Psyllid ID: psy3865

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MDELNLFRGDTVLLRGKRRKESAKMDELNLFRGDTVLLRGKRRKESVCIVLSDDTCPDEKIRMNRVMRNNLRVRLSDVVSLVPCPGIVYGKRIHVLPIDDSVQGLTG
ccccccccccEEEEcEEEEccHHHHHHcccccccEEEEEEccccEEEEEEEccccccccEEEEcHHHHHccccccccEEEEEEccccccccEEEEEccccccccccc
cccHHcccccEEEEEEEEcccHHHHHHHccccccEEEEEccccccEEEEEEcccccccccEEEEHHHHHcEEEEcccEEEEEcccccccccEEEEEEcccccccccc
mdelnlfrgdtvllrgkrrkesakmdelnlfrgdtvllrgkrrkesvcivlsddtcpdekirMNRVMRNNLRVRLSDvvslvpcpgivygkrihvlpiddsvqgltg
mdelnlfrgdtvllrgkrrkesakmdelnlfrgdtvllrgkrrkesvcivlsddtcpdekirmnrvmrnnlrvrlsdvvSLVPCpgivygkrihvlpiddsvqgltg
MDELNLFRGDTVLLRGKRRKESAKMDELNLFRGDTVLLRGKRRKESVCIVLSDDTCPDEKIrmnrvmrnnlrvrlsdvvslvPCPGIVYGKRIHVLPIDDSVQGLTG
***************************LNLFRGDTVLLRGKRRKESVCIVLSDDTCPDEKIRMNRVMRNNLRVRLSDVVSLVPCPGIVYGKRIHVLPID********
****NLFRGDTVLLRGKRRKESAKMDELNLFRGDTVLLRGKRRKESVCIVLSDDTCPDEKIRMNRVMRNNLRVRLSDVVSLVPCPGIVYGKRIHVLPIDDSVQGL**
MDELNLFRGDTVLLRGKRRKESAKMDELNLFRGDTVLLRGKRRKESVCIVLSDDTCPDEKIRMNRVMRNNLRVRLSDVVSLVPCPGIVYGKRIHVLPIDDSVQGLTG
**ELNLFRGDTVLLRGKRRKESAKMDELNLFRGDTVLLRGKRRKESVCIVLSDDTCPDEKIRMNRVMRNNLRVRLSDVVSLVPCPGIVYGKRIHVLPIDDSV*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDELNLFRGDTVLLRGKRRKESAKMDELNLFRGDTVLLRGKRRKESVCIVLSDDTCPDEKIRMNRVMRNNLRVRLSDVVSLVPCPGIVYGKRIHVLPIDDSVQGLTG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query107 2.2.26 [Sep-21-2011]
Q6GL04 805 Transitional endoplasmic yes N/A 0.803 0.106 0.790 7e-36
Q7ZU99 806 Transitional endoplasmic yes N/A 0.803 0.106 0.779 1e-35
P23787 805 Transitional endoplasmic N/A N/A 0.803 0.106 0.779 1e-35
Q01853 806 Transitional endoplasmic yes N/A 0.785 0.104 0.797 3e-35
P55072 806 Transitional endoplasmic yes N/A 0.785 0.104 0.797 3e-35
P46462 806 Transitional endoplasmic yes N/A 0.785 0.104 0.797 3e-35
Q3ZBT1 806 Transitional endoplasmic yes N/A 0.785 0.104 0.785 9e-35
P03974 806 Transitional endoplasmic yes N/A 0.785 0.104 0.785 9e-35
Q7KN62 801 Transitional endoplasmic yes N/A 0.803 0.107 0.755 4e-33
P54811 809 Transitional endoplasmic yes N/A 0.803 0.106 0.697 1e-32
>sp|Q6GL04|TERA_XENTR Transitional endoplasmic reticulum ATPase OS=Xenopus tropicalis GN=vcp PE=2 SV=1 Back     alignment and function desciption
 Score =  149 bits (375), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 79/86 (91%)

Query: 22  SAKMDELNLFRGDTVLLRGKRRKESVCIVLSDDTCPDEKIRMNRVMRNNLRVRLSDVVSL 81
            AKMDEL LFRGDTVLL+GK+R+E+VCIVLSDDTC DEKIRMNRV+RNNLRVRL DV+S+
Sbjct: 43  QAKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISI 102

Query: 82  VPCPGIVYGKRIHVLPIDDSVQGLTG 107
            PCP + YGKRIHVLPIDD+V+G+TG
Sbjct: 103 QPCPDVKYGKRIHVLPIDDTVEGITG 128
Necessary for the fragmentation of Golgi stacks during mitosis and for their reassembly after mitosis. Involved in the formation of the nuclear envelope and of the transitional endoplasmic reticulum (tER). The transfer of membranes from the endoplasmic reticulum to the Golgi apparatus occurs via 50-70 nm transition vesicles which derive from part-rough, part-smooth transitional elements of the endoplasmic reticulum (tER). Vesicle budding from the tER is an ATP-dependent process.
Xenopus tropicalis (taxid: 8364)
>sp|Q7ZU99|TERA_DANRE Transitional endoplasmic reticulum ATPase OS=Danio rerio GN=vcp PE=1 SV=1 Back     alignment and function description
>sp|P23787|TERA_XENLA Transitional endoplasmic reticulum ATPase OS=Xenopus laevis GN=vcp PE=1 SV=3 Back     alignment and function description
>sp|Q01853|TERA_MOUSE Transitional endoplasmic reticulum ATPase OS=Mus musculus GN=Vcp PE=1 SV=4 Back     alignment and function description
>sp|P55072|TERA_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens GN=VCP PE=1 SV=4 Back     alignment and function description
>sp|P46462|TERA_RAT Transitional endoplasmic reticulum ATPase OS=Rattus norvegicus GN=Vcp PE=1 SV=3 Back     alignment and function description
>sp|Q3ZBT1|TERA_BOVIN Transitional endoplasmic reticulum ATPase OS=Bos taurus GN=VCP PE=2 SV=1 Back     alignment and function description
>sp|P03974|TERA_PIG Transitional endoplasmic reticulum ATPase OS=Sus scrofa GN=VCP PE=1 SV=5 Back     alignment and function description
>sp|Q7KN62|TERA_DROME Transitional endoplasmic reticulum ATPase TER94 OS=Drosophila melanogaster GN=TER94 PE=1 SV=1 Back     alignment and function description
>sp|P54811|TERA1_CAEEL Transitional endoplasmic reticulum ATPase homolog 1 OS=Caenorhabditis elegans GN=cdc-48.1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query107
112983322 805 transitional endoplasmic reticulum ATPas 0.794 0.105 0.823 6e-36
380016377 893 PREDICTED: LOW QUALITY PROTEIN: transiti 0.803 0.096 0.837 2e-35
357623246 1316 transitional endoplasmic reticulum ATPas 0.785 0.063 0.821 2e-35
350426753 811 PREDICTED: transitional endoplasmic reti 0.803 0.106 0.837 3e-35
328783535 811 PREDICTED: transitional endoplasmic reti 0.803 0.106 0.837 3e-35
383861757 801 PREDICTED: transitional endoplasmic reti 0.803 0.107 0.825 4e-35
340722106 811 PREDICTED: transitional endoplasmic reti 0.803 0.106 0.825 4e-35
383861759 811 PREDICTED: transitional endoplasmic reti 0.794 0.104 0.835 4e-35
307174120 801 Transitional endoplasmic reticulum ATPas 0.803 0.107 0.837 5e-35
307211146 796 Transitional endoplasmic reticulum ATPas 0.803 0.108 0.825 6e-35
>gi|112983322|ref|NP_001037003.1| transitional endoplasmic reticulum ATPase TER94 [Bombyx mori] gi|83423461|dbj|BAE54254.1| transitional endoplasmic reticulum ATPase TER94 [Bombyx mori] gi|95102992|gb|ABF51437.1| transitional endoplasmic reticulum ATPase TER94 [Bombyx mori] Back     alignment and taxonomy information
 Score =  154 bits (389), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 80/85 (94%)

Query: 23  AKMDELNLFRGDTVLLRGKRRKESVCIVLSDDTCPDEKIRMNRVMRNNLRVRLSDVVSLV 82
           AKM++L LFRGDTVLL+GKRRKE+VCIVLSDD CPDEKIRMNRV+RNNLRVRLSDVVS+ 
Sbjct: 42  AKMEQLQLFRGDTVLLKGKRRKETVCIVLSDDNCPDEKIRMNRVVRNNLRVRLSDVVSIA 101

