Psyllid ID: psy3920

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---
MARTLCNKESSRSHSVFMIRLVQAPLDLQGDQVLSDKRCLTVSQLSLVDLAGSERGSRTHVASGQRLREAGNINNSLMTLRTCLEVLRENQQQGTNRSPPFRESKLTHLFKTYFTGEGDVRMIVCVNPSSDDYDENLIGATNFEIRAHLCEKM
cccccccccccccEEEEEEEEEEEEcccccccccccccEEEEEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHcccc
cccccccccccccEEEEEEEEEEEEccccccccccccccEEEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHccccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHccc
martlcnkessrsHSVFMIRLVQapldlqgdqvlsdkrcltvSQLSLVDlagsergsrthvasgqrlreagninnSLMTLRTCLEVLREnqqqgtnrsppfresklTHLFKtyftgegdvrmivcvnpssddydenligaTNFEIRAHLCEKM
martlcnkessrshsVFMIRLVQAPLDLQGDQVLSDKRCLTVSQLSlvdlagsergsrthvasgqrlreagninnsLMTLRTCLEVLREnqqqgtnrsppfresklTHLFKtyftgegdvRMIVCVNPSSDDYDENLIGATNFEIRAHLCEKM
MARTLCNKESSRSHSVFMIRLVQAPLDLQGDQVLSDKRCLTVSQLSLVDLAGSERGSRTHVASGQRLREAGNINNSLMTLRTCLEVLRENQQQGTNRSPPFRESKLTHLFKTYFTGEGDVRMIVCVNPSSDDYDENLIGATNFEIRAHLCEKM
***************VFMIRLVQAPLDLQGDQVLSDKRCLTVSQLSLVDL**********************INNSLMTLRTCLEVL******************LTHLFKTYFTGEGDVRMIVCVNPSSDDYDENLIGATNFEIRAHLC***
MARTL**KESSRSHSVFMIRLVQAPL*************LTVSQLSLVDLAGSERG**********LREAGNINNSLMTLRTCLEVLRE**********PFRESKLTHLFKTYFTGEGDVRMIVCVNPSSDDYDENLIGATNFEIRAHLCEK*
*************HSVFMIRLVQAPLDLQGDQVLSDKRCLTVSQLSLVDLAG***********GQRLREAGNINNSLMTLRTCLEVLRE**********PFRESKLTHLFKTYFTGEGDVRMIVCVNPSSDDYDENLIGATNFEIRAHLCEKM
***********RSHSVFMIRLVQAPLDL******SDKRCLTVSQLSLVDLAG***********GQRLREAGNINNSLMTLRTCLEVLRENQQQGTNRSPPFRESKLTHLFKTYFTGEGDVRMIVCVNPSSDDYDENLIGATNFEIRAHLC***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARTLCNKESSRSHSVFMIRLVQAPLDLQGDQVLSDKRCLTVSQLSLVDLAGSERGSRTHVASGQRLREAGNINNSLMTLRTCLEVLRENQQQGTNRSPPFRESKLTHLFKTYFTGEGDVRMIVCVNPSSDDYDENLIGATNFEIRAHLCEKM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query153 2.2.26 [Sep-21-2011]
Q02241 960 Kinesin-like protein KIF2 no N/A 0.888 0.141 0.715 2e-51
P97329 887 Kinesin-like protein KIF2 no N/A 0.830 0.143 0.520 3e-27
Q80WE4 1774 Kinesin-like protein KIF2 no N/A 0.836 0.072 0.481 1e-26
O95235 890 Kinesin-like protein KIF2 no N/A 0.810 0.139 0.517 1e-25
Q29RT6 888 Kinesin-like protein KIF2 no N/A 0.810 0.139 0.517 1e-25
Q96Q89 1820 Kinesin-like protein KIF2 no N/A 0.843 0.070 0.459 4e-25
Q9EQW7 1749 Kinesin-like protein KIF1 no N/A 0.856 0.074 0.442 1e-20
Q9H1H9 1805 Kinesin-like protein KIF1 no N/A 0.856 0.072 0.434 4e-20
P46873 699 Osmotic avoidance abnorma no N/A 0.777 0.170 0.417 3e-19
Q9NQT8 1826 Kinesin-like protein KIF1 no N/A 0.849 0.071 0.424 8e-19
>sp|Q02241|KIF23_HUMAN Kinesin-like protein KIF23 OS=Homo sapiens GN=KIF23 PE=1 SV=3 Back     alignment and function desciption
 Score =  201 bits (510), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 98/137 (71%), Positives = 113/137 (82%), Gaps = 1/137 (0%)

Query: 1   MARTLCNKESSRSHSVFMIRLVQAPLDLQGDQVLSDKRCLTVSQLSLVDLAGSERGSRTH 60
           +A T  N+ESSRSHSVF I+LVQAPLD  GD VL +K  +T+SQLSLVDLAGSER +RT 
Sbjct: 289 IANTHLNRESSRSHSVFNIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNRTR 348

Query: 61  VASGQRLREAGNINNSLMTLRTCLEVLRENQQQGTNRSPPFRESKLTHLFKTYFTGEGDV 120
            A G RLREAGNIN SLMTLRTC++VLRENQ  GTN+  P+R+SKLTHLFK YF GEG V
Sbjct: 349 -AEGNRLREAGNINQSLMTLRTCMDVLRENQMYGTNKMVPYRDSKLTHLFKNYFDGEGKV 407

