FD+G   +N+  Y+ + PP Y+L  +   +A +   NDLL 
Sbjct: 268 SVQNVLHWSQAVKSGKFQAFDWGSPVQNMMHYHQSMPPYYNLTDMHVPIAVWNGGNDLLA 327

Query: 62  NEQDVKELYTLLPNPVGLFKVNFTYFNHLDFLWAKDVKALVYNDLLLVLKT 112
           +  DV  L + LPN +   K+    +NHLDF+WA D    VYN+++ ++ T
Sbjct: 328 DPHDVDLLLSKLPNLIYHRKIP--PYNHLDFIWAMDAPQAVYNEIVSMMGT 376

PyMOL of d1k8qa_

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		215
d1k8qa_		377	Gastric lipase {Dog (Canis familiaris) [TaxId: 961	99.82
d1tqha_		242	Carboxylesterase Est {Bacillus stearothermophilus	97.73
d1a8qa_		274	Bromoperoxidase A1 {Streptomyces aureofaciens [Tax	97.7
d1c4xa_		281	2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas	97.6
d1wm1a_		313	Proline aminopeptidase {Serratia marcescens [TaxId	97.54
d1q0ra_		297	Aclacinomycin methylesterase RdmC {Streptomyces pu	97.53
d2rhwa1		283	2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas	97.47
d1xkla_		258	Salicylic acid-binding protein 2 (SABP2) {Common t	97.46
d1va4a_		271	Arylesterase {Pseudomonas fluorescens [TaxId: 294]	97.41
d1j1ia_		268	Meta cleavage compound hydrolase CarC {Janthinobac	97.34
d1uk8a_		271	Meta-cleavage product hydrolase CumD {Pseudomonas	97.3
d1zd3a2		322	Mammalian epoxide hydrolase, C-terminal domain {Hu	97.3
d1l7aa_		318	Cephalosporin C deacetylase {Bacillus subtilis [Ta	97.26
d1mtza_		290	Tricorn interacting factor F1 {Archaeon Thermoplas	97.26
d1brta_		277	Bromoperoxidase A2 {Streptomyces aureofaciens [Tax	97.25
d1azwa_		313	Proline iminopeptidase {Xanthomonas campestris, pv	97.2
d1a88a_		275	Chloroperoxidase L {Streptomyces lividans [TaxId:	97.08
d1m33a_		256	Biotin biosynthesis protein BioH {Escherichia coli	97.07
d1a8sa_		273	Chloroperoxidase F {Pseudomonas fluorescens [TaxId	97.06
d3c70a1		256	Hydroxynitrile lyase {Rubber tree (Hevea brasilien	97.06
d1bn7a_		291	Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1	96.94
d1dina_		233	Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI	96.79
d2hu7a2		260	Acylamino-acid-releasing enzyme, C-terminal donain	96.76
d1hkha_		279	Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]	96.65
d1b6ga_		310	Haloalkane dehalogenase {Xanthobacter autotrophicu	96.63
d1thta_		302	Myristoyl-ACP-specific thioesterase {Vibrio harvey	96.35
d1vlqa_		322	Acetyl xylan esterase TM0077 {Thermotoga maritima	96.26
d2vata1		376	Acetyl-CoA:deacetylcephalosporin C acetyltransfera	96.14
d1imja_		208	Ccg1/TafII250-interacting factor B (Cib) {Human (H	96.04
d1jfra_		260	Lipase {Streptomyces exfoliatus [TaxId: 1905]}	96.03
d1vkha_		263	Putative serine hydrolase Ydr428c {Baker's yeast (	96.02
d2jbwa1		360	2,6-dihydropseudooxynicotine hydrolase {Arthrobact	95.83
d2bgra2		258	Dipeptidyl peptidase IV/CD26, C-terminal domain {P	95.73
d1qfma2		280	Prolyl oligopeptidase, C-terminal domain {Pig (Sus	95.59
d1uxoa_		186	Hypothetical protein YdeN {Bacillus subtilis [TaxI	95.51
d1xfda2		258	Dipeptidyl aminopeptidase-like protein 6, DPP6, C-	95.47
d2fuka1		218	XC6422 protein {Xanthomonas campestris [TaxId: 339	95.41
d1ehya_		293	Bacterial epoxide hydrolase {Agrobacterium radioba	95.36
d2pl5a1		362	Homoserine O-acetyltransferase {Leptospira interro	94.73
d1qlwa_		318	A novel bacterial esterase {Alcaligenes sp. [TaxId	94.41
d2b61a1		357	Homoserine O-acetyltransferase {Haemophilus influe	93.82
d2r8ba1		203	Uncharacterized protein Atu2452 {Agrobacterium tum	93.25
d1mj5a_		298	Haloalkane dehalogenase {Sphingomonas paucimobilis	92.99
d1auoa_		218	Carboxylesterase {Pseudomonas fluorescens [TaxId:	92.93
d2pbla1		261	Uncharacterized protein TM1040_2492 {Silicibacter	92.39
d1fj2a_		229	Acyl protein thioesterase 1 {Human (Homo sapiens)	92.25
d1lnsa3		405	X-Prolyl dipeptidyl aminopeptidase PepX, middle do	92.01
d1ufoa_		238	Hypothetical protein TT1662 {Thermus thermophilus	91.37
d2h1ia1		202	Carboxylesterase {Bacillus cereus [TaxId: 1396]}	90.62
d2h7xa1		283	Picromycin polyketide synthase {Streptomyces venez	88.67
d2i3da1		218	Hypothetical protein Atu1826 {Agrobacterium tumefa	88.22
d2d81a1		318	Polyhydroxybutyrate depolymerase {Penicillium funi	86.94
d1r3da_		264	Hypothetical protein VC1974 {Vibrio cholerae [TaxI	85.86
d1lzla_		317	Heroin esterase {Rhodococcus sp. [TaxId: 1831]}	84.51
d1jmkc_		230	Surfactin synthetase, SrfA {Bacillus subtilis [Tax	83.67
d1cvla_		319	Lipase {Chromobacterium viscosum [TaxId: 42739]}	83.11
d1qo7a_		394	Bacterial epoxide hydrolase {Aspergillus niger [Ta	82.78