Query: 83  PCPGIVYGKRIHVLPIDDSVQGLTG 107
           PCP + YGKR+H+LPIDDSV+GLTG
Sbjct: 102 PCPSVKYGKRVHILPIDDSVEGLTG 126

Source: Bombyx mori

Species: Bombyx mori

Genus: Bombyx

Family: Bombycidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380016377|ref|XP_003692162.1| PREDICTED: LOW QUALITY PROTEIN: transitional endoplasmic reticulum ATPase TER94-like [Apis florea] Back     alignment and taxonomy information
>gi|357623246|gb|EHJ74479.1| transitional endoplasmic reticulum ATPase TER94 [Danaus plexippus] Back     alignment and taxonomy information
>gi|350426753|ref|XP_003494532.1| PREDICTED: transitional endoplasmic reticulum ATPase TER94-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328783535|ref|XP_392892.3| PREDICTED: transitional endoplasmic reticulum ATPase TER94 isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|383861757|ref|XP_003706351.1| PREDICTED: transitional endoplasmic reticulum ATPase TER94-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
>gi|340722106|ref|XP_003399450.1| PREDICTED: transitional endoplasmic reticulum ATPase TER94-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383861759|ref|XP_003706352.1| PREDICTED: transitional endoplasmic reticulum ATPase TER94-like isoform 2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|307174120|gb|EFN64778.1| Transitional endoplasmic reticulum ATPase TER94 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307211146|gb|EFN87364.1| Transitional endoplasmic reticulum ATPase TER94 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query107
UNIPROTKB|C9IZA5160 VCP "Transitional endoplasmic 0.775 0.518 0.602 1.6e-22
UNIPROTKB|C9JUP7115 VCP "Transitional endoplasmic 0.775 0.721 0.602 1.6e-22
UNIPROTKB|E1BTS8 804 LOC426240 "Uncharacterized pro 0.794 0.105 0.611 2.4e-22
UNIPROTKB|Q6GL04 805 vcp "Transitional endoplasmic 0.794 0.105 0.611 2.4e-22
UNIPROTKB|F1P4V8 810 LOC426240 "Uncharacterized pro 0.794 0.104 0.611 2.4e-22
UNIPROTKB|P23787 805 vcp "Transitional endoplasmic 0.794 0.105 0.6 3e-22
ZFIN|ZDB-GENE-030131-5408 806 vcp "valosin containing protei 0.794 0.105 0.6 3e-22
UNIPROTKB|G3X757 806 VCP "Transitional endoplasmic 0.785 0.104 0.607 6.4e-22
UNIPROTKB|Q3ZBT1 806 VCP "Transitional endoplasmic 0.785 0.104 0.607 6.4e-22
UNIPROTKB|P55072 806 VCP "Transitional endoplasmic 0.785 0.104 0.607 6.4e-22
UNIPROTKB|C9IZA5 VCP "Transitional endoplasmic reticulum ATPase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 261 (96.9 bits), Expect = 1.6e-22, P = 1.6e-22
 Identities = 50/83 (60%), Positives = 58/83 (69%)

Query:    25 MDELNLFRGDTVLLRGKRRKESVCIVLSDDTCPDEKIXXXXXXXXXXXXXXXXXXXXXPC 84
             MDEL LFRGDTVLL+GK+R+E+VCIVLSDDTC DEKI                     PC
Sbjct:     1 MDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPC 60

Query:    85 PGIVYGKRIHVLPIDDSVQGLTG 107
             P + YGKRIHVLPIDD+V+G+TG
Sbjct:    61 PDVKYGKRIHVLPIDDTVEGITG 83
GO:0005102 "receptor binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005783 "endoplasmic reticulum" evidence=IEA
GO:0005829 "cytosol" evidence=IEA
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=IEA
GO:0006888 "ER to Golgi vesicle-mediated transport" evidence=IEA
GO:0006919 "activation of cysteine-type endopeptidase activity involved in apoptotic process" evidence=IEA
GO:0016887 "ATPase activity" evidence=IEA
GO:0031593 "polyubiquitin binding" evidence=IEA
GO:0032403 "protein complex binding" evidence=IEA
GO:0032436 "positive regulation of proteasomal ubiquitin-dependent protein catabolic process" evidence=IEA
GO:0042802 "identical protein binding" evidence=IEA
GO:0043234 "protein complex" evidence=IEA
GO:0051260 "protein homooligomerization" evidence=IEA
GO:0070842 "aggresome assembly" evidence=IEA
GO:0005634 "nucleus" evidence=IDA
GO:0005730 "nucleolus" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
UNIPROTKB|C9JUP7 VCP "Transitional endoplasmic reticulum ATPase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BTS8 LOC426240 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q6GL04 vcp "Transitional endoplasmic reticulum ATPase" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|F1P4V8 LOC426240 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P23787 vcp "Transitional endoplasmic reticulum ATPase" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5408 vcp "valosin containing protein" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G3X757 VCP "Transitional endoplasmic reticulum ATPase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZBT1 VCP "Transitional endoplasmic reticulum ATPase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P55072 VCP "Transitional endoplasmic reticulum ATPase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7KN62TERA_DROMENo assigned EC number0.75580.80370.1073yesN/A
Q9LZF6CD48E_ARATHNo assigned EC number0.61440.77570.1024yesN/A
Q3ZBT1TERA_BOVINNo assigned EC number0.78570.78500.1042yesN/A
P54811TERA1_CAEELNo assigned EC number0.69760.80370.1063yesN/A
Q7ZU99TERA_DANRENo assigned EC number0.77900.80370.1066yesN/A
P25694CDC48_YEASTNo assigned EC number0.59300.80370.1029yesN/A
Q9P3A7CDC48_SCHPONo assigned EC number0.59300.80370.1055yesN/A
P54609CD48A_ARATHNo assigned EC number0.61170.79430.1050yesN/A
P55072TERA_HUMANNo assigned EC number0.79760.78500.1042yesN/A
Q6GL04TERA_XENTRNo assigned EC number0.79060.80370.1068yesN/A
P03974TERA_PIGNo assigned EC number0.78570.78500.1042yesN/A
Q01853TERA_MOUSENo assigned EC number0.79760.78500.1042yesN/A
Q5AWS6CDC48_EMENINo assigned EC number0.61440.77570.1008yesN/A
P46462TERA_RATNo assigned EC number0.79760.78500.1042yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query107
pfam0235984 pfam02359, CDC48_N, Cell division protein 48 (CDC4 1e-15
smart0107382 smart01073, CDC48_N, Cell division protein 48 (CDC 3e-13
>gnl|CDD|216993 pfam02359, CDC48_N, Cell division protein 48 (CDC48), N-terminal domain Back     alignment and domain information 
 Score = 65.7 bits (161), Expect = 1e-15
 Identities = 30/80 (37%), Positives = 38/80 (47%), Gaps = 4/80 (5%)

Query: 8  RGDTVLLRGKRRKESAKMDELNLFRGDTVLLRGKRRKESVCIVLSDDTC--PDEKIRMNR 65
            D  + RG  R     MDEL LF GD V ++GKRR  +V IV            IRM+ 
Sbjct: 7  PNDRDVGRGIARLSPKDMDELGLFPGDIVEIKGKRR--TVAIVWPARPEDEGPGIIRMDG 64