Query: 121 RMIVCVNPSSDDYDENL 137
           RMIVCVNP ++DY+ENL
Sbjct: 408 RMIVCVNPKAEDYEENL 424
Component of the centralspindlin complex that serves as a microtubule-dependent and Rho-mediated signaling required for the myosin contractile ring formation during the cell cycle cytokinesis. Essential for cytokinesis in Rho-mediated signaling. Required for the localization of ECT2 to the central spindle. Plus-end-directed motor enzyme that moves antiparallel microtubules in vitro.
Homo sapiens (taxid: 9606)
>sp|P97329|KI20A_MOUSE Kinesin-like protein KIF20A OS=Mus musculus GN=Kif20a PE=2 SV=1 Back     alignment and function description
>sp|Q80WE4|KI20B_MOUSE Kinesin-like protein KIF20B OS=Mus musculus GN=Kif20b PE=1 SV=3 Back     alignment and function description
>sp|O95235|KI20A_HUMAN Kinesin-like protein KIF20A OS=Homo sapiens GN=KIF20A PE=1 SV=1 Back     alignment and function description
>sp|Q29RT6|KI20A_BOVIN Kinesin-like protein KIF20A OS=Bos taurus GN=KIF20A PE=2 SV=1 Back     alignment and function description
>sp|Q96Q89|KI20B_HUMAN Kinesin-like protein KIF20B OS=Homo sapiens GN=KIF20B PE=1 SV=3 Back     alignment and function description
>sp|Q9EQW7|KI13A_MOUSE Kinesin-like protein KIF13A OS=Mus musculus GN=Kif13a PE=1 SV=1 Back     alignment and function description
>sp|Q9H1H9|KI13A_HUMAN Kinesin-like protein KIF13A OS=Homo sapiens GN=KIF13A PE=1 SV=2 Back     alignment and function description
>sp|P46873|OSM3_CAEEL Osmotic avoidance abnormal protein 3 OS=Caenorhabditis elegans GN=osm-3 PE=2 SV=4 Back     alignment and function description
>sp|Q9NQT8|KI13B_HUMAN Kinesin-like protein KIF13B OS=Homo sapiens GN=KIF13B PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query153
307201878 2061 Kinesin-like protein KIF23 [Harpegnathos 0.888 0.065 0.729 2e-52
383865787 854 PREDICTED: kinesin-like protein KIF23-li 0.888 0.159 0.729 5e-52
307167505 800 Kinesin-like protein KIF23 [Camponotus f 0.888 0.17 0.729 6e-52
350398349 849 PREDICTED: kinesin-like protein KIF23-li 0.888 0.160 0.722 9e-52
340725013 849 PREDICTED: kinesin-like protein KIF23-li 0.888 0.160 0.722 1e-51
322779232 894 hypothetical protein SINV_04172 [Solenop 0.928 0.158 0.692 1e-51
383854884 887 PREDICTED: kinesin-like protein KIF23-li 0.888 0.153 0.729 2e-51
345490642 858 PREDICTED: kinesin-like protein KIF23 [N 0.888 0.158 0.729 2e-51
380020997 853 PREDICTED: kinesin-like protein KIF23-li 0.888 0.159 0.722 3e-51
328782772 849 PREDICTED: kinesin 6A [Apis mellifera] 0.888 0.160 0.722 3e-51
>gi|307201878|gb|EFN81507.1| Kinesin-like protein KIF23 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 100/137 (72%), Positives = 115/137 (83%), Gaps = 1/137 (0%)

Query: 1    MARTLCNKESSRSHSVFMIRLVQAPLDLQGDQVLSDKRCLTVSQLSLVDLAGSERGSRTH 60
            +A T  N ESSRSHSVF IRLVQAPLD +G+ V+ DKR + +SQLSLVDLAGSER +RT 
Sbjct: 1510 VAHTALNAESSRSHSVFTIRLVQAPLDYEGEHVVQDKRVVCISQLSLVDLAGSERTNRTK 1569

Query: 61   VASGQRLREAGNINNSLMTLRTCLEVLRENQQQGTNRSPPFRESKLTHLFKTYFTGEGDV 120
              +GQRLREAGNINNSLMTLR+CLE+LRENQ QGTN+  P+R+SKLTHLFK YF GEG V
Sbjct: 1570 -NTGQRLREAGNINNSLMTLRSCLEILRENQTQGTNKMVPYRDSKLTHLFKNYFDGEGQV 1628

Query: 121  RMIVCVNPSSDDYDENL 137
            RMIVCVNP +DDYDE +
Sbjct: 1629 RMIVCVNPRADDYDETI 1645

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383865787|ref|XP_003708354.1| PREDICTED: kinesin-like protein KIF23-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307167505|gb|EFN61078.1| Kinesin-like protein KIF23 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|350398349|ref|XP_003485167.1| PREDICTED: kinesin-like protein KIF23-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340725013|ref|XP_003400869.1| PREDICTED: kinesin-like protein KIF23-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|322779232|gb|EFZ09558.1| hypothetical protein SINV_04172 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|383854884|ref|XP_003702950.1| PREDICTED: kinesin-like protein KIF23-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|345490642|ref|XP_001601945.2| PREDICTED: kinesin-like protein KIF23 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|380020997|ref|XP_003694361.1| PREDICTED: kinesin-like protein KIF23-like [Apis florea] Back     alignment and taxonomy information
>gi|328782772|ref|XP_624886.3| PREDICTED: kinesin 6A [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query153
UNIPROTKB|H0YKQ5267 KIF23 "Kinesin-like protein KI 0.895 0.513 0.710 4.7e-48
RGD|1308596482 Kif23 "kinesin family member 2 0.895 0.284 0.710 7.7e-48
UNIPROTKB|B4E1K0 673 KIF23 "cDNA FLJ58416, highly s 0.888 0.202 0.715 9.8e-48
UNIPROTKB|H7BYN4 952 KIF23 "Kinesin-like protein KI 0.888 0.142 0.715 8.1e-47
UNIPROTKB|Q02241 960 KIF23 "Kinesin-like protein KI 0.888 0.141 0.715 8.3e-47
UNIPROTKB|D4AAG4 952 Kif23 "Protein Kif23" [Rattus 0.888 0.142 0.715 1.3e-46
UNIPROTKB|J9P721 953 KIF23 "Uncharacterized protein 0.888 0.142 0.715 1.7e-46
UNIPROTKB|F1SIT8 953 KIF23 "Uncharacterized protein 0.888 0.142 0.715 1.7e-46
UNIPROTKB|F1PML0 964 KIF23 "Uncharacterized protein 0.888 0.141 0.715 1.8e-46
ZFIN|ZDB-GENE-991019-4 867 kif23 "kinesin family member 2 0.895 0.158 0.695 3.2e-46
UNIPROTKB|H0YKQ5 KIF23 "Kinesin-like protein KIF23" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 502 (181.8 bits), Expect = 4.7e-48, P = 4.7e-48
 Identities = 98/138 (71%), Positives = 114/138 (82%)