>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Gastric lipase
domain: Gastric lipase
species: Dog (Canis familiaris) [TaxId: 9615]

Probab=99.82  E-value=9.5e-21  Score=156.16  Aligned_cols=109  Identities=33%  Similarity=0.628  Sum_probs=101.4

Q ss_pred             chhhhHHHHHHHHhCCCccccccCCc-ccccccCCccCccccccccCceEEEEeeCCCccCchHhHHHHHhhCCCceeee
Q psy3850           2 QSRYCGRFLSTSIDGRKFRQFDYGKD-ENLHIYNSTFPPKYDLKFISTKVAFFYADNDLLTNEQDVKELYTLLPNPVGLF   80 (215)
Q Consensus         2 TSvK~l~H~~Q~i~Sg~Fq~YDYG~~-~Nl~~YGq~tPP~YnLsnItvPV~LfyG~nD~La~p~DV~~L~~~LpNv~~~~   80 (215)
                      .|.+.+.||.|.+.++.|+.||+|.. .|...|+...+|.++|++|++||.+++|++|.++++++++++.+.|||..  .
T Consensus       267 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~vPvL~i~G~~D~~~~~~~~~~l~~~lp~~~--~  344 (377)
T d1k8qa_         267 TSVQNVLHWSQAVKSGKFQAFDWGSPVQNMMHYHQSMPPYYNLTDMHVPIAVWNGGNDLLADPHDVDLLLSKLPNLI--Y  344 (377)
T ss_dssp             EEHHHHHHHHHHHHHCSCBCCCCSSHHHHHHHHSSSSCCBCCGGGCCSCEEEEEETTCSSSCHHHHHHHHTTCTTEE--E
T ss_pred             chHHHHHHHHHHHhcCcchhccchhhhhhhhhhcccCchhhhHhhCCCCEEEEEeCCCCccCHHHHHHHHHHCCCCe--E
Confidence            57889999999999999999999974 89999999999999999999999999999999999999999999999964  3


Q ss_pred             EeeCCCCcccchhhcccchhHHHHHHHHHHHh
Q psy3850          81 KVNFTYFNHLDFLWAKDVKALVYNDLLLVLKT  112 (215)
Q Consensus        81 ~v~~~~fnHLDFIwg~da~~~VY~~II~iL~k  112 (215)
                      .+.+++++|+||+||.+|.+.||++|+++|+.
T Consensus       345 ~~~i~~~GH~d~~~~~~a~~~v~~~I~~fl~~  376 (377)
T d1k8qa_         345 HRKIPPYNHLDFIWAMDAPQAVYNEIVSMMGT  376 (377)
T ss_dssp             EEEETTCCTTHHHHCTTHHHHTHHHHHHHHHT
T ss_pred             EEEeCCCCCcchhhccchHHHHHHHHHHHHhc
Confidence            45678999999999999999999999999974

PyMOL of d1k8qa_

>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]}	Back information, alignment and structure

>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]}	Back information, alignment and structure

>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]}	Back information, alignment and structure

>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]}	Back information, alignment and structure

>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]}	Back information, alignment and structure

>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]}	Back information, alignment and structure

>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]}	Back information, alignment and structure

>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]}	Back information, alignment and structure

>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]}	Back information, alignment and structure

>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]}	Back information, alignment and structure

>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}	Back information, alignment and structure

>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]}	Back information, alignment and structure

>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]}	Back information, alignment and structure

>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]}	Back information, alignment and structure

>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]}	Back information, alignment and structure

>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]}	Back information, alignment and structure

>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]}	Back information, alignment and structure

>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]}	Back information, alignment and structure

>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]}	Back information, alignment and structure

>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]}	Back information, alignment and structure

>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]}	Back information, alignment and structure

>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]}	Back information, alignment and structure

>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]}	Back information, alignment and structure

>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]}	Back information, alignment and structure

>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]}	Back information, alignment and structure

>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]}	Back information, alignment and structure

>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]}	Back information, alignment and structure

>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]}	Back information, alignment and structure

>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]}	Back information, alignment and structure

>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]}	Back information, alignment and structure

>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]}	Back information, alignment and structure