Query: 66 VMRNNLRVRLSDVVSLVPCP 85
          V R N  V + D V++ P  
Sbjct: 65 VQRKNAGVSIGDEVTVRPAE 84

This domain has a double psi-beta barrel fold and includes VCP-like ATPase and N-ethylmaleimide sensitive fusion protein N-terminal domains. Both the VAT and NSF N-terminal functional domains consist of two structural domains of which this is at the N-terminus. The VAT-N domain found in AAA ATPases pfam00004 is a substrate 185-residue recognition domain. Length = 84
>gnl|CDD|215012 smart01073, CDC48_N, Cell division protein 48 (CDC48) N-terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 107
PF0235987 CDC48_N: Cell division protein 48 (CDC48), N-termi 99.8
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.57
KOG0730|consensus 693 98.56
PF0235987 CDC48_N: Cell division protein 48 (CDC48), N-termi 97.44
cd02786116 MopB_CT_3 The MopB_CT_3 CD includes a group of rel 97.35
PF01568110 Molydop_binding: Molydopterin dinucleotide binding 97.34
cd02787112 MopB_CT_ydeP The MopB_CT_ydeP CD includes a group 97.29
cd0278896 MopB_CT_NDH-1_NuoG2-N7 MopB_CT_NDH-1_NuoG2-N7: C-t 97.28
cd02790116 MopB_CT_Formate-Dh_H Formate dehydrogenase H (Form 97.23
cd02775101 MopB_CT Molybdopterin-Binding, C-terminal (MopB_CT 97.21
cd02789106 MopB_CT_FmdC-FwdD The MopB_FmdC-FwdD CD includes t 97.21
cd02794121 MopB_CT_DmsA-EC The MopB_CT_DmsA-EC CD includes th 97.2
cd02777127 MopB_CT_DMSOR-like The MopB_CT_DMSOR-like CD conta 97.15
cd02785124 MopB_CT_4 The MopB_CT_4 CD includes a group of rel 97.15
cd02792122 MopB_CT_Formate-Dh-Na-like Formate dehydrogenase N 97.07
cd00508120 MopB_CT_Fdh-Nap-like This CD includes formate dehy 97.07
cd02781130 MopB_CT_Acetylene-hydratase The MopB_CT_Acetylene- 97.07
cd02778123 MopB_CT_Thiosulfate-R-like The MopB_CT_Thiosulfate 97.06
cd02793129 MopB_CT_DMSOR-BSOR-TMAOR The MopB_DMSOR-BSOR-TMAOR 97.02
cd02791122 MopB_CT_Nitrate-R-NapA-like Nitrate reductases, Na 96.91
cd02779115 MopB_CT_Arsenite-Ox This CD contains the molybdopt 96.9
cd02782129 MopB_CT_1 The MopB_CT_1 CD includes a group of rel 96.87
cd02776141 MopB_CT_Nitrate-R-NarG-like Respiratory nitrate re 96.84
cd02784137 MopB_CT_PHLH The MopB_CT_PHLH CD includes a group 96.71
cd02780143 MopB_CT_Tetrathionate_Arsenate-R This CD contains 96.68
cd02783156 MopB_CT_2 The MopB_CT_2 CD includes a group of rel 96.64
COG1153128 FwdD Formylmethanofuran dehydrogenase subunit D [E 96.58
PRK05449126 aspartate alpha-decarboxylase; Provisional 95.9
cd06919111 Asp_decarbox Aspartate alpha-decarboxylase or L-as 95.76
TIGR00223126 panD L-aspartate-alpha-decarboxylase. Members of t 95.51
PF03152176 UFD1: Ubiquitin fusion degradation protein UFD1; I 95.29
KOG1816|consensus 308 95.23
TIGR02693806 arsenite_ox_L arsenite oxidase, large subunit. Thi 94.96
PRK15102825 trimethylamine N-oxide reductase I catalytic subun 94.95
COG0853126 PanD Aspartate 1-decarboxylase [Coenzyme metabolis 94.73
TIGR02166797 dmsA_ynfE anaerobic dimethyl sulfoxide reductase, 94.66
TIGR02164822 torA trimethylamine-N-oxide reductase TorA. This v 94.59
PF02261116 Asp_decarbox: Aspartate decarboxylase; InterPro: I 94.56
TIGR03479912 DMSO_red_II_alp DMSO reductase family type II enzy 94.51
COG0243765 BisC Anaerobic dehydrogenases, typically selenocys 94.42
PRK14990814 anaerobic dimethyl sulfoxide reductase subunit A; 94.18
TIGR00509770 bisC_fam molybdopterin guanine dinucleotide-contai 94.08
TIGR01591671 Fdh-alpha formate dehydrogenase, alpha subunit, ar 93.85
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 93.24
PRK15488759 thiosulfate reductase PhsA; Provisional 93.18
PRK08166847 NADH dehydrogenase subunit G; Validated 92.95
PRK07860797 NADH dehydrogenase subunit G; Validated 92.84
TIGR01701743 Fdhalpha-like oxidoreductase alpha (molybdopterin) 91.88
TIGR03327 500 AMP_phos AMP phosphorylase. This enzyme family is 91.69
PRK149911031 tetrathionate reductase subunit A; Provisional 91.46
TIGR01706830 NAPA periplasmic nitrate reductase, large subunit. 91.34
PF0401447 Antitoxin-MazE: Antidote-toxin recognition MazE; I 91.2
TIGR02645 493 ARCH_P_rylase putative thymidine phosphorylase. Me 91.07
PRK04350 490 thymidine phosphorylase; Provisional 90.76
TIGR015801235 narG respiratory nitrate reductase, alpha subunit. 90.64
PRK13532830 nitrate reductase catalytic subunit; Provisional 90.53
PF0401447 Antitoxin-MazE: Antidote-toxin recognition MazE; I 90.14
PRK09129776 NADH dehydrogenase subunit G; Validated 90.01
PF0892280 DUF1905: Domain of unknown function (DUF1905); Int 89.79
TIGR0000868 infA translation initiation factor IF-1. This fami 89.58
TIGR0143943 lp_hng_hel_AbrB looped-hinge helix DNA binding dom 89.45
PRK15070211 propanediol utilization phosphotransacylase; Provi 89.35
TIGR0143943 lp_hng_hel_AbrB looped-hinge helix DNA binding dom 88.45
TIGR0260974 doc_partner putative addiction module antidote. Me 87.78
PRK1134783 antitoxin ChpS; Provisional 87.59
COG036175 InfA Translation initiation factor 1 (IF-1) [Trans 86.77
PF0345964 TOBE: TOBE domain; InterPro: IPR005116 The TOBE do 86.6
PLN03086 567 PRLI-interacting factor K; Provisional 86.23
PF03152176 UFD1: Ubiquitin fusion degradation protein UFD1; I 85.87
COG200289 AbrB Regulators of stationary/sporulation gene exp 85.86
PRK1244287 translation initiation factor IF-1; Reviewed 85.2
TIGR015531009 formate-DH-alph formate dehydrogenase, alpha subun 84.89
PRK08577136 hypothetical protein; Provisional 84.74
PRK0979882 antitoxin MazE; Provisional 84.43
PLN03086 567 PRLI-interacting factor K; Provisional 83.8
TIGR0260974 doc_partner putative addiction module antidote. Me 83.71
cd0445968 Rho_CSD Rho_CSD: Rho protein cold-shock domain (CS 83.19
COG1974201 LexA SOS-response transcriptional repressors (RecA 81.83
COG1974201 LexA SOS-response transcriptional repressors (RecA 80.71
PF0926387 PEX-2N: Peroxisome biogenesis factor 1, N-terminal 80.36
>PF02359 CDC48_N: Cell division protein 48 (CDC48), N-terminal domain; InterPro: IPR003338 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information 
Probab=99.80  E-value=5.9e-20  Score=120.06  Aligned_cols=71  Identities=35%  Similarity=0.539  Sum_probs=60.0

Q ss_pred             EEeEEEecCHHHHhhCCCCCCCEEEEEeccCCcEEEEeccCCCC--CCCeEEEeHhhhhcccccCCCeEEEEeCC
Q psy3865          13 LLRGKRRKESAKMDELNLFRGDTVLLRGKRRKESVCIVLSDDTC--PDEKIRMNRVMRNNLRVRLSDVVSLVPCP   85 (107)
Q Consensus        13 ~~rGiari~~~~m~~Lgl~~GD~V~I~Gkr~~~tvai~~~~~d~--~~~~Irid~~~R~N~~v~igD~V~V~~~~   85 (107)
                      ..+++|+|||++|++||++.||+|+|.|++  +|+|++++.+..  +.+.|+||+.+|+||++++||.|+|++++
T Consensus        13 ~~~n~v~v~~~~m~~l~l~~gd~v~i~g~~--~tv~~v~~~~~~~~~~g~I~l~~~~R~n~~v~igd~V~V~~~~   85 (87)
T PF02359_consen   13 AGTNCVRVSPEDMEELGLFPGDVVLISGKR--KTVAFVFPDRPDDSPPGVIRLSGIQRKNAGVSIGDRVTVRPYD   85 (87)
T ss_dssp             HCTTEEEEEHHHHHCTTT-TTEEEEEETTT--EEEEEEEEECCSTTCTTEEEE-HHHHHHCT--TTSEEEEEEET
T ss_pred             CCCCEEEEcHHHHHHcCCCCccEEEEeCCc--eEEEEEEECCCCCCCCCEEEECHHHHhhCCcCCCCEEEEEECC
Confidence            457899999999999999999999999955  499999877543  79999999999999999999999999973