Query:     1 MARTLCNKESSRSHSVFMIRLVQAPLDLQGDQVLSDKRCLTVSQLSLVDLAGSERGSRTH 60
             +A T  N+ESSRSHSVF I+LVQAPLD  GD VL +K  +T+SQLSLVDLAGSER +RT 
Sbjct:    92 IANTHLNRESSRSHSVFNIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNRTR 151

Query:    61 VASGQRLREAGNINNSLMTLRTCLEVLRENQQQGTNRSPPFRESKLTHLFKTYFTGEGDV 120
              A G RLREAGNIN SLMTLRTC++VLRENQ  GTN+  P+R+SKLTHLFK YF GEG V
Sbjct:   152 -AEGNRLREAGNINQSLMTLRTCMDVLRENQMYGTNKMVPYRDSKLTHLFKNYFDGEGKV 210

Query:   121 RMIVCVNPSSDDYDENLI 138
             RMIVCVNP ++DY+ENL+
Sbjct:   211 RMIVCVNPKAEDYEENLV 228
GO:0003777 "microtubule motor activity" evidence=IEA
GO:0005875 "microtubule associated complex" evidence=IEA
GO:0007018 "microtubule-based movement" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005874 "microtubule" evidence=IEA
RGD|1308596 Kif23 "kinesin family member 23" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|B4E1K0 KIF23 "cDNA FLJ58416, highly similar to Kinesin-like protein KIF23" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H7BYN4 KIF23 "Kinesin-like protein KIF23" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q02241 KIF23 "Kinesin-like protein KIF23" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D4AAG4 Kif23 "Protein Kif23" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9P721 KIF23 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SIT8 KIF23 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PML0 KIF23 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-991019-4 kif23 "kinesin family member 23" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
cd01368345 cd01368, KISc_KIF23_like, Kinesin motor domain, KI 1e-71
pfam00225326 pfam00225, Kinesin, Kinesin motor domain 9e-52
smart00129335 smart00129, KISc, Kinesin motor, catalytic domain 4e-46
cd00106328 cd00106, KISc, Kinesin motor domain 8e-44
cd01365356 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K 3e-32
cd01366329 cd01366, KISc_C_terminal, Kinesin motor domain, KI 3e-29
cd01371333 cd01371, KISc_KIF3, Kinesin motor domain, kinesins 3e-29
cd01370338 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP 2e-28
cd01364352 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC 1e-26
cd01367322 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF 7e-26
cd01372341 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik 3e-25
cd01374321 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E 3e-24
cd01369325 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine 4e-24
COG5059 568 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] 5e-23
cd01373337 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP 4e-22
PLN03188 1320 PLN03188, PLN03188, kinesin-12 family protein; Pro 2e-20
cd01363186 cd01363, Motor_domain, Myosin and Kinesin motor do 3e-20
cd01376319 cd01376, KISc_KID_like, Kinesin motor domain, KIF2 4e-18
cd01375334 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF 5e-18
>gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information 
 Score =  218 bits (556), Expect = 1e-71
 Identities = 91/138 (65%), Positives = 104/138 (75%), Gaps = 3/138 (2%)

Query: 1   MARTLCNKESSRSHSVFMIRLVQAPLDLQGDQVLSDKRCLTVSQLSLVDLAGSERGSRTH 60
           +A T  N+ESSRSHSVF I+LVQAP D  GD V  DK  +TVSQLSLVDLAGSER SRT 
Sbjct: 200 VAGTKLNRESSRSHSVFTIKLVQAPGDSDGD-VDQDKDQITVSQLSLVDLAGSERTSRTQ 258

Query: 61  VASGQRLREAGNINNSLMTLRTCLEVLRENQQQGTNRSP-PFRESKLTHLFKTYFTGEGD 119
             +G+RL+EAGNIN SLMTL  C+EVLRENQ  G+     P+R+SKLTHLF+ YF GEG 
Sbjct: 259 -NTGERLKEAGNINTSLMTLGKCIEVLRENQLSGSTNKMVPYRDSKLTHLFQNYFDGEGK 317

