Psyllid ID: psy388


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90----
MQYYSLLSKDTPMSPIEKSIWWIEYVLRHKGVAHLHSAAADLSYVQYYLLDVIAFIITILLVLLLALYLATVRVLRKLNVIRLESEKDIKKKIK
cHHHHHHHcccccccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcc
cccHcHcccccccccHHHHHHHHHHHHHHcccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccc
mqyysllskdtpmspiekSIWWIEYVLRHKGVAHLHSAAADLSYVQYYLLDVIAFIITILLVLLLALYLATVRVLRKLNVIRLESEKDIKKKIK
mqyysllskdtpmspieKSIWWIEYVLRHKGVAHLHSAAADLSYVQYYLLDVIAFIITILLVLLLALYLATVRVLRKlnvirlesekdikkkik
MQYYSLLSKDTPMSPIEKSIWWIEYVLRHKGVAHLHSAAADLSYVQYYLLDviafiitillvlllalylatvrvlrKLNVIRLESEKDIKKKIK
***************IEKSIWWIEYVLRHKGVAHLHSAAADLSYVQYYLLDVIAFIITILLVLLLALYLATVRVLRKLNVIRL***********
**YYSLLSKDTPMSPIEKSIWWIEYVLRHKGVAHLHSAAADLSYVQYYLLDVIAFIITILLVLLLALYLATVRVLR******************
MQYYSLLSKDTPMSPIEKSIWWIEYVLRHKGVAHLHSAAADLSYVQYYLLDVIAFIITILLVLLLALYLATVRVLRKLNVIRLESEKDIKKKIK
*QYYSLLSKDTPMSPIEKSIWWIEYVLRHKGVAHLHSAAADLSYVQYYLLDVIAFIITILLVLLLALYLATVRVLRKLNVI*************
ooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQYYSLLSKDTPMSPIEKSIWWIEYVLRHKGVAHLHSAAADLSYVQYYLLDVIAFIITILLVLLLALYLATVRVLRKLNVIRLESEKDIKKKIK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query94 2.2.26 [Sep-21-2011]
Q64633531 UDP-glucuronosyltransfera yes N/A 0.776 0.137 0.438 9e-14
Q64634530 UDP-glucuronosyltransfera no N/A 0.776 0.137 0.438 1e-13
P20720533 UDP-glucuronosyltransfera no N/A 0.776 0.136 0.438 2e-13
Q64550535 UDP-glucuronosyltransfera no N/A 0.776 0.136 0.438 2e-13
Q64637531 UDP-glucuronosyltransfera no N/A 0.776 0.137 0.438 2e-13
P08430529 UDP-glucuronosyltransfera no N/A 0.776 0.137 0.438 2e-13
Q64638531 UDP-glucuronosyltransfera no N/A 0.776 0.137 0.438 2e-13
Q6ZQM8531 UDP-glucuronosyltransfera yes N/A 0.680 0.120 0.453 4e-13
Q63886535 UDP-glucuronosyltransfera no N/A 0.680 0.119 0.453 6e-13
P36513530 UDP-glucuronosyltransfera yes N/A 0.893 0.158 0.380 9e-13
>sp|Q64633|UD17_RAT UDP-glucuronosyltransferase 1-7 OS=Rattus norvegicus GN=Ugt1a7c PE=2 SV=1 Back     alignment and function desciption
 Score = 75.5 bits (184), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 50/73 (68%)

Query: 5   SLLSKDTPMSPIEKSIWWIEYVLRHKGVAHLHSAAADLSYVQYYLLDVIAFIITILLVLL 64
           S L KD P+ P++ +++W+EYV+RHKG  HL  AA DL++ QY+ LDVI F++ I+L ++
Sbjct: 442 SSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVV 501

Query: 65  LALYLATVRVLRK 77
             +Y +     RK
Sbjct: 502 FIVYKSCAYGCRK 514




UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.
Rattus norvegicus (taxid: 10116)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 1EC: 7
>sp|Q64634|UD18_RAT UDP-glucuronosyltransferase 1-8 OS=Rattus norvegicus GN=Ugt1a8 PE=2 SV=1 Back     alignment and function description
>sp|P20720|UD12_RAT UDP-glucuronosyltransferase 1-2 OS=Rattus norvegicus GN=Ugt1a2 PE=2 SV=2 Back     alignment and function description
>sp|Q64550|UD11_RAT UDP-glucuronosyltransferase 1-1 OS=Rattus norvegicus GN=Ugt1a1 PE=1 SV=1 Back     alignment and function description
>sp|Q64637|UD13_RAT UDP-glucuronosyltransferase 1-3 OS=Rattus norvegicus GN=Ugt1a3 PE=2 SV=1 Back     alignment and function description
>sp|P08430|UD16_RAT UDP-glucuronosyltransferase 1-6 OS=Rattus norvegicus GN=Ugt1a6 PE=2 SV=1 Back     alignment and function description
>sp|Q64638|UD15_RAT UDP-glucuronosyltransferase 1-5 OS=Rattus norvegicus GN=Ugt1a5 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZQM8|UD17C_MOUSE UDP-glucuronosyltransferase 1-7C OS=Mus musculus GN=Ugt1a7c PE=2 SV=1 Back     alignment and function description
>sp|Q63886|UD11_MOUSE UDP-glucuronosyltransferase 1-1 OS=Mus musculus GN=Ugt1a1 PE=2 SV=2 Back     alignment and function description
>sp|P36513|UDB14_RABIT UDP-glucuronosyltransferase 2B14 OS=Oryctolagus cuniculus GN=UGT2B14 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query94
328698878 518 PREDICTED: UDP-glucuronosyltransferase 1 0.712 0.129 0.522 3e-13
260789750 499 hypothetical protein BRAFLDRAFT_114677 [ 0.787 0.148 0.418 3e-13
260797576 525 hypothetical protein BRAFLDRAFT_104350 [ 0.797 0.142 0.413 1e-12
260799421 436 hypothetical protein BRAFLDRAFT_116017 [ 0.712 0.153 0.462 1e-12
260800921 466 hypothetical protein BRAFLDRAFT_59784 [B 0.787 0.158 0.445 1e-12
260818180 488 hypothetical protein BRAFLDRAFT_59893 [B 0.787 0.151 0.405 1e-12
195389528 524 GJ23874 [Drosophila virilis] gi|19415151 0.946 0.169 0.393 2e-12
260800897 502 hypothetical protein BRAFLDRAFT_87570 [B 0.787 0.147 0.445 2e-12
66771617 530 IP12319p [Drosophila melanogaster] 0.819 0.145 0.461 2e-12
260800899 216 hypothetical protein BRAFLDRAFT_87571 [B 0.829 0.361 0.423 2e-12
>gi|328698878|ref|XP_001944276.2| PREDICTED: UDP-glucuronosyltransferase 1-7-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 79.3 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 48/67 (71%)

Query: 10  DTPMSPIEKSIWWIEYVLRHKGVAHLHSAAADLSYVQYYLLDVIAFIITILLVLLLALYL 69
           D PMS +  +++W+EYV+R+KG  HL SAA DL++ QYYLLDVIAF+I I L  +   Y 
Sbjct: 442 DRPMSALNTAVYWVEYVIRNKGAHHLRSAAVDLTWYQYYLLDVIAFLIIISLFFICIFYF 501