Some of them function as molecular chaperones, subunits of proteolytic complexes or independent proteases (FtsH, Lon). They also act as DNA helicases and transcription factors []. AAA ATPases belong to the AAA+ superfamily of ringshaped P-loop NTPases, which act via the energy-dependent unfolding of macromolecules [, ]. There are six major clades of AAA domains (proteasome subunits, metalloproteases, domains D1 and D2 of ATPases with two AAA domains, the MSP1/katanin/spastin group and BCS1 and it homologues), as well as a number of deeply branching minor clades []. They assemble into oligomeric assemblies (often hexamers) that form a ring-shaped structure with a central pore. These proteins produce a molecular motor that couples ATP binding and hydrolysis to changes in conformational states that act upon a target substrate, either translocating or remodelling it []. They are found in all living organisms and share the common feature of the presence of a highly conserved AAA domain called the AAA module. This domain is responsible for ATP binding and hydrolysis. It contains 200-250 residues, among them there are two classical motifs, Walker A (GX4GKT) and Walker B (HyDE) []. The VAT protein of the archaebacterium Thermoplasma acidophilum, like all other members of the Cdc48/p97 family of AAA ATPases, has two ATPase domains and a 185-residue amino-terminal substrate-recognition domain, VAT-N. VAT shows activity in protein folding and unfolding and thus shares the common function of these ATPases in disassembly and/or degradation of protein complexes. VAT-N is composed of two equally sized subdomains. The amino-terminal subdomain VAT-Nn forms a double-psi beta-barrel whose pseudo-twofold symmetry is mirrored by an internal sequence repeat of 42 residues. The carboxy-terminal subdomain VAT-Nc forms a novel six-stranded beta-clam fold []. Together, VAT-Nn and VAT-Nc form a kidney-shaped structure, in close agreement with results from electron microscopy. VAT-Nn is related to numerous proteins including prokaryotic transcription factors, metabolic enzymes, the protease cofactors UFD1 and PrlF, and aspartic proteinases. ; GO: 0005524 ATP binding; PDB: 1CZ4_A 1CZ5_A 3CF3_C 3CF1_A 3CF2_A 1S3S_D 1E32_A 1R7R_A 2PJH_B 1CR5_B ....
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>PF02359 CDC48_N: Cell division protein 48 (CDC48), N-terminal domain; InterPro: IPR003338 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>cd02786 MopB_CT_3 The MopB_CT_3 CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site Back     alignment and domain information
>PF01568 Molydop_binding: Molydopterin dinucleotide binding domain; InterPro: IPR006657 A domain in this entry corresponds to the C-terminal domain IV in dimethyl sulphoxide (DMSO)reductase which interacts with the 2-amino pyrimidone ring of both molybdopterin guanine dinucleotide molecules [] Back     alignment and domain information
>cd02787 MopB_CT_ydeP The MopB_CT_ydeP CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative molybdopterin cofactor binding site Back     alignment and domain information
>cd02788 MopB_CT_NDH-1_NuoG2-N7 MopB_CT_NDH-1_NuoG2-N7: C-terminal region of the NuoG-like subunit (of the variant with a [4Fe-4S] cluster, N7) of the NADH-quinone oxidoreductase/NADH dehydrogenase-1 (NDH-1) found in various bacteria Back     alignment and domain information
>cd02790 MopB_CT_Formate-Dh_H Formate dehydrogenase H (Formate-Dh-H) catalyzes the reversible oxidation of formate to CO2 with the release of a proton and two electrons Back     alignment and domain information
>cd02775 MopB_CT Molybdopterin-Binding, C-terminal (MopB_CT) domain of the MopB superfamily of proteins, a large, diverse, heterogeneous superfamily of enzymes that, in general, bind molybdopterin as a cofactor Back     alignment and domain information
>cd02789 MopB_CT_FmdC-FwdD The MopB_FmdC-FwdD CD includes the C-terminus of subunit C of molybdenum formylmethanofuran dehydrogenase (FmdC) and subunit D of tungsten formylmethanofuran dehydrogenase (FwdD), and other related proteins Back     alignment and domain information
>cd02794 MopB_CT_DmsA-EC The MopB_CT_DmsA-EC CD includes the DmsA enzyme of the dmsABC operon encoding the anaerobic dimethylsulfoxide reductase (DMSOR) of Escherichia coli and other related DMSOR-like enzymes Back     alignment and domain information
>cd02777 MopB_CT_DMSOR-like The MopB_CT_DMSOR-like CD contains dimethylsulfoxide reductase (DMSOR), biotin sulfoxide reductase (BSOR), trimethylamine N-oxide reductase (TMAOR) and other related proteins Back     alignment and domain information
>cd02785 MopB_CT_4 The MopB_CT_4 CD includes a group of related uncharacterized bacterial and archaeal molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site Back     alignment and domain information
>cd02792 MopB_CT_Formate-Dh-Na-like Formate dehydrogenase N, alpha subunit (Formate-Dh-Na) is a major component of nitrate respiration in bacteria such as in the E Back     alignment and domain information
>cd00508 MopB_CT_Fdh-Nap-like This CD includes formate dehydrogenases (Fdh) H and N; nitrate reductases, Nap and Nas; and other related proteins Back     alignment and domain information
>cd02781 MopB_CT_Acetylene-hydratase The MopB_CT_Acetylene-hydratase CD contains acetylene hydratase (Ahy) and other related proteins Back     alignment and domain information
>cd02778 MopB_CT_Thiosulfate-R-like The MopB_CT_Thiosulfate-R-like CD contains thiosulfate-, sulfur-, and polysulfide-reductases, and other related proteins Back     alignment and domain information
>cd02793 MopB_CT_DMSOR-BSOR-TMAOR The MopB_DMSOR-BSOR-TMAOR CD contains dimethylsulfoxide reductase (DMSOR), biotin sulfoxide reductase (BSOR), trimethylamine N-oxide reductase (TMAOR) and other related proteins Back     alignment and domain information
>cd02791 MopB_CT_Nitrate-R-NapA-like Nitrate reductases, NapA (Nitrate-R-NapA), NasA, and NarB catalyze the reduction of nitrate to nitrite Back     alignment and domain information
>cd02779 MopB_CT_Arsenite-Ox This CD contains the molybdopterin_binding C-terminal (MopB_CT) region of Arsenite oxidase (Arsenite-Ox) and related proteins Back     alignment and domain information
>cd02782 MopB_CT_1 The MopB_CT_1 CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site Back     alignment and domain information
>cd02776 MopB_CT_Nitrate-R-NarG-like Respiratory nitrate reductase A (NarGHI), alpha chain (NarG) and related proteins Back     alignment and domain information
>cd02784 MopB_CT_PHLH The MopB_CT_PHLH CD includes a group of related uncharacterized putative hydrogenase-like homologs (PHLH) of molybdopterin binding proteins Back     alignment and domain information
>cd02780 MopB_CT_Tetrathionate_Arsenate-R This CD contains the molybdopterin_binding C-terminal (MopB_CT) region of tetrathionate reductase, subunit A, (TtrA); respiratory arsenate As(V) reductase, catalytic subunit (ArrA); and other related proteins Back     alignment and domain information
>cd02783 MopB_CT_2 The MopB_CT_2 CD includes a group of related uncharacterized bacterial and archaeal molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site Back     alignment and domain information
>COG1153 FwdD Formylmethanofuran dehydrogenase subunit D [Energy production and conversion] Back     alignment and domain information
>PRK05449 aspartate alpha-decarboxylase; Provisional Back     alignment and domain information
>cd06919 Asp_decarbox Aspartate alpha-decarboxylase or L-aspartate 1-decarboxylase, a pyruvoyl group-dependent decarboxylase in beta-alanine production Back     alignment and domain information
>TIGR00223 panD L-aspartate-alpha-decarboxylase Back     alignment and domain information
>PF03152 UFD1: Ubiquitin fusion degradation protein UFD1; InterPro: IPR004854 Post-translational ubiquitin-protein conjugates are recognised for degradation by the ubiquitin fusion degradation (UFD) pathway Back     alignment and domain information
>KOG1816|consensus Back     alignment and domain information
>TIGR02693 arsenite_ox_L arsenite oxidase, large subunit Back     alignment and domain information
>PRK15102 trimethylamine N-oxide reductase I catalytic subunit; Provisional Back     alignment and domain information
>COG0853 PanD Aspartate 1-decarboxylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02166 dmsA_ynfE anaerobic dimethyl sulfoxide reductase, A subunit, DmsA/YnfE family Back     alignment and domain information
>TIGR02164 torA trimethylamine-N-oxide reductase TorA Back     alignment and domain information
>PF02261 Asp_decarbox: Aspartate decarboxylase; InterPro: IPR003190 Decarboxylation of aspartate is the major route of alanine production in bacteria, and is catalysed by the enzyme aspartate decarboxylase Back     alignment and domain information
>TIGR03479 DMSO_red_II_alp DMSO reductase family type II enzyme, molybdopterin subunit Back     alignment and domain information
>COG0243 BisC Anaerobic dehydrogenases, typically selenocysteine-containing [Energy production and conversion] Back     alignment and domain information
>PRK14990 anaerobic dimethyl sulfoxide reductase subunit A; Provisional Back     alignment and domain information
>TIGR00509 bisC_fam molybdopterin guanine dinucleotide-containing S/N-oxide reductases Back     alignment and domain information
>TIGR01591 Fdh-alpha formate dehydrogenase, alpha subunit, archaeal-type Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK15488 thiosulfate reductase PhsA; Provisional Back     alignment and domain information
>PRK08166 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK07860 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>TIGR01701 Fdhalpha-like oxidoreductase alpha (molybdopterin) subunit Back     alignment and domain information
>TIGR03327 AMP_phos AMP phosphorylase Back     alignment and domain information
>PRK14991 tetrathionate reductase subunit A; Provisional Back     alignment and domain information
>TIGR01706 NAPA periplasmic nitrate reductase, large subunit Back     alignment and domain information
>PF04014 Antitoxin-MazE: Antidote-toxin recognition MazE; InterPro: IPR007159 This domain is found in AbrB from Bacillus subtilis Back     alignment and domain information
>TIGR02645 ARCH_P_rylase putative thymidine phosphorylase Back     alignment and domain information
>PRK04350 thymidine phosphorylase; Provisional Back     alignment and domain information
>TIGR01580 narG respiratory nitrate reductase, alpha subunit Back     alignment and domain information
>PRK13532 nitrate reductase catalytic subunit; Provisional Back     alignment and domain information
>PF04014 Antitoxin-MazE: Antidote-toxin recognition MazE; InterPro: IPR007159 This domain is found in AbrB from Bacillus subtilis Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PF08922 DUF1905: Domain of unknown function (DUF1905); InterPro: IPR015018 This family consist of hypothetical bacterial proteins Back     alignment and domain information
>TIGR00008 infA translation initiation factor IF-1 Back     alignment and domain information
>TIGR01439 lp_hng_hel_AbrB looped-hinge helix DNA binding domain, AbrB family Back     alignment and domain information
>PRK15070 propanediol utilization phosphotransacylase; Provisional Back     alignment and domain information
>TIGR01439 lp_hng_hel_AbrB looped-hinge helix DNA binding domain, AbrB family Back     alignment and domain information
>TIGR02609 doc_partner putative addiction module antidote Back     alignment and domain information
>PRK11347 antitoxin ChpS; Provisional Back     alignment and domain information
>COG0361 InfA Translation initiation factor 1 (IF-1) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03459 TOBE: TOBE domain; InterPro: IPR005116 The TOBE domain [] (Transport-associated OB) always occurs as a dimer as the C-terminal strand of each domain is supplied by the partner Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF03152 UFD1: Ubiquitin fusion degradation protein UFD1; InterPro: IPR004854 Post-translational ubiquitin-protein conjugates are recognised for degradation by the ubiquitin fusion degradation (UFD) pathway Back     alignment and domain information
>COG2002 AbrB Regulators of stationary/sporulation gene expression [Transcription] Back     alignment and domain information
>PRK12442 translation initiation factor IF-1; Reviewed Back     alignment and domain information
>TIGR01553 formate-DH-alph formate dehydrogenase, alpha subunit, proteobacterial-type Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>PRK09798 antitoxin MazE; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>TIGR02609 doc_partner putative addiction module antidote Back     alignment and domain information
>cd04459 Rho_CSD Rho_CSD: Rho protein cold-shock domain (CSD) Back     alignment and domain information
>COG1974 LexA SOS-response transcriptional repressors (RecA-mediated autopeptidases) [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG1974 LexA SOS-response transcriptional repressors (RecA-mediated autopeptidases) [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF09263 PEX-2N: Peroxisome biogenesis factor 1, N-terminal ; InterPro: IPR015343 This domain adopts a Cdc48 domain 2-like fold, with a beta-alpha-beta(3) arrangement Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query107
3hu2_A 489 Structure Of P97 N-D1 R86a Mutant In Complex With A 6e-24
1r7r_A 816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 7e-24
1e32_A 458 Structure Of The N-Terminal Domain And The D1 Aaa D 7e-24
3cf1_A 806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 8e-24
3hu3_A 489 Structure Of P97 N-D1 R155h Mutant In Complex With 8e-24
3hu1_A 489 Structure Of P97 N-D1 R95g Mutant In Complex With A 9e-24
3tiw_A187 Crystal Structure Of P97n In Complex With The C-Ter 2e-23
3qq7_A186 Crystal Structure Of The P97 N-Terminal Domain Leng 2e-23
3qc8_A178 Crystal Structure Of Faf1 Ubx Domain In Complex Wit 3e-23
2pjh_B193 Strctural Model Of The P97 N Domain- Npl4 Ubd Compl 3e-23
3qwz_A211 Crystal Structure Of Faf1 Ubx-P97n-Domain Complex L 9e-23
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure 
Iteration: 1