Query: 120 VRMIVCVNPSSDDYDENL 137
            RMIV VNP + DYDE L
Sbjct: 318 ARMIVNVNPCASDYDETL 335

Members of this group may play a role in mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 Angstroms along the microtubule. Meanwhile, ATP hydrolysis takes place, and when the second head domain binds to the microtubule, the first domain again replaces ADP with ATP, triggering a conformational change that pulls the first domain forward. Length = 345
>gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain Back     alignment and domain information
>gnl|CDD|238054 cd00106, KISc, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group Back     alignment and domain information
>gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional Back     alignment and domain information
>gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 153
KOG4280|consensus 574 100.0
cd01373337 KISc_KLP2_like Kinesin motor domain, KLP2-like sub 100.0
KOG0243|consensus 1041 100.0
KOG0245|consensus 1221 100.0
cd01368345 KISc_KIF23_like Kinesin motor domain, KIF23-like s 100.0
cd01370338 KISc_KIP3_like Kinesin motor domain, KIP3-like sub 100.0
PLN03188 1320 kinesin-12 family protein; Provisional 100.0
KOG0240|consensus 607 100.0
cd01365356 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p 100.0
cd01364352 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind 100.0
KOG0242|consensus 675 100.0
cd01371333 KISc_KIF3 Kinesin motor domain, kinesins II or KIF 100.0
cd01372341 KISc_KIF4 Kinesin motor domain, KIF4-like subfamil 100.0
cd01376319 KISc_KID_like Kinesin motor domain, KIF22/Kid-like 100.0
cd01375334 KISc_KIF9_like Kinesin motor domain, KIF9-like sub 100.0
cd01369325 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy 100.0
cd01367322 KISc_KIF2_like Kinesin motor domain, KIF2-like gro 100.0
cd01374321 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like 100.0
cd01366329 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ 100.0
PF00225335 Kinesin: Kinesin motor domain; InterPro: IPR001752 100.0
KOG0241|consensus 1714 100.0
smart00129335 KISc Kinesin motor, catalytic domain. ATPase. Micr 100.0
KOG0239|consensus670 100.0
KOG0246|consensus 676 100.0
cd00106328 KISc Kinesin motor domain. This catalytic (head) d 100.0
KOG0247|consensus 809 100.0
cd01363186 Motor_domain Myosin and Kinesin motor domain. Thes 100.0
KOG0244|consensus 913 100.0
COG5059 568 KIP1 Kinesin-like protein [Cytoskeleton] 100.0
COG5059568 KIP1 Kinesin-like protein [Cytoskeleton] 92.78
>KOG4280|consensus Back     alignment and domain information 
Probab=100.00  E-value=4.9e-46  Score=311.71  Aligned_cols=140  Identities=41%  Similarity=0.555  Sum_probs=128.2

Q ss_pred             CCcCCCCCcCCcCeeEEEEEEEeeecCCCCCccccCCceeeeeeeEEEecCCCCCccccccccccccccccccchhHHHH
Q psy3920           1 MARTLCNKESSRSHSVFMIRLVQAPLDLQGDQVLSDKRCLTVSQLSLVDLAGSERGSRTHVASGQRLREAGNINNSLMTL   80 (153)
Q Consensus         1 ~~~t~~n~~SSRSH~if~l~i~~~~~~~~~~~~~~~~~~~~~s~L~~VDLaGse~~~~~~~~~~~~~~E~~~in~SL~~L   80 (153)
                      ||+|.+|+.|||||+||+|+|++.....+      +....+.|||+|||||||||..+++ +.|++++|+.+||+||++|
T Consensus       199 vgat~mn~~SsRSH~ift~~i~~~~~~~~------~~~~~~~~rlnlvDLagsEr~~~tg-a~G~rlkEa~~IN~SLs~L  271 (574)
T KOG4280|consen  199 VGATSMNEESSRSHAIFTIHIESSEKSDG------GLMSGRSSKLNLVDLAGSERQSKTG-AEGERLKEATNINLSLSAL  271 (574)
T ss_pred             hhhccCCcccccceEEEEEEEEeecccCC------CccccccceeeeeeccchhhhcccC-ccchhhhhhcccchhHHHH
Confidence            68999999999999999999999332222      2345688999999999999999999 9999999999999999999


Q ss_pred             HHHHHHHHHhhcCCCCCCCCCCCchhHHhhhhhcCCCCeEEEEEEeCCCCCCHHHHHHHHHHHHHHHhhccc
Q psy3920          81 RTCLEVLRENQQQGTNRSPPFRESKLTHLFKTYFTGEGDVRMIVCVNPSSDDYDENLIGATNFEIRAHLCEK  152 (153)
Q Consensus        81 ~~vi~aL~~~~~~~~~~~vpyr~S~LT~lL~d~l~g~~~t~~i~~vsp~~~~~~eTl~tL~~~a~r~~~i~~  152 (153)
                      |+||.+|+++.+    .|||||||+||+||+|+|||||+|+|||||+|...+|+||++||+ ||+|+|.|+.
T Consensus       272 G~vI~aLvd~~~----~HIPYRdSkLT~LLqdSLGGN~kT~mianvsp~~~~~~ETlsTLr-fA~Rak~I~n  338 (574)
T KOG4280|consen  272 GNVISALVDGSK----THIPYRDSKLTRLLQDSLGGNSKTTMIANVSPSSDNYEETLSTLR-FAQRAKAIKN  338 (574)
T ss_pred             HHHHHHHhcccc----CCCCcchhHHHHHHHHHcCCCceEEEEEecCchhhhhHHHHHHHH-HHHHHHHhhc
Confidence            999999998653    399999999999999999999999999999999999999999999 9999999975