Query: 70  ATVRVLR 76
            T R++R
Sbjct: 502 ITKRIMR 508




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|260789750|ref|XP_002589908.1| hypothetical protein BRAFLDRAFT_114677 [Branchiostoma floridae] gi|229275093|gb|EEN45919.1| hypothetical protein BRAFLDRAFT_114677 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|260797576|ref|XP_002593778.1| hypothetical protein BRAFLDRAFT_104350 [Branchiostoma floridae] gi|229279007|gb|EEN49789.1| hypothetical protein BRAFLDRAFT_104350 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|260799421|ref|XP_002594695.1| hypothetical protein BRAFLDRAFT_116017 [Branchiostoma floridae] gi|229279931|gb|EEN50706.1| hypothetical protein BRAFLDRAFT_116017 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|260800921|ref|XP_002595345.1| hypothetical protein BRAFLDRAFT_59784 [Branchiostoma floridae] gi|229280590|gb|EEN51357.1| hypothetical protein BRAFLDRAFT_59784 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|260818180|ref|XP_002604261.1| hypothetical protein BRAFLDRAFT_59893 [Branchiostoma floridae] gi|229289587|gb|EEN60272.1| hypothetical protein BRAFLDRAFT_59893 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|195389528|ref|XP_002053428.1| GJ23874 [Drosophila virilis] gi|194151514|gb|EDW66948.1| GJ23874 [Drosophila virilis] Back     alignment and taxonomy information
>gi|260800897|ref|XP_002595333.1| hypothetical protein BRAFLDRAFT_87570 [Branchiostoma floridae] gi|229280578|gb|EEN51345.1| hypothetical protein BRAFLDRAFT_87570 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|66771617|gb|AAY55120.1| IP12319p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|260800899|ref|XP_002595334.1| hypothetical protein BRAFLDRAFT_87571 [Branchiostoma floridae] gi|229280579|gb|EEN51346.1| hypothetical protein BRAFLDRAFT_87571 [Branchiostoma floridae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query94
UNIPROTKB|F5GY78238 UGT2A3 "UDP-glucuronosyltransf 0.5 0.197 0.468 2e-09
UNIPROTKB|E1BAR9528 UGT2B4 "Uncharacterized protei 0.542 0.096 0.450 2.5e-09
UNIPROTKB|I3LTQ3110 LOC100624891 "Uncharacterized 0.5 0.427 0.468 2.9e-09
FB|FBgn0051002521 CG31002 [Drosophila melanogast 0.457 0.082 0.558 3.1e-09
UNIPROTKB|I3LJX5174 UGT8 "Uncharacterized protein" 0.531 0.287 0.44 4.7e-09
MGI|MGI:3576092528 Ugt1a9 "UDP glucuronosyltransf 0.5 0.089 0.510 5.2e-09
RGD|620949529 Ugt1a6 "UDP glucuronosyltransf 0.5 0.088 0.510 5.2e-09
FB|FBgn0034605530 CG15661 [Drosophila melanogast 0.542 0.096 0.450 5.2e-09
RGD|708474530 Ugt1a8 "UDP glycosyltransferas 0.5 0.088 0.510 5.2e-09
UNIPROTKB|Q6T5E7530 Ugt1a8 "UDP glycosyltransferas 0.5 0.088 0.510 5.2e-09
UNIPROTKB|F5GY78 UGT2A3 "UDP-glucuronosyltransferase 2A3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 139 (54.0 bits), Expect = 2.0e-09, P = 2.0e-09
 Identities = 22/47 (46%), Positives = 36/47 (76%)

Query:     5 SLLSKDTPMSPIEKSIWWIEYVLRHKGVAHLHSAAADLSYVQYYLLD 51
             S +  D P+ P++++++WIE+V+RHKG  HL SAA DL++ Q+Y +D
Sbjct:   155 SRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRSAAHDLTWFQHYSID 201




GO:0016758 "transferase activity, transferring hexosyl groups" evidence=IEA
UNIPROTKB|E1BAR9 UGT2B4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LTQ3 LOC100624891 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0051002 CG31002 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|I3LJX5 UGT8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:3576092 Ugt1a9 "UDP glucuronosyltransferase 1 family, polypeptide A9" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620949 Ugt1a6 "UDP glucuronosyltransferase 1 family, polypeptide A6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0034605 CG15661 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|708474 Ugt1a8 "UDP glycosyltransferase 1 family, polypeptide A8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6T5E7 Ugt1a8 "UDP glycosyltransferase 1 family polypeptide A9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query94
pfam00201500 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosy 2e-15
PHA03392507 PHA03392, egt, ecdysteroid UDP-glucosyltransferase 2e-08
>gnl|CDD|201077 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosyl transferase Back     alignment and domain information
 Score = 69.4 bits (170), Expect = 2e-15
 Identities = 25/58 (43%), Positives = 41/58 (70%)

Query: 5   SLLSKDTPMSPIEKSIWWIEYVLRHKGVAHLHSAAADLSYVQYYLLDVIAFIITILLV 62
           S +  D P+ P++++++WIE+V+RHKG  HL  AA DL++ QY+ LDVI F++  +  
Sbjct: 420 SSIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRPAAHDLTWYQYHSLDVIGFLLACVAT 477


Length = 500

>gnl|CDD|223071 PHA03392, egt, ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 94
PF00201500 UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera 99.91
PHA03392507 egt ecdysteroid UDP-glucosyltransferase; Provision 99.73
KOG1192|consensus496 99.08
PF05478 806 Prominin: Prominin; InterPro: IPR008795 The promin 85.53
>PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule Back     alignment and domain information
Probab=99.91  E-value=7.5e-26  Score=173.29  Aligned_cols=81  Identities=47%  Similarity=0.840  Sum_probs=8.1

Q ss_pred             ChhhhHHhhcCCCCHHHHHHHHHHHHHhcCCCccccccccCccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhh
Q psy388            1 MQYYSLLSKDTPMSPIEKSIWWIEYVLRHKGVAHLHSAAADLSYVQYYLLDVIAFIITILLVLLLALYLATVRVLRKLNV   80 (94)
Q Consensus         1 a~~ls~~~~drP~~P~d~av~wiE~vir~~g~~~l~~~~~~l~~~qy~~lDv~~~l~~~~~~~~~~~~~~~~~~~~~~~~   80 (94)
                      |+++|++++|||++|.|+|+||||||+||||++||++++.++||+|||+|||+++++++++++++++++++++++|++++
T Consensus       416 a~~ls~~~~~~p~~p~~~~~~~ie~v~~~~~~~~l~~~~~~l~~~~~~~lDv~~~~~~~~~~~~~~~~~~~~~~~~~~~~  495 (500)
T PF00201_consen  416 AKRLSSLFRDRPISPLERAVWWIEYVARHGGAPHLRSPARDLSFYQYYLLDVIAFLLLIILLIIYIIFKICRFVCRKCVK  495 (500)
T ss_dssp             HHHHHHTTT-----------------------------------------------------------------------
T ss_pred             HHHHHHHHhcCCCCHHHHHHHHHHHHHhcCCCcccCChhhcCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            57899999999999999999999999999999999999999999999999999998888888888888888888888876


Q ss_pred             h
Q psy388           81 I   81 (94)
Q Consensus        81 ~   81 (94)
                      .
T Consensus       496 ~  496 (500)
T PF00201_consen  496 K  496 (500)
T ss_dssp             -
T ss_pred             c
Confidence            5