 Score =  105 bits (262), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 51/84 (60%), Positives = 59/84 (70%)
Query: 24  KMDELNLFRGDTVLLRGKRRKESVCIVLSDDTCPDEKIXXXXXXXXXXXXXXXXXXXXXP 83
           KMDEL LFRGDTVLL+GK+R+E+VCIVLSDDTC DEKI                     P
Sbjct: 45  KMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNAVVRNNLRVRLGDVISIQP 104
Query: 84  CPGIVYGKRIHVLPIDDSVQGLTG 107
           CP + YGKRIHVLPIDD+V+G+TG
Sbjct: 105 CPDVKYGKRIHVLPIDDTVEGITG 128
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3TIW|A Chain A, Crystal Structure Of P97n In Complex With The C-Terminus Of Gp78 Length = 187 Back     alignment and structure
>pdb|3QQ7|A Chain A, Crystal Structure Of The P97 N-Terminal Domain Length = 186 Back     alignment and structure
>pdb|3QC8|A Chain A, Crystal Structure Of Faf1 Ubx Domain In Complex With P97VCP N DOMAIN Reveals The Conserved Fcisp Touch-Turn Motif Of Ubx Domain Suffering Conformational Change Length = 178 Back     alignment and structure
>pdb|2PJH|B Chain B, Strctural Model Of The P97 N Domain- Npl4 Ubd Complex Length = 193 Back     alignment and structure
>pdb|3QWZ|A Chain A, Crystal Structure Of Faf1 Ubx-P97n-Domain Complex Length = 211 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query107
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 1e-27
3tiw_A187 Transitional endoplasmic reticulum ATPase; beta-ba 1e-26
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 4e-26
3qwz_A211 Transitional endoplasmic reticulum ATPase; UBX, P9 6e-26
1cz4_A185 VCP-like ATPase; double-PSI beta-barrel, beta-CLAM 2e-20
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
 Score =  103 bits (259), Expect = 1e-27
 Identities = 67/93 (72%), Positives = 78/93 (83%)

Query: 15  RGKRRKESAKMDELNLFRGDTVLLRGKRRKESVCIVLSDDTCPDEKIRMNRVMRNNLRVR 74
                    KMDEL LFRGDTVLL+GK+R+E+VCIVLSDDTC DEKIRMNRV+RNNLRVR
Sbjct: 36  NSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVR 95