>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>KOG0243|consensus Back     alignment and domain information
>KOG0245|consensus Back     alignment and domain information
>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>PLN03188 kinesin-12 family protein; Provisional Back     alignment and domain information
>KOG0240|consensus Back     alignment and domain information
>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>KOG0242|consensus Back     alignment and domain information
>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group Back     alignment and domain information
>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>KOG0241|consensus Back     alignment and domain information
>smart00129 KISc Kinesin motor, catalytic domain Back     alignment and domain information
>KOG0239|consensus Back     alignment and domain information
>KOG0246|consensus Back     alignment and domain information
>cd00106 KISc Kinesin motor domain Back     alignment and domain information
>KOG0247|consensus Back     alignment and domain information
>cd01363 Motor_domain Myosin and Kinesin motor domain Back     alignment and domain information
>KOG0244|consensus Back     alignment and domain information
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
3gbj_A354 Crystal Structure Of The Motor Domain Of Kinesin Ki 1e-21
2owm_A443 Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 6e-19
4a14_A344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 1e-17
4etp_A403 C-Terminal Motor And Motor Homology Domain Of Kar3v 8e-17
2vvg_A350 Crystal Structure Of The G.Intestinalis Kinesin 2 G 1e-16
3lre_A355 Crystal Structure Analysis Of Human Kinesin-8 Motor 1e-16
2xt3_A344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 1e-16
3kar_A346 The Motor Domain Of Kinesin-Like Protein Kar3, A Sa 2e-16
1f9t_A358 Crystal Structures Of Kinesin Mutants Reveal A Sign 3e-16
4aqv_C373 Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma 4e-16
4a1z_A368 Eg5-1 Length = 368 4e-16
1q0b_A367 Crystal Structure Of The Motor Protein Ksp In Compl 4e-16
1x88_A359 Human Eg5 Motor Domain Bound To Mg-Adp And Monastro 5e-16
4ap0_A370 The Mitotic Kinesin Eg5 In Complex With Mg-Adp And 5e-16
1ii6_A368 Crystal Structure Of The Mitotic Kinesin Eg5 In Com 5e-16
4a28_A368 Eg5-2 Length = 368 5e-16
3hqd_A369 Human Kinesin Eg5 Motor Domain In Complex With Ampp 5e-16
3zcw_A348 Eg5 - New Allosteric Binding Site Length = 348 5e-16
2wbe_C373 Kinesin-5-Tubulin Complex With Amppnp Length = 373 7e-16
1f9w_A347 Crystal Structures Of Mutants Reveal A Signalling P 1e-15
1f9u_A347 Crystal Structures Of Mutants Reveal A Signalling P 1e-15
1f9v_A347 Crystal Structures Of Mutants Reveal A Signalling P 2e-15
1ia0_K394 Kif1a Head-Microtubule Complex Structure In Atp-For 2e-15
1i5s_A367 Crystal Structure Of The Kif1a Motor Domain Complex 2e-15
1i6i_A366 Crystal Structure Of The Kif1a Motor Domain Complex 3e-15
1vfv_A366 Crystal Structure Of The Kif1a Motor Domain Complex 3e-15
3b6u_A372 Crystal Structure Of The Motor Domain Of Human Kine 7e-15
4h1g_A715 Structure Of Candida Albicans Kar3 Motor Domain Fus 2e-14
2y5w_A365 Crystal Structure Of Drosophila Melanogaster Kinesi 3e-14
4gkr_A371 Structure Of The C-Terminal Motor Domain Of Kar3 Fr 4e-14
1goj_A355 Structure Of A Fast Kinesin: Implications For Atpas 5e-14
4atx_C340 Rigor Kinesin Motor Domain With An Ordered Neck-Lin 9e-14
1mkj_A349 Human Kinesin Motor Domain With Docked Neck Linker 1e-13
3t0q_A349 Motor Domain Structure Of The Kar3-Like Kinesin Fro 1e-13
1bg2_A325 Human Ubiquitous Kinesin Motor Domain Length = 325 1e-13
1v8j_A410 The Crystal Structure Of The Minimal Functional Dom 1e-13
3edl_D331 Kinesin13-Microtubule Ring Complex Length = 331 1e-13
2heh_A387 Crystal Structure Of The Kif2c Motor Domain (Casp T 1e-13
1t5c_A349 Crystal Structure Of The Motor Domain Of Human Kine 9e-13
2h58_A330 Crystal Structure Of The Kifc3 Motor Domain In Comp 1e-12
2gry_A420 Crystal Structure Of The Human Kif2 Motor Domain In 4e-12
2rep_A376 Crystal Structure Of The Motor Domain Of Human Kine 7e-12
1ry6_A360 Crystal Structure Of Internal Kinesin Motor Domain 2e-11
1sdm_A369 Crystal Structure Of Kinesin-Like Calmodulin Bindin 1e-10
3h4s_A386 Structure Of The Complex Of A Mitotic Kinesin With 2e-10
3nwn_A359 Crystal Structure Of The Human Kif9 Motor Domain In 2e-10
3bfn_A388 Crystal Structure Of The Motor Domain Of Human Kine 4e-10
3l1c_A383 Kinesin-14 Protein Ncd, T436s Mutant Length = 383 7e-10
3u06_A412 Crystal Structure Of The Kinesin-14 Ncdg347d Length 7e-10
2ncd_A420 Ncd (Non-Claret Disjunctional) Dimer From D. Melano 7e-10
1cz7_A406 The Crystal Structure Of A Minus-End Directed Micro 8e-10
3b6v_A395 Crystal Structure Of The Motor Domain Of Human Kine 1e-09
1n6m_A409 Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY 4e-09
3dc4_A344 Crystal Structure Of The Drosophila Kinesin Family 1e-04
3pxn_A344 Crystal Structure Of The Drosophila Kinesin Family 1e-04
>pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 Back     alignment and structure 
Iteration: 1

