UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. Rattus norvegicus (taxid: 10116) EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 1EC: 7
UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. Glucuronates opioids and bilirubin.
UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isoform has specificity for phenols.
Prominin: Prominin; InterPro: IPR008795 The promin
85.53
>PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule
Probab=99.91 E-value=7.5e-26 Score=173.29 Aligned_cols=81 Identities=47% Similarity=0.840 Sum_probs=8.1
Q ss_pred ChhhhHHhhcCCCCHHHHHHHHHHHHHhcCCCccccccccCccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhh
Q psy388 1 MQYYSLLSKDTPMSPIEKSIWWIEYVLRHKGVAHLHSAAADLSYVQYYLLDVIAFIITILLVLLLALYLATVRVLRKLNV 80 (94)
Q Consensus 1 a~~ls~~~~drP~~P~d~av~wiE~vir~~g~~~l~~~~~~l~~~qy~~lDv~~~l~~~~~~~~~~~~~~~~~~~~~~~~ 80 (94)
|+++|++++|||++|.|+|+||||||+||||++||++++.++||+|||+|||+++++++++++++++++++++++|++++
T Consensus 416 a~~ls~~~~~~p~~p~~~~~~~ie~v~~~~~~~~l~~~~~~l~~~~~~~lDv~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 495 (500)
T PF00201_consen 416 AKRLSSLFRDRPISPLERAVWWIEYVARHGGAPHLRSPARDLSFYQYYLLDVIAFLLLIILLIIYIIFKICRFVCRKCVK 495 (500)
T ss_dssp HHHHHHTTT-----------------------------------------------------------------------
T ss_pred HHHHHHHHhcCCCCHHHHHHHHHHHHHhcCCCcccCChhhcCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence 57899999999999999999999999999999999999999999999999999998888888888888888888888876
Q ss_pred h
Q psy388 81 I 81 (94)
Q Consensus 81 ~ 81 (94)
.
T Consensus 496 ~ 496 (500)
T PF00201_consen 496 K 496 (500)
T ss_dssp -
T ss_pred c
Confidence 5
This family currently consist of: Mammalian UDP-glucuronosyl transferases (2.4.1.17 from EC) (UDPGT) []. A large family of membrane-bound microsomal enzymes which catalyze the transfer of glucuronic acid to a wide variety of exogenous and endogenous lipophilic substrates. These enzymes are of major importance in the detoxification and subsequent elimination of xenobiotics such as drugs and carcinogens. A large number of putative UDPGT from Caenorhabditis elegans. Mammalian 2-hydroxyacylsphingosine 1-beta-galactosyltransferase [] (2.4.1.45 from EC) (also known as UDP-galactose-ceramide galactosyltransferase). This enzyme catalyzes the transfer of galactose to ceramide, a key enzymatic step in the biosynthesis of galactocerebrosides, which are abundant sphingolipids of the myelin membrane of the central nervous system and peripheral nervous system. Plants flavonol O(3)-glucosyltransferase (2.4.1.91 from EC). An enzyme [] that catalyzes the transfer of glucose from UDP-glucose to a flavanol. This reaction is essential and one of the last steps in anthocyanin pigment biosynthesis. Baculoviruses ecdysteroid UDP-glucosyltransferase (2.4.1 from EC) [] (egt). This enzyme catalyzes the transfer of glucose from UDP-glucose to ectysteroids which are insect molting hormones. The expression of egt in the insect host interferes with the normal insect development by blocking the molting process. Prokaryotic zeaxanthin glucosyltransferase (2.4.1 from EC) (gene crtX), an enzyme involved in carotenoid biosynthesis and that catalyses the glycosylation reaction which converts zeaxanthin to zeaxanthin-beta-diglucoside. Streptomyces macrolide glycosyltransferases (2.4.1 from EC) []. These enzymes specifically inactivates macrolide anitibiotics via 2'-O-glycosylation using UDP-glucose. These enzymes share a conserved domain of about 50 amino acid residues located in their C-terminal section.; GO: 0016758 transferase activity, transferring hexosyl groups, 0008152 metabolic process; PDB: 3HBJ_A 3HBF_A 2PQ6_A 3IA7_B 3RSC_A 3IAA_B 2IYA_A 2IYF_B 2O6L_A 2VCH_A ....
>PF05478 Prominin: Prominin; InterPro: IPR008795 The prominins are an emerging family of proteins that, among the multispan membrane proteins, display a novel topology
Mouse and Homo sapiens prominin and (Mus musculus) prominin-like 1 (PROML1) are predicted to contain five membrane spanning domains, with an N-terminal domain exposed to the extracellular space followed by four, alternating small cytoplasmic and large extracellular, loops and a cytoplasmic C-terminal domain []. The exact function of prominin is unknown although in humans defects in PROM1, the gene coding for prominin, cause retinal degeneration [].; GO: 0016021 integral to membrane