Query: 75  LSDVVSLVPCPGIVYGKRIHVLPIDDSVQGLTG 107
           L DV+S+ PCP + YGKRIHVLPIDD+V+G+TG
Sbjct: 96  LGDVISIQPCPDVKYGKRIHVLPIDDTVEGITG 128
>3tiw_A Transitional endoplasmic reticulum ATPase; beta-barrel alpha-helix, transport protein ATPase ubiquitin ubiquitin, phosphorylation; 1.80A {Homo sapiens} PDB: 3qq8_A 3qq7_A 3qc8_A Length = 187 Back     alignment and structure
>3qwz_A Transitional endoplasmic reticulum ATPase; UBX, P97 binding, transport protein; HET: MLY; 2.00A {Homo sapiens} PDB: 2pjh_B Length = 211 Back     alignment and structure
>1cz4_A VCP-like ATPase; double-PSI beta-barrel, beta-CLAM, substrate recognition DOM hydrolase; NMR {Thermoplasma acidophilum} SCOP: b.52.2.3 d.31.1.1 PDB: 1cz5_A Length = 185 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query107
3qwz_A211 Transitional endoplasmic reticulum ATPase; UBX, P9 99.97
3tiw_A187 Transitional endoplasmic reticulum ATPase; beta-ba 99.97
1cz4_A185 VCP-like ATPase; double-PSI beta-barrel, beta-CLAM 99.93
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.9
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.9
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 99.85
1wlf_A179 PEX1, peroxisome biogenesis factor 1; N-terminal d 99.84
3tiw_A187 Transitional endoplasmic reticulum ATPase; beta-ba 98.42
3qwz_A211 Transitional endoplasmic reticulum ATPase; UBX, P9 98.32
1cz4_A185 VCP-like ATPase; double-PSI beta-barrel, beta-CLAM 97.88
2glw_A92 PHS018, 92AA long hypothetical protein; RIFT barre 97.17
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 97.12
2ki8_A146 Tungsten formylmethanofuran dehydrogenase, subunit 96.99
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 96.79
1wlf_A179 PEX1, peroxisome biogenesis factor 1; N-terminal d 96.74
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 96.69
2yuj_A190 Ubiquitin fusion degradation 1-like; ubiquitin-dep 96.18
1cr5_A189 SEC18P (residues 22 - 210); double-PSI beta barrel 95.95
1zc1_A208 Ubiquitin fusion degradation protein 1; UFD1, doub 95.55
3oug_A114 Aspartate 1-decarboxylase; structural genomics, ce 95.49
1vc3_B96 L-aspartate-alpha-decarboxylase heavy chain; tetra 95.33
1qcs_A 211 N-ethylmaleimide sensitive factor (NSF-N); double- 95.28
3plx_B102 Aspartate 1-decarboxylase; structural genomics, ce 95.07
1pqh_A143 Aspartate 1-decarboxylase; pyruvoyl dependent deca 95.06
1eu1_A780 Dimethyl sulfoxide reductase; molybdenum, molybden 95.04
1tmo_A829 TMAO reductase, trimethylamine N-oxide reductase; 94.97
2vpz_A765 Thiosulfate reductase; oxidoreductase, molybdopter 94.96
2e7z_A727 Acetylene hydratase AHY; tungstoprotein, DMSO redu 94.9
3i9v_3783 NADH-quinone oxidoreductase subunit 3; electron tr 94.78
1g8k_A825 Arsenite oxidase; molybdopterin, [3Fe-4S] cluster, 94.75
2iv2_X715 Formate dehydrogenase H; oxidoreductase, 4Fe-4S, a 94.52
2c45_A139 Aspartate 1-decarboxylase precursor; double-PSI be 94.47
2nap_A723 Protein (periplasmic nitrate reductase); nitrogeno 94.32
1ti6_A875 Pyrogallol hydroxytransferase large subunit; molyb 94.02
4aay_A845 AROA; oxidoreductase, rieske, iron sulfur, molybdo 93.96
1uhe_A97 Aspartate 1-decarboxylase alpha chain; double-PSI 93.89
1yfb_A59 Transition state regulatory protein ABRB; , homodi 93.82
2glw_A92 PHS018, 92AA long hypothetical protein; RIFT barre 93.62
2ivf_A976 Ethylbenzene dehydrogenase alpha-subunit; anaerobi 93.52
3ml1_A802 NAPA, periplasmic nitrate reductase; heterodimer, 93.38
1yfb_A59 Transition state regulatory protein ABRB; , homodi 92.74
1q16_A1247 Respiratory nitrate reductase 1 alpha chain; membr 91.5
2l66_A53 SSO7C4, transcriptional regulator, ABRB family; DN 91.39
1kqf_A1015 FDH-N alpha, formate dehydrogenase, nitrate-induci 91.39
1h0h_A977 Formate dehydrogenase (large subunit); tungsten se 91.27
1zc1_A208 Ubiquitin fusion degradation protein 1; UFD1, doub 90.94
2yuj_A190 Ubiquitin fusion degradation 1-like; ubiquitin-dep 90.77
2d9r_A104 Conserved hypothetical protein; MCSG, structural g 90.46
3i4o_A79 Translation initiation factor IF-1; cytoplasm, pro 88.24
1mvf_D82 MAZE protein, PEMI-like protein 1; plasmid addicti 87.91
1mvf_D82 MAZE protein, PEMI-like protein 1; plasmid addicti 85.24
2l66_A53 SSO7C4, transcriptional regulator, ABRB family; DN 83.96
3idw_A72 Actin cytoskeleton-regulatory complex protein SLA; 82.39
1a62_A130 RHO; transcription termination, termination, RNA b 80.25
>3qwz_A Transitional endoplasmic reticulum ATPase; UBX, P97 binding, transport protein; HET: MLY; 2.00A {Homo sapiens} PDB: 2pjh_B Back     alignment and structure
Probab=99.97  E-value=6.8e-31  Score=195.75  Aligned_cols=93  Identities=71%  Similarity=1.191  Sum_probs=89.4

Q ss_pred             eEEEecCHHHHhhCCCCCCCEEEEEeccCCcEEEEeccCCCCCCCeEEEeHhhhhcccccCCCeEEEEeCCCCCCccEEE
Q psy3865          15 RGKRRKESAKMDELNLFRGDTVLLRGKRRKESVCIVLSDDTCPDEKIRMNRVMRNNLRVRLSDVVSLVPCPGIVYGKRIH   94 (107)
Q Consensus        15 rGiari~~~~m~~Lgl~~GD~V~I~Gkr~~~tvai~~~~~d~~~~~Irid~~~R~N~~v~igD~V~V~~~~~~~~a~~V~   94 (107)
                      ||+|||||+.|++||+++||+|+|+|+|++.|+|++|++++++.+.||||+.+|+|||+++||.|+|+++.++++|++|+
T Consensus        39 rgivrl~p~~m~~Lgl~~GD~V~I~Gkr~k~Tva~v~~~~~~~~g~Irid~~~R~N~gV~iGD~V~V~~~~~v~~A~~V~  118 (211)
T 3qwz_A           39 NSVVSLSQPKMDELQLFRGDTVLLKGXKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIH  118 (211)
T ss_dssp             TTEEEECHHHHHHHTCCBTCEEEEECSTTCEEEEEEEECTTSCTTEEEECHHHHHHTTCCTTCEEEEEECTTCCBCSEEE
T ss_pred             CcEEEECHHHHHHcCCCCCCEEEEeCCCCCcEEEEEEeCCCCCCCEEEeCHHHHhhcCCCCCCEEEEEECCCCCCceEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999986899999999