 Score = 98.2 bits (243), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 81/139 (58%), Gaps = 9/139 (6%)
Query: 1   MARTLCNKESSRSHSVFMIRLVQAPLDLQGDQVLSDKRCLTVSQLSLVDLAGSERGSRTH 60
           +A T  N+ESSRSH+VF I L     D++     S      V +LSLVDLAGSER ++T 
Sbjct: 207 VAATNMNEESSRSHAVFKITLTHTLYDVK-----SGTSGEKVGKLSLVDLAGSERATKTG 261
Query: 61  VASGQRLREAGNINNSLMTLRTCLEVLRENQQQGTNRSP--PFRESKLTHLFKTYFTGEG 118
            A+G RL+E  NIN SL TL   +  L  +Q  G N++   P+R+S LT L K    G  
Sbjct: 262 -AAGDRLKEGSNINKSLTTLGLVISAL-ADQSAGKNKNKFVPYRDSVLTWLLKDSLGGNS 319
Query: 119 DVRMIVCVNPSSDDYDENL 137
              M+  V+P++D+YDE L
Sbjct: 320 KTAMVATVSPAADNYDETL 338
>pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 Back     alignment and structure
>pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure
>pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 Back     alignment and structure
>pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 Back     alignment and structure
>pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 Back     alignment and structure
>pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure
>pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 Back     alignment and structure
>pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 Back     alignment and structure
>pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 Back     alignment and structure
>pdb|4A1Z|A Chain A, Eg5-1 Length = 368 Back     alignment and structure
>pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 Back     alignment and structure
>pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 Back     alignment and structure
>pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 Back     alignment and structure
>pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 Back     alignment and structure
>pdb|4A28|A Chain A, Eg5-2 Length = 368 Back     alignment and structure
>pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 Back     alignment and structure
>pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 Back     alignment and structure
>pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 Back     alignment and structure
>pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 Back     alignment and structure
>pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 Back     alignment and structure
>pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 Back     alignment and structure
>pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 Back     alignment and structure
>pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 Back     alignment and structure
>pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 Back     alignment and structure
>pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 Back     alignment and structure
>pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 Back     alignment and structure
>pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 Back     alignment and structure
>pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 Back     alignment and structure
>pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 Back     alignment and structure
>pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 Back     alignment and structure
>pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 Back     alignment and structure
>pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 Back     alignment and structure
>pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 Back     alignment and structure
>pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 Back     alignment and structure
>pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 Back     alignment and structure
>pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 Back     alignment and structure
>pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 Back     alignment and structure
>pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 Back     alignment and structure
>pdb|1RY6|A Chain A, Crystal Structure Of Internal Kinesin Motor Domain Length = 360 Back     alignment and structure
>pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 Back     alignment and structure
>pdb|3H4S|A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator Length = 386 Back     alignment and structure
>pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 Back     alignment and structure
>pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 Back     alignment and structure
>pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 Back     alignment and structure
>pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 Back     alignment and structure
>pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 Back     alignment and structure
>pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 Back     alignment and structure
>pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 Back     alignment and structure
>pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 Back     alignment and structure
>pdb|3DC4|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Nod In Complex With Adp Length = 344 Back     alignment and structure
>pdb|3PXN|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Kin10NOD IN Complex With Divalent Manganese And Adp Length = 344 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
3gbj_A354 KIF13B protein; kinesin, motor domain, ADP, struct 2e-36
2wbe_C373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 6e-36
1x88_A359 Kinesin-like protein KIF11; switch II, motor domai 8e-36
4a14_A344 Kinesin, kinesin-like protein KIF7; motor protein, 1e-35
3b6u_A372 Kinesin-like protein KIF3B; structural genomics co 2e-35
3lre_A355 Kinesin-like protein KIF18A; motor protein, nucleo 2e-35
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 2e-35
2zfi_A366 Kinesin-like protein KIF1A, kinesin heavy chain is 3e-35
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 7e-35
2nr8_A358 Kinesin-like protein KIF9; motor domain, ADP, stru 9e-35
2vvg_A350 Kinesin-2; motor protein, nucleotide-binding, micr 1e-34
3t0q_A349 AGR253WP; kinesin, alpha and beta proteins, P-loop 2e-34
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 2e-34
3cob_A369 Kinesin heavy chain-like protein; motor, switch II 3e-34
1goj_A355 Kinesin, kinesin heavy chain; motor protein, ATPas 3e-34
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 6e-34
2y65_A365 Kinesin, kinesin heavy chain; motor protein; HET: 9e-34
3bfn_A388 Kinesin-like protein KIF22; limited proteolysis, s 9e-34
1t5c_A349 CENP-E protein, centromeric protein E; kinesin mot 6e-33
2rep_A376 Kinesin-like protein KIFC1; structural genomics co 1e-32
3u06_A412 Protein claret segregational; motor domain, stalk 1e-32
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 4e-32
2heh_A387 KIF2C protein; kinesin, motor domain, ADP, structu 4e-32
2owm_A443 Nckin3-434, related to kinesin-like protein KIF1C; 6e-32
1ry6_A360 Internal kinesin; kinesin motor domain, nucleotide 1e-31
1v8k_A410 Kinesin-like protein KIF2C; microtubule destabiliz 4e-31
2kin_B100 Kinesin; motor protein, cytoskeleton; HET: ADP; 2. 4e-10
3kin_B117 Kinesin heavy chain; motor protein, cytoskeleton; 7e-07
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 Back     alignment and structure
 Score =  126 bits (320), Expect = 2e-36
 Identities = 59/146 (40%), Positives = 79/146 (54%), Gaps = 25/146 (17%)

Query: 2   ARTLCNKESSRSHSVFMIRLVQAPLDLQGDQVLSDKRCLTVSQLSLVDLAGSERGSRTHV 61
           A T  N+ESSRSH+VF I L     D++            V +LSLVDLAGSER ++T  
Sbjct: 208 AATNMNEESSRSHAVFKITLTHTLYDVKSGTS-----GEKVGKLSLVDLAGSERATKTG- 261

Query: 62  ASGQRLREAGNINNSLMTLRTCLEVLRENQQQGTNRSP--PFRESKLTHLF--------K 111
           A+G RL+E  NIN SL TL   +  L + Q  G N++   P+R+S LT L         K
Sbjct: 262 AAGDRLKEGSNINKSLTTLGLVISALAD-QSAGKNKNKFVPYRDSVLTWLLKDSLGGNSK 320