This family currently consist of: Mammalian UDP-glucuronosyl transferases (2.4.1.17 from EC) (UDPGT) []. A large family of membrane-bound microsomal enzymes which catalyze the transfer of glucuronic acid to a wide variety of exogenous and endogenous lipophilic substrates. These enzymes are of major importance in the detoxification and subsequent elimination of xenobiotics such as drugs and carcinogens. A large number of putative UDPGT from Caenorhabditis elegans. Mammalian 2-hydroxyacylsphingosine 1-beta-galactosyltransferase [] (2.4.1.45 from EC) (also known as UDP-galactose-ceramide galactosyltransferase). This enzyme catalyzes the transfer of galactose to ceramide, a key enzymatic step in the biosynthesis of galactocerebrosides, which are abundant sphingolipids of the myelin membrane of the central nervous system and peripheral nervous system. Plants flavonol O(3)-glucosyltransferase (2.4.1.91 from EC). An enzyme [] that catalyzes the transfer of glucose from UDP-glucose to a flavanol. This reaction is essential and one of the last steps in anthocyanin pigment biosynthesis. Baculoviruses ecdysteroid UDP-glucosyltransferase (2.4.1 from EC) [] (egt). This enzyme catalyzes the transfer of glucose from UDP-glucose to ectysteroids which are insect molting hormones. The expression of egt in the insect host interferes with the normal insect development by blocking the molting process. Prokaryotic zeaxanthin glucosyltransferase (2.4.1 from EC) (gene crtX), an enzyme involved in carotenoid biosynthesis and that catalyses the glycosylation reaction which converts zeaxanthin to zeaxanthin-beta-diglucoside. Streptomyces macrolide glycosyltransferases (2.4.1 from EC) []. These enzymes specifically inactivates macrolide anitibiotics via 2'-O-glycosylation using UDP-glucose. These enzymes share a conserved domain of about 50 amino acid residues located in their C-terminal section.; GO: 0016758 transferase activity, transferring hexosyl groups, 0008152 metabolic process; PDB: 3HBJ_A 3HBF_A 2PQ6_A 3IA7_B 3RSC_A 3IAA_B 2IYA_A 2IYF_B 2O6L_A 2VCH_A ....

>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>KOG1192|consensus Back     alignment and domain information
>PF05478 Prominin: Prominin; InterPro: IPR008795 The prominins are an emerging family of proteins that, among the multispan membrane proteins, display a novel topology Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query94
1iir_A415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 80.06
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
Probab=80.06  E-value=0.72  Score=33.31  Aligned_cols=26  Identities=12%  Similarity=0.001  Sum_probs=17.0

Q ss_pred             CCCCHHHHHHHHHHHHHhcCCCcccc
Q psy388           11 TPMSPIEKSIWWIEYVLRHKGVAHLH   36 (94)
Q Consensus        11 rP~~P~d~av~wiE~vir~~g~~~l~   36 (94)
                      ++.++.+.+++|+|.+++++|++|+-
T Consensus       383 ~~~~~~~~~~~~i~~~~~~~~~~~~~  408 (415)
T 1iir_A          383 RTDGAAVAARLLLDAVSREKPTVSAL  408 (415)
T ss_dssp             CSCHHHHHHHHHHHHHHTC-------
T ss_pred             hhcChHHHHHHHHHHHHhcccHHHHh
Confidence            35788999999999999999998864




Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query94
d2c1xa1450 UDP glucose:flavonoid 3-o-glucosyltransferase {Gra 96.68
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: UDPGT-like
domain: UDP glucose:flavonoid 3-o-glucosyltransferase
species: Grape (Vitis vinifera) [TaxId: 29760]
Probab=96.68  E-value=0.00019  Score=50.05  Aligned_cols=24  Identities=25%  Similarity=0.394  Sum_probs=20.6

Q ss_pred             hhcCCCCH----HHHHHHHHHHHHhcCC
Q psy388            8 SKDTPMSP----IEKSIWWIEYVLRHKG   31 (94)
Q Consensus         8 ~~drP~~P----~d~av~wiE~vir~~g   31 (94)
                      ..+||++|    .+.|++|||||+||+.
T Consensus       422 ~~~~a~~~~gss~~~~~~~~e~v~r~~~  449 (450)
T d2c1xa1         422 TADRAVGPKGSSTENFITLVDLVSKPKD  449 (450)
T ss_dssp             HHHHHTSTTCHHHHHHHHHHHHHTSCCC
T ss_pred             HHHHhccCCCCHHHHHHHHHHHHhhhcC
Confidence            45688876    9999999999999975