Q ss_pred             EccCCccccCCCC
Q psy3865          95 VLPIDDSVQGLTG  107 (107)
Q Consensus        95 l~P~~dti~~~~g  107 (107)
                      |+|+++++++++|
T Consensus       119 LaP~~~~i~~i~~  131 (211)
T 3qwz_A          119 VLPIDDTVEGITG  131 (211)
T ss_dssp             EEEBGGGCTTCCS
T ss_pred             EeccCcchhccCc
Confidence            9999999887654
>3tiw_A Transitional endoplasmic reticulum ATPase; beta-barrel alpha-helix, transport protein ATPase ubiquitin ubiquitin, phosphorylation; 1.80A {Homo sapiens} PDB: 3qq8_A 3qq7_A 3qc8_A Back     alignment and structure
>1cz4_A VCP-like ATPase; double-PSI beta-barrel, beta-CLAM, substrate recognition DOM hydrolase; NMR {Thermoplasma acidophilum} SCOP: b.52.2.3 d.31.1.1 PDB: 1cz5_A Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1wlf_A PEX1, peroxisome biogenesis factor 1; N-terminal domain, protein transport; 2.05A {Mus musculus} SCOP: b.52.2.3 d.31.1.1 Back     alignment and structure
>3tiw_A Transitional endoplasmic reticulum ATPase; beta-barrel alpha-helix, transport protein ATPase ubiquitin ubiquitin, phosphorylation; 1.80A {Homo sapiens} PDB: 3qq8_A 3qq7_A 3qc8_A Back     alignment and structure
>3qwz_A Transitional endoplasmic reticulum ATPase; UBX, P97 binding, transport protein; HET: MLY; 2.00A {Homo sapiens} PDB: 2pjh_B Back     alignment and structure
>1cz4_A VCP-like ATPase; double-PSI beta-barrel, beta-CLAM, substrate recognition DOM hydrolase; NMR {Thermoplasma acidophilum} SCOP: b.52.2.3 d.31.1.1 PDB: 1cz5_A Back     alignment and structure
>2glw_A PHS018, 92AA long hypothetical protein; RIFT barrel, bioinformatics, transcription; NMR {Pyrococcus horikoshii} Back     alignment and structure
>2ki8_A Tungsten formylmethanofuran dehydrogenase, subunit D (FWDD-2); beta-barrel, structural genomics, PSI-2, protein structure initiative; NMR {Archaeoglobus fulgidus} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1wlf_A PEX1, peroxisome biogenesis factor 1; N-terminal domain, protein transport; 2.05A {Mus musculus} SCOP: b.52.2.3 d.31.1.1 Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2yuj_A Ubiquitin fusion degradation 1-like; ubiquitin-dependent proteolytic, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1cr5_A SEC18P (residues 22 - 210); double-PSI beta barrel, vesicle fusion, endocytosis/exocytosis complex; 2.30A {Saccharomyces cerevisiae} SCOP: b.52.2.3 d.31.1.1 Back     alignment and structure
>1zc1_A Ubiquitin fusion degradation protein 1; UFD1, double-PSI-beta-barrel, protein turnover; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3oug_A Aspartate 1-decarboxylase; structural genomics, center for structural genomics of infec diseases, csgid, double-PSI beta barrel; HET: MSE; 1.55A {Francisella tularensis subsp} SCOP: b.52.2.0 Back     alignment and structure
>1vc3_B L-aspartate-alpha-decarboxylase heavy chain; tetramer, pyruvoyl group, riken structural genomics/proteomi initiative, RSGI; 1.50A {Thermus thermophilus} PDB: 2eeo_B Back     alignment and structure
>1qcs_A N-ethylmaleimide sensitive factor (NSF-N); double-PSI beta barrel alpha beta roll, fusion protein; 1.90A {Cricetulus griseus} SCOP: b.52.2.3 d.31.1.1 PDB: 1qdn_A Back     alignment and structure
>3plx_B Aspartate 1-decarboxylase; structural genomics, center for structural genomics of infec diseases, csgid, double-PSI beta-barrel; 1.75A {Campylobacter jejuni subsp} Back     alignment and structure
>1pqh_A Aspartate 1-decarboxylase; pyruvoyl dependent decarboxylase, protein SELF-processing; 1.29A {Escherichia coli} SCOP: b.52.2.1 PDB: 1pqf_A 1pt1_A 1pt0_A 1pyq_A 1ppy_A 1pqe_A 1pyu_B 3tm7_B 1aw8_B 1pyu_A 3tm7_A 1aw8_A Back     alignment and structure
>1eu1_A Dimethyl sulfoxide reductase; molybdenum, molybdenum cofactor, DMSO, molybdopte oxidoreductase; HET: GLC MGD EPE; 1.30A {Rhodobacter sphaeroides} SCOP: b.52.2.2 c.81.1.1 PDB: 4dmr_A* 1dmr_A* 1e5v_A* 1h5n_A* 2dmr_A* 3dmr_A* 1e61_A* 1e60_A* 1e18_A* 1dms_A* Back     alignment and structure
>1tmo_A TMAO reductase, trimethylamine N-oxide reductase; oxidoreductase, oxotransferase, molybdoenzyme, MO-cofactor, molybdenum; HET: 2MD; 2.50A {Shewanella massilia} SCOP: b.52.2.2 c.81.1.1 Back     alignment and structure
>2vpz_A Thiosulfate reductase; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_A* 2vpw_A* 2vpy_A* Back     alignment and structure
>2e7z_A Acetylene hydratase AHY; tungstoprotein, DMSO reductase family, iron-sulfur-cluster, lyase; HET: MGD; 1.26A {Pelobacter acetylenicus} Back     alignment and structure
>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* Back     alignment and structure
>1g8k_A Arsenite oxidase; molybdopterin, [3Fe-4S] cluster, [2Fe-2S] rieske, oxidoreductase; HET: MGD; 1.64A {Alcaligenes faecalis} SCOP: b.52.2.2 c.81.1.1 PDB: 1g8j_A* Back     alignment and structure
>2iv2_X Formate dehydrogenase H; oxidoreductase, 4Fe-4S, anaerobic, complete proteome, direct protein sequencing, Fe4S4, iron, iron sulfur cluster; HET: 2MD MGD; 2.27A {Escherichia coli} SCOP: b.52.2.2 c.81.1.1 PDB: 1fdi_A* 1fdo_A* 1aa6_A* Back     alignment and structure
>2c45_A Aspartate 1-decarboxylase precursor; double-PSI beta barrel, lyase, zymogen, pantothenate biosynthesis, pyruvate; 2.99A {Mycobacterium tuberculosis} Back     alignment and structure
>2nap_A Protein (periplasmic nitrate reductase); nitrogenous acceptor, dissimilatory nitrate reductase; HET: MGD MES; 1.90A {Desulfovibrio desulfuricans} SCOP: b.52.2.2 c.81.1.1 PDB: 2jim_A* 2jir_A* 2jip_A* 2v45_A* 2v3v_A* 2jiq_A* 2jio_A* Back     alignment and structure
>1ti6_A Pyrogallol hydroxytransferase large subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.52.2.2 c.81.1.1 PDB: 1ti2_A* 1ti4_A* 1vld_M* 1vle_M* 1vlf_M* Back     alignment and structure
>4aay_A AROA; oxidoreductase, rieske, iron sulfur, molybdopterin; HET: MGD; 2.70A {Rhizobium species} Back     alignment and structure
>1uhe_A Aspartate 1-decarboxylase alpha chain; double-PSI beta barrel, lyase; HET: NSN; 1.55A {Helicobacter pylori} SCOP: b.52.2.1 PDB: 1uhd_A Back     alignment and structure
>1yfb_A Transition state regulatory protein ABRB; , homodimer, bioinformatics, swapped-hairpin barrel, transcription; NMR {Bacillus subtilis} SCOP: b.129.1.3 PDB: 1ysf_A 2k1n_A* 1z0r_A 2ro4_A 2fy9_A 2ro3_A Back     alignment and structure
>2glw_A PHS018, 92AA long hypothetical protein; RIFT barrel, bioinformatics, transcription; NMR {Pyrococcus horikoshii} Back     alignment and structure
>2ivf_A Ethylbenzene dehydrogenase alpha-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum} Back     alignment and structure
>3ml1_A NAPA, periplasmic nitrate reductase; heterodimer, oxidoreductase; HET: MGD HEC; 1.60A {Ralstonia eutropha} PDB: 3o5a_A* 1ogy_A* 2nya_A* Back     alignment and structure
>1yfb_A Transition state regulatory protein ABRB; , homodimer, bioinformatics, swapped-hairpin barrel, transcription; NMR {Bacillus subtilis} SCOP: b.129.1.3 PDB: 1ysf_A 2k1n_A* 1z0r_A 2ro4_A 2fy9_A 2ro3_A Back     alignment and structure
>1q16_A Respiratory nitrate reductase 1 alpha chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: b.52.2.2 c.81.1.1 PDB: 3ir7_A* 1y5i_A* 1siw_A* 1y4z_A* 1r27_A* 1y5l_A* 1y5n_A* 3ir6_A* 3ir5_A* 3egw_A* Back     alignment and structure
>2l66_A SSO7C4, transcriptional regulator, ABRB family; DNA binding protein, transcription regulator; NMR {Sulfolobus solfataricus} Back     alignment and structure
>1kqf_A FDH-N alpha, formate dehydrogenase, nitrate-inducible, major S; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: b.52.2.2 c.81.1.1 PDB: 1kqg_A* Back     alignment and structure
>1h0h_A Formate dehydrogenase (large subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: b.52.2.2 c.81.1.1 Back     alignment and structure
>1zc1_A Ubiquitin fusion degradation protein 1; UFD1, double-PSI-beta-barrel, protein turnover; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2yuj_A Ubiquitin fusion degradation 1-like; ubiquitin-dependent proteolytic, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9r_A Conserved hypothetical protein; MCSG, structural genomics, hypothe protein, PSI, protein structure initiative; 2.01A {Porphyromonas gingivalis} SCOP: b.129.2.1 Back     alignment and structure
>3i4o_A Translation initiation factor IF-1; cytoplasm, protein biosynthesis; 1.47A {Mycobacterium tuberculosis} SCOP: b.40.4.5 Back     alignment and structure
>1mvf_D MAZE protein, PEMI-like protein 1; plasmid addiction, camel antibody, addiction antidote, immun; 1.65A {Escherichia coli} SCOP: b.129.1.1 PDB: 1ub4_C Back     alignment and structure
>1mvf_D MAZE protein, PEMI-like protein 1; plasmid addiction, camel antibody, addiction antidote, immun; 1.65A {Escherichia coli} SCOP: b.129.1.1 PDB: 1ub4_C Back     alignment and structure
>2l66_A SSO7C4, transcriptional regulator, ABRB family; DNA binding protein, transcription regulator; NMR {Sulfolobus solfataricus} Back     alignment and structure
>3idw_A Actin cytoskeleton-regulatory complex protein SLA; clathrin adaptor, endocytosis, SAM domain, yeast, actin-BIND membrane, endosome; 1.85A {Saccharomyces cerevisiae} Back     alignment and structure
>1a62_A RHO; transcription termination, termination, RNA binding domain, transcription regulation, OB fold, F1-ATPase; 1.55A {Escherichia coli BL21} SCOP: a.140.3.1 b.40.4.5 PDB: 1a63_A 2a8v_A 1a8v_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 107
d1e32a186 b.52.2.3 (A:21-106) Membrane fusion ATPase p97 N-t 9e-24
d1cz5a191 b.52.2.3 (A:1-91) N-terminal domain of VAT-N, VAT- 4e-16
d1e32a394 d.31.1.1 (A:107-200) Membrane fusion atpase p97 do 1e-05
>d1e32a1 b.52.2.3 (A:21-106) Membrane fusion ATPase p97 N-terminal domain , P97-Nn {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure

class: All beta proteins
fold: Double psi beta-barrel
superfamily: ADC-like
family: Cdc48 N-terminal domain-like
domain: Membrane fusion ATPase p97 N-terminal domain , P97-Nn
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 84.8 bits (210), Expect = 9e-24
 Identities = 51/71 (71%), Positives = 58/71 (81%)