Query: 112 TYFTGEGDVRMIVCVNPSSDDYDENL 137
           T         M+  V+P++D+YDE L
Sbjct: 321 TA--------MVATVSPAADNYDETL 338
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 Back     alignment and structure
>2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Length = 100 Back     alignment and structure
>3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Length = 117 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query153
3t0q_A349 AGR253WP; kinesin, alpha and beta proteins, P-loop 100.0
3lre_A355 Kinesin-like protein KIF18A; motor protein, nucleo 100.0
2vvg_A350 Kinesin-2; motor protein, nucleotide-binding, micr 100.0
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 100.0
1x88_A359 Kinesin-like protein KIF11; switch II, motor domai 100.0
2zfi_A366 Kinesin-like protein KIF1A, kinesin heavy chain is 100.0
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 100.0
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 100.0
1t5c_A349 CENP-E protein, centromeric protein E; kinesin mot 100.0
3cob_A369 Kinesin heavy chain-like protein; motor, switch II 100.0
2rep_A376 Kinesin-like protein KIFC1; structural genomics co 100.0
4a14_A344 Kinesin, kinesin-like protein KIF7; motor protein, 100.0
3gbj_A354 KIF13B protein; kinesin, motor domain, ADP, struct 100.0
1goj_A355 Kinesin, kinesin heavy chain; motor protein, ATPas 100.0
3nwn_A359 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
2y65_A365 Kinesin, kinesin heavy chain; motor protein; HET: 100.0
3b6u_A372 Kinesin-like protein KIF3B; structural genomics co 100.0
2wbe_C373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 100.0
2nr8_A358 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
3bfn_A388 Kinesin-like protein KIF22; limited proteolysis, s 100.0
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 100.0
2owm_A443 Nckin3-434, related to kinesin-like protein KIF1C; 100.0
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 100.0
1ry6_A360 Internal kinesin; kinesin motor domain, nucleotide 100.0
2heh_A387 KIF2C protein; kinesin, motor domain, ADP, structu 100.0
4h1g_A715 Maltose binding protein-cakar3 motor domain fusio; 100.0
1v8k_A410 Kinesin-like protein KIF2C; microtubule destabiliz 100.0
3u06_A412 Protein claret segregational; motor domain, stalk 100.0
2kin_B100 Kinesin; motor protein, cytoskeleton; HET: ADP; 2. 99.97
3kin_B117 Kinesin heavy chain; motor protein, cytoskeleton; 99.95
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Back     alignment and structure
Probab=100.00  E-value=1.7e-47  Score=308.26  Aligned_cols=139  Identities=37%  Similarity=0.490  Sum_probs=115.5

Q ss_pred             CCcCCCCCcCCcCeeEEEEEEEeeecCCCCCccccCCceeeeeeeEEEecCCCCCccccccccccccccccccchhHHHH
Q psy3920           1 MARTLCNKESSRSHSVFMIRLVQAPLDLQGDQVLSDKRCLTVSQLSLVDLAGSERGSRTHVASGQRLREAGNINNSLMTL   80 (153)
Q Consensus         1 ~~~t~~n~~SSRSH~if~l~i~~~~~~~~~~~~~~~~~~~~~s~L~~VDLaGse~~~~~~~~~~~~~~E~~~in~SL~~L   80 (153)
                      +|+|.+|+.|||||+||+|+|.+.+...+         ....|+|+|||||||||..+.+ +.+++++|+..||+||.+|
T Consensus       208 ~~~T~~N~~SSRSH~if~i~v~~~~~~~~---------~~~~~kL~lVDLAGSEr~~~t~-~~g~rl~E~~~INkSL~aL  277 (349)
T 3t0q_A          208 TAATRSNERSSRSHSVFMVHINGRNLHTG---------ETSQGKLNLVDLAGSERINSSA-VTGERLRETQNINKSLSCL  277 (349)
T ss_dssp             -------CTGGGSEEEEEEEEEEEETTTC---------CEEEEEEEEEECCCCCCCC-----CCHHHHHHHHHHHHHHHH
T ss_pred             ccccccccccCCcceEEEEEEEEEecCCC---------CeeEEEEEEEeCCCCCcccccc-CccccchhHHhhhHhHHHH
Confidence            57899999999999999999999875433         2367999999999999999999 9999999999999999999


Q ss_pred             HHHHHHHHHhhcCCCCCCCCCCCchhHHhhhhhcCCCCeEEEEEEeCCCCCCHHHHHHHHHHHHHHHhhccc
Q psy3920          81 RTCLEVLRENQQQGTNRSPPFRESKLTHLFKTYFTGEGDVRMIVCVNPSSDDYDENLIGATNFEIRAHLCEK  152 (153)
Q Consensus        81 ~~vi~aL~~~~~~~~~~~vpyr~S~LT~lL~d~l~g~~~t~~i~~vsp~~~~~~eTl~tL~~~a~r~~~i~~  152 (153)
                      ++||.+|++++.  ++.||||||||||+||||+|||+++|+||+||||...+++||++||+ ||+|++.||.
T Consensus       278 g~vI~aL~~~~~--~~~hiPyRdSkLT~lLqdsLgGnskt~mi~~vsP~~~~~~ETl~TL~-fA~rv~~ik~  346 (349)
T 3t0q_A          278 GDVIYALNTPDA--GKRYIPFRNSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLR-FASKVNSTKI  346 (349)
T ss_dssp             HHHHHHHHSTTG--GGSCCCGGGSHHHHHHGGGSSTTCEEEEEEEECCCGGGHHHHHHHHH-HHHHHHC---
T ss_pred             HHHHHHHhcccC--CCCcCCCcCCHHHHHHHHhcCCCceEEEEEEeCCchhhHHHHHHHHH-HHHHhhhccc
Confidence            999999987542  23699999999999999999999999999999999999999999999 9999999873
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Back     alignment and structure
>3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Back     alignment and structure
>4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Back     alignment and structure
>3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 153
d2zfia1349 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), 1e-26
d1ry6a_330 c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu 6e-26
d1v8ka_362 c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c 5e-24
d1f9va_342 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 7e-24
d1bg2a_323 c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId 6e-23
d2ncda_368 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 3e-21
d1goja_354 c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 1e-20
d1x88a1345 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), 1e-20
d1sdma_364 c.37.1.9 (A:) Kinesin heavy chain-like protein {Po 1e-16
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin
species: Mouse (Mus musculus), kif1a [TaxId: 10090]