Query: 15 RGKRRKESAKMDELNLFRGDTVLLRGKRRKESVCIVLSDDTCPDEKIRMNRVMRNNLRVR 74
                   KMDEL LFRGDTVLL+GK+R+E+VCIVLSDDTC DEKIRMNRV+RNNLRVR
Sbjct: 16 NSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVR 75

Query: 75 LSDVVSLVPCP 85
          L DV+S+ PCP
Sbjct: 76 LGDVISIQPCP 86
>d1cz5a1 b.52.2.3 (A:1-91) N-terminal domain of VAT-N, VAT-Nn {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 91 Back     information, alignment and structure
>d1e32a3 d.31.1.1 (A:107-200) Membrane fusion atpase p97 domain 2, P97-Nc {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query107
d1e32a186 Membrane fusion ATPase p97 N-terminal domain , P97 99.95
d1cz5a191 N-terminal domain of VAT-N, VAT-Nn {Archaeon Therm 99.92
d1e32a186 Membrane fusion ATPase p97 N-terminal domain , P97 98.42
d1cz5a191 N-terminal domain of VAT-N, VAT-Nn {Archaeon Therm 98.09
d1ogya1120 Periplasmic nitrate reductase alpha chain, NapA {R 97.45
d1g8ka1143 Arsenite oxidase large subunit {Alcaligenes faecal 97.34
d2jioa1123 Periplasmic nitrate reductase alpha chain, NapA {D 97.33
d2fug3182 NADH-quinone oxidoreductase chain 3, Nqo3, C-termi 97.22
d2iv2x1151 Formate dehydrogenase H {Escherichia coli [TaxId: 97.1
d1vlfm1147 Transhydroxylase alpha subunit, AthL {Pelobacter a 97.08
d1eu1a1155 Dimethylsulfoxide reductase (DMSO reductase) {Rhod 97.03
d1tmoa1167 Trimethylamine N-oxide reductase {Shewanella massi 96.82
d1cr5a182 N-terminal domain of NSF-N, NSF-Nn {Baker's yeast 96.82
d1kqfa1165 Formate dehydrogenase N, alpha subunit {Escherichi 96.78
d1qcsa186 N-terminal domain of NSF-N, NSF-Nn {Hamster (Crice 96.73
d1y5ia1170 Respiratory nitrate reductase 1 alpha chain {Esche 96.63
d1h0ha1165 Tungsten containing formate dehydrogenase, large s 96.15
d1ppya_118 Pyruvoyl dependent aspartate decarboxylase, ADC {E 93.69
g1uhe.1121 Pyruvoyl dependent aspartate decarboxylase, ADC {H 92.9
d1mvfd_44 MazE {Escherichia coli [TaxId: 562]} 91.55
d2d6fa172 Glutamyl-tRNA(Gln) amidotransferase subunit D, Gat 90.8
d2d9ra185 Hypothetical protein PG0164 {Porphyromonas gingiva 88.95
d1zq1a174 Glutamyl-tRNA(Gln) amidotransferase subunit D, Gat 88.29
d1hr0w_71 Translational initiation factor 1, IF1 {Escherichi 87.56
d1wlfa287 Peroxisome biogenesis factor 1 (PEX-1), N-terminal 85.42
d1ah9a_71 Translational initiation factor 1, IF1 {Escherichi 83.48
d1a62a278 Rho termination factor, RNA-binding domain {Escher 82.67
d1umua_105 UmuD' {Escherichia coli [TaxId: 562]} 82.48
d1guta_67 Molybdate/tungstate binding protein MOP {Clostridi 80.89
>d1e32a1 b.52.2.3 (A:21-106) Membrane fusion ATPase p97 N-terminal domain , P97-Nn {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: Double psi beta-barrel
superfamily: ADC-like
family: Cdc48 N-terminal domain-like
domain: Membrane fusion ATPase p97 N-terminal domain , P97-Nn
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.95  E-value=6.5e-28  Score=156.26  Aligned_cols=70  Identities=71%  Similarity=1.150  Sum_probs=68.6

Q ss_pred             eEEEecCHHHHhhCCCCCCCEEEEEeccCCcEEEEeccCCCCCCCeEEEeHhhhhcccccCCCeEEEEeC
Q psy3865          15 RGKRRKESAKMDELNLFRGDTVLLRGKRRKESVCIVLSDDTCPDEKIRMNRVMRNNLRVRLSDVVSLVPC   84 (107)
Q Consensus        15 rGiari~~~~m~~Lgl~~GD~V~I~Gkr~~~tvai~~~~~d~~~~~Irid~~~R~N~~v~igD~V~V~~~   84 (107)
                      +|+|||||++|++||+++||+|+|+|+|++.|+|++|+.++++.++||||+.+|+|||+++||.|+|++|
T Consensus        16 ~~iarl~p~~m~~Lgl~~GD~V~I~Gkr~t~av~~~~~~~d~~~g~Irid~~~R~Nagv~iGD~V~V~p~   85 (86)
T d1e32a1          16 NSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPC   85 (86)
T ss_dssp             TTEEEECHHHHHHTTCCTTCEEEEECSTTCEEEEEEEECTTSCSSEEEECHHHHHHTTCCTTCEEEEEEC
T ss_pred             CCEEEECHHHHHHcCCCCCCEEEEEcCCceeEEEEEeccCCCCCCEEEecHHHHhhcCcCCCCEEEEEeC
Confidence            7999999999999999999999999999999999999999999999999999999999999999999997
>d1cz5a1 b.52.2.3 (A:1-91) N-terminal domain of VAT-N, VAT-Nn {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1e32a1 b.52.2.3 (A:21-106) Membrane fusion ATPase p97 N-terminal domain , P97-Nn {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cz5a1 b.52.2.3 (A:1-91) N-terminal domain of VAT-N, VAT-Nn {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ogya1 b.52.2.2 (A:682-801) Periplasmic nitrate reductase alpha chain, NapA {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1g8ka1 b.52.2.2 (A:683-825) Arsenite oxidase large subunit {Alcaligenes faecalis [TaxId: 511]} Back     information, alignment and structure
>d2jioa1 b.52.2.2 (A:601-723) Periplasmic nitrate reductase alpha chain, NapA {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d2fug31 b.52.2.2 (3:686-767) NADH-quinone oxidoreductase chain 3, Nqo3, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2iv2x1 b.52.2.2 (X:565-715) Formate dehydrogenase H {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlfm1 b.52.2.2 (M:729-875) Transhydroxylase alpha subunit, AthL {Pelobacter acidigallici [TaxId: 35816]} Back     information, alignment and structure
>d1eu1a1 b.52.2.2 (A:626-780) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1tmoa1 b.52.2.2 (A:632-798) Trimethylamine N-oxide reductase {Shewanella massilia [TaxId: 76854]} Back     information, alignment and structure
>d1cr5a1 b.52.2.3 (A:26-107) N-terminal domain of NSF-N, NSF-Nn {Baker's yeast (Saccharomyces cerevisiae), sec18p [TaxId: 4932]} Back     information, alignment and structure
>d1kqfa1 b.52.2.2 (A:851-1015) Formate dehydrogenase N, alpha subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qcsa1 b.52.2.3 (A:0-85) N-terminal domain of NSF-N, NSF-Nn {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1y5ia1 b.52.2.2 (A:1075-1244) Respiratory nitrate reductase 1 alpha chain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h0ha1 b.52.2.2 (A:813-977) Tungsten containing formate dehydrogenase, large subunit {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1ppya_ b.52.2.1 (A:) Pyruvoyl dependent aspartate decarboxylase, ADC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mvfd_ b.129.1.1 (D:) MazE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d6fa1 b.38.3.1 (A:2-73) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2d9ra1 b.129.2.1 (A:20-104) Hypothetical protein PG0164 {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1zq1a1 b.38.3.1 (A:2-75) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1hr0w_ b.40.4.5 (W:) Translational initiation factor 1, IF1 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wlfa2 b.52.2.3 (A:13-99) Peroxisome biogenesis factor 1 (PEX-1), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ah9a_ b.40.4.5 (A:) Translational initiation factor 1, IF1 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a62a2 b.40.4.5 (A:48-125) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1umua_ b.87.1.1 (A:) UmuD' {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1guta_ b.40.6.1 (A:) Molybdate/tungstate binding protein MOP {Clostridium pasteurianum, MOP II [TaxId: 1501]} Back     information, alignment and structure