 Score =  100 bits (249), Expect = 1e-26
 Identities = 52/144 (36%), Positives = 69/144 (47%), Gaps = 13/144 (9%)

Query: 1   MARTLCNKESSRSHSVFMIRLVQAPLDLQGDQVLSDKRCLTVSQLSLVDLAGSERGSRTH 60
           +A T  N+ SSRSH+VF I   Q   D + +          VS++SLVDLAGSER   T 
Sbjct: 202 VAATNMNETSSRSHAVFNIIFTQKRHDAETNITTE-----KVSKISLVDLAGSERADSTG 256

Query: 61  VASGQRLREAGNINNSLMTLRTCLEVLRENQQQGTNRSP-------PFRESKLTHLFKTY 113
              G RL+E  NIN SL TL   +  L E                 P+R+S LT L +  
Sbjct: 257 A-KGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKTDFIPYRDSVLTWLLREN 315

Query: 114 FTGEGDVRMIVCVNPSSDDYDENL 137
             G     M+  ++P+  +YDE L
Sbjct: 316 LGGNSRTAMVAALSPADINYDETL 339
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query153
d1sdma_364 Kinesin heavy chain-like protein {Potato (Solanum 100.0
d1f9va_342 Kinesin motor Ncd (non-claret disjunctional) {Bake 100.0
d1x88a1345 Kinesin {Human (Homo sapiens), mitotic kinesin eg5 100.0
d1v8ka_362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 100.0
d1goja_354 Kinesin {Neurospora crassa [TaxId: 5141]} 100.0
d2zfia1349 Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 100.0
d1bg2a_323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1ry6a_330 Kinesin {Malaria parasite (Plasmodium falciparum) 100.0
d2ncda_368 Kinesin motor Ncd (non-claret disjunctional) {Frui 100.0
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin heavy chain-like protein
species: Potato (Solanum tuberosum) [TaxId: 4113]

Probab=100.00  E-value=1.4e-42  Score=279.18  Aligned_cols=136  Identities=32%  Similarity=0.484  Sum_probs=117.9

Q ss_pred             CCcCCCCCcCCcCeeEEEEEEEeeecCCCCCccccCCceeeeeeeEEEecCCCCCccccccccccccccccccchhHHHH
Q psy3920           1 MARTLCNKESSRSHSVFMIRLVQAPLDLQGDQVLSDKRCLTVSQLSLVDLAGSERGSRTHVASGQRLREAGNINNSLMTL   80 (153)
Q Consensus         1 ~~~t~~n~~SSRSH~if~l~i~~~~~~~~~~~~~~~~~~~~~s~L~~VDLaGse~~~~~~~~~~~~~~E~~~in~SL~~L   80 (153)
                      +++|.+|..|||||+||+|+|.+...+..         ....++|+||||||+||..+.+ +.+.+++|+..||+||.+|
T Consensus       189 ~~~t~~n~~ssRsH~i~~i~v~~~~~~~~---------~~~~~kl~~vDLAGsEr~~~~~-~~g~~~~E~~~iN~SL~~L  258 (364)
T d1sdma_         189 TTGTLMNEQSSRSHLIVSVIIESTNLQTQ---------AIARGKLSFVDLAGSERVKKSG-SAGNQLKEAQSINKSLSAL  258 (364)
T ss_dssp             CCSSCTTCHHHHSEEEEEEEEEEEETTTC---------CEEEEEEEEEECCCCSCCCC----------CCCTTCHHHHHH
T ss_pred             cccccccccccccceEEEEEEEEeccCcc---------eeeeEEEEeechhhcccccccc-ccCceeeeccccccchhhH
Confidence            47899999999999999999999775432         4577999999999999999988 8999999999999999999


Q ss_pred             HHHHHHHHHhhcCCCCCCCCCCCchhHHhhhhhcCCCCeEEEEEEeCCCCCCHHHHHHHHHHHHHHHhhccc
Q psy3920          81 RTCLEVLRENQQQGTNRSPPFRESKLTHLFKTYFTGEGDVRMIVCVNPSSDDYDENLIGATNFEIRAHLCEK  152 (153)
Q Consensus        81 ~~vi~aL~~~~~~~~~~~vpyr~S~LT~lL~d~l~g~~~t~~i~~vsp~~~~~~eTl~tL~~~a~r~~~i~~  152 (153)
                      ++||.+|++++     .|||||+|+||++|+|+|+|+|+|+||+||||...+++||++||+ ||+|++.|+.
T Consensus       259 ~~vi~aL~~~~-----~~ipyR~SkLT~lL~d~Lggns~t~~I~~isp~~~~~~eTl~TL~-fa~~ak~i~n  324 (364)
T d1sdma_         259 GDVISALSSGN-----QHIPYRNHKLTMLMSDSLGGNAKTLMFVNISPAESNLDETHNSLT-YASRVRSIVN  324 (364)
T ss_dssp             HHHHHHHHHTC-----SCCCGGGCHHHHHTTTTTTSSSEEEEEEEECCBGGGHHHHHHHHH-HHHHHTTCCC
T ss_pred             HHHHHHHHcCC-----CcCCchhhhhhHHHHhhcCCCceEEEEEEeCCCcchHHHHHHHHH-HHHHHhhccc
Confidence            99999999865     689999999999999999999999999999999999999999999 9999999864
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure