Psyllid ID: psy3964
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 65 | ||||||
| 332374780 | 544 | unknown [Dendroctonus ponderosae] | 0.984 | 0.117 | 0.734 | 6e-20 | |
| 432881828 | 563 | PREDICTED: counting factor associated pr | 0.923 | 0.106 | 0.75 | 7e-20 | |
| 348542138 | 551 | PREDICTED: counting factor associated pr | 0.923 | 0.108 | 0.75 | 9e-20 | |
| 383860620 | 549 | PREDICTED: counting factor associated pr | 0.923 | 0.109 | 0.75 | 2e-19 | |
| 194870649 | 549 | GG15663 [Drosophila erecta] gi|190654476 | 0.923 | 0.109 | 0.766 | 2e-19 | |
| 195590156 | 549 | GD14469 [Drosophila simulans] gi|1941968 | 0.923 | 0.109 | 0.766 | 2e-19 | |
| 20428641 | 549 | 26-29kD-proteinase [Drosophila melanogas | 0.923 | 0.109 | 0.766 | 2e-19 | |
| 195327474 | 549 | GM25442 [Drosophila sechellia] gi|194119 | 0.923 | 0.109 | 0.766 | 2e-19 | |
| 195494228 | 549 | GE21992 [Drosophila yakuba] gi|194180848 | 0.923 | 0.109 | 0.766 | 2e-19 | |
| 350425511 | 549 | PREDICTED: counting factor associated pr | 0.923 | 0.109 | 0.75 | 2e-19 |
| >gi|332374780|gb|AEE62531.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
Score = 101 bits (251), Expect = 6e-20, Method: Compositional matrix adjust.
Identities = 47/64 (73%), Positives = 52/64 (81%)
Query: 2 RKGHNSPDGLDHAVLAVGYGELDGKPYWQVKNSWSTYWGNQGYVLMSIKDNNCGVMTAPT 61
K HN D LDHAVLAVGYG ++G YW VKNSWS YWGN GYVLMS K+NNCGVM+APT
Sbjct: 480 EKCHNKVDELDHAVLAVGYGSINGNHYWLVKNSWSNYWGNDGYVLMSSKNNNCGVMSAPT 539
Query: 62 YVTM 65
YVT+
Sbjct: 540 YVTL 543
|
Source: Dendroctonus ponderosae Species: Dendroctonus ponderosae Genus: Dendroctonus Family: Curculionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|432881828|ref|XP_004073923.1| PREDICTED: counting factor associated protein D-like [Oryzias latipes] | Back alignment and taxonomy information |
|---|
| >gi|348542138|ref|XP_003458543.1| PREDICTED: counting factor associated protein D-like [Oreochromis niloticus] | Back alignment and taxonomy information |
|---|
| >gi|383860620|ref|XP_003705787.1| PREDICTED: counting factor associated protein D-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|194870649|ref|XP_001972693.1| GG15663 [Drosophila erecta] gi|190654476|gb|EDV51719.1| GG15663 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|195590156|ref|XP_002084812.1| GD14469 [Drosophila simulans] gi|194196821|gb|EDX10397.1| GD14469 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
| >gi|20428641|ref|NP_620470.1| 26-29kD-proteinase [Drosophila melanogaster] gi|6448467|dbj|BAA86910.1| homologue of Sarcophaga 26,29kDa proteinase [Drosophila melanogaster] gi|7294432|gb|AAF49777.1| 26-29kD-proteinase [Drosophila melanogaster] gi|21483518|gb|AAM52734.1| RE18380p [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195327474|ref|XP_002030443.1| GM25442 [Drosophila sechellia] gi|194119386|gb|EDW41429.1| GM25442 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|195494228|ref|XP_002094747.1| GE21992 [Drosophila yakuba] gi|194180848|gb|EDW94459.1| GE21992 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|350425511|ref|XP_003494144.1| PREDICTED: counting factor associated protein D-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 65 | ||||||
| FB|FBgn0250848 | 549 | 26-29-p "26-29kD-proteinase" [ | 0.923 | 0.109 | 0.766 | 2.7e-22 | |
| UNIPROTKB|F1NT07 | 317 | LOC100857883 "Uncharacterized | 0.876 | 0.179 | 0.719 | 1.7e-20 | |
| UNIPROTKB|F1NHB8 | 329 | F1NHB8 "Uncharacterized protei | 0.876 | 0.173 | 0.701 | 9.2e-20 | |
| ZFIN|ZDB-GENE-050417-107 | 546 | zgc:110239 "zgc:110239" [Danio | 0.923 | 0.109 | 0.65 | 4.6e-18 | |
| UNIPROTKB|E2QV47 | 136 | CTSH "Uncharacterized protein" | 0.892 | 0.426 | 0.551 | 3.8e-14 | |
| UNIPROTKB|F1P3U9 | 261 | CTSH "Uncharacterized protein" | 0.876 | 0.218 | 0.543 | 6.2e-14 | |
| UNIPROTKB|F6X9C1 | 305 | CTSH "Uncharacterized protein" | 0.892 | 0.190 | 0.551 | 6.6e-14 | |
| UNIPROTKB|G3SSC1 | 335 | CTSH "Uncharacterized protein" | 0.892 | 0.173 | 0.551 | 7.7e-14 | |
| UNIPROTKB|F7BJD8 | 305 | CTSH "Uncharacterized protein" | 0.892 | 0.190 | 0.534 | 1.1e-13 | |
| ZFIN|ZDB-GENE-040718-61 | 334 | ctsl.1 "cathepsin L.1" [Danio | 0.892 | 0.173 | 0.571 | 1.3e-13 |
| FB|FBgn0250848 26-29-p "26-29kD-proteinase" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 266 (98.7 bits), Expect = 2.7e-22, P = 2.7e-22
Identities = 46/60 (76%), Positives = 50/60 (83%)
Query: 6 NSPDGLDHAVLAVGYGELDGKPYWQVKNSWSTYWGNQGYVLMSIKDNNCGVMTAPTYVTM 65
N DGLDHAVLAVGYG ++G+ YW VKNSWSTYWGN GY+LMS K NNCGVMT PTYV M
Sbjct: 490 NDVDGLDHAVLAVGYGSINGEDYWLVKNSWSTYWGNDGYILMSAKKNNCGVMTMPTYVEM 549
|
|
| UNIPROTKB|F1NT07 LOC100857883 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NHB8 F1NHB8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050417-107 zgc:110239 "zgc:110239" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QV47 CTSH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P3U9 CTSH "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6X9C1 CTSH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3SSC1 CTSH "Uncharacterized protein" [Loxodonta africana (taxid:9785)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F7BJD8 CTSH "Uncharacterized protein" [Equus caballus (taxid:9796)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040718-61 ctsl.1 "cathepsin L.1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 65 | |||
| cd02248 | 210 | cd02248, Peptidase_C1A, Peptidase C1A subfamily (M | 1e-23 | |
| pfam00112 | 213 | pfam00112, Peptidase_C1, Papain family cysteine pr | 3e-21 | |
| smart00645 | 175 | smart00645, Pept_C1, Papain family cysteine protea | 1e-18 | |
| cd02620 | 236 | cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro | 2e-12 | |
| cd02619 | 223 | cd02619, Peptidase_C1, C1 Peptidase family (MEROPS | 3e-11 | |
| PTZ00200 | 448 | PTZ00200, PTZ00200, cysteine proteinase; Provision | 7e-11 | |
| cd02621 | 243 | cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al | 3e-10 | |
| PTZ00203 | 348 | PTZ00203, PTZ00203, cathepsin L protease; Provisio | 7e-10 | |
| PTZ00462 | 1004 | PTZ00462, PTZ00462, Serine-repeat antigen protein; | 1e-08 | |
| PTZ00049 | 693 | PTZ00049, PTZ00049, cathepsin C-like protein; Prov | 5e-07 | |
| COG4870 | 372 | COG4870, COG4870, Cysteine protease [Posttranslati | 4e-06 | |
| cd02698 | 239 | cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th | 1e-05 | |
| PTZ00021 | 489 | PTZ00021, PTZ00021, falcipain-2; Provisional | 2e-04 | |
| pfam03051 | 438 | pfam03051, Peptidase_C1_2, Peptidase C1-like famil | 8e-04 |
| >gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
Score = 87.7 bits (218), Expect = 1e-23
Identities = 27/57 (47%), Positives = 36/57 (63%)
Query: 7 SPDGLDHAVLAVGYGELDGKPYWQVKNSWSTYWGNQGYVLMSIKDNNCGVMTAPTYV 63
S L+HAVL VGYG +G YW VKNSW T WG +GY+ ++ N CG+ + +Y
Sbjct: 154 SNTNLNHAVLLVGYGTENGVDYWIVKNSWGTSWGEKGYIRIARGSNLCGIASYASYP 210
|
Papain is an endopeptidase with specific substrate preferences, primarily for bulky hydrophobic or aromatic residues at the S2 subsite, a hydrophobic pocket in papain that accommodates the P2 sidechain of the substrate (the second residue away from the scissile bond). Most members of the papain subfamily are endopeptidases. Some exceptions to this rule can be explained by specific details of the catalytic domains like the occluding loop in cathepsin B which confers an additional carboxydipeptidyl activity and the mini-chain of cathepsin H resulting in an N-terminal exopeptidase activity. Papain-like CPs have different functions in various organisms. Plant CPs are used to mobilize storage proteins in seeds. Parasitic CPs act extracellularly to help invade tissues and cells, to hatch or to evade the host immune system. Mammalian CPs are primarily lysosomal enzymes with the exception of cathepsin W, which is retained in the endoplasmic reticulum. They are responsible for protein degradation in the lysosome. Papain-like CPs are synthesized as inactive proenzymes with N-terminal propeptide regions, which are removed upon activation. In addition to its inhibitory role, the propeptide is required for proper folding of the newly synthesized enzyme and its stabilization in denaturing pH conditions. Residues within the propeptide region also play a role in the transport of the proenzyme to lysosomes or acidified vesicles. Also included in this subfamily are proteins classified as non-peptidase homologs, which lack peptidase activity or have missing active site residues. Length = 210 |
| >gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185641 PTZ00462, PTZ00462, Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227207 COG4870, COG4870, Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|202517 pfam03051, Peptidase_C1_2, Peptidase C1-like family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 65 | |||
| PTZ00203 | 348 | cathepsin L protease; Provisional | 99.91 | |
| cd02698 | 239 | Peptidase_C1A_CathepsinX Cathepsin X; the only pap | 99.91 | |
| cd02620 | 236 | Peptidase_C1A_CathepsinB Cathepsin B group; compos | 99.9 | |
| KOG1542|consensus | 372 | 99.9 | ||
| cd02621 | 243 | Peptidase_C1A_CathepsinC Cathepsin C; also known a | 99.89 | |
| PF00112 | 219 | Peptidase_C1: Papain family cysteine protease This | 99.89 | |
| cd02248 | 210 | Peptidase_C1A Peptidase C1A subfamily (MEROPS data | 99.89 | |
| PTZ00200 | 448 | cysteine proteinase; Provisional | 99.87 | |
| PTZ00021 | 489 | falcipain-2; Provisional | 99.87 | |
| KOG1543|consensus | 325 | 99.86 | ||
| smart00645 | 174 | Pept_C1 Papain family cysteine protease. | 99.86 | |
| PTZ00364 | 548 | dipeptidyl-peptidase I precursor; Provisional | 99.84 | |
| PTZ00049 | 693 | cathepsin C-like protein; Provisional | 99.84 | |
| PTZ00462 | 1004 | Serine-repeat antigen protein; Provisional | 99.8 | |
| cd02619 | 223 | Peptidase_C1 C1 Peptidase family (MEROPS database | 99.72 | |
| KOG1544|consensus | 470 | 99.56 | ||
| cd00585 | 437 | Peptidase_C1B Peptidase C1B subfamily (MEROPS data | 99.51 | |
| COG4870 | 372 | Cysteine protease [Posttranslational modification, | 99.3 | |
| PF03051 | 438 | Peptidase_C1_2: Peptidase C1-like family This fami | 99.1 | |
| COG3579 | 444 | PepC Aminopeptidase C [Amino acid transport and me | 98.33 | |
| KOG4128|consensus | 457 | 95.19 | ||
| PF05543 | 175 | Peptidase_C47: Staphopain peptidase C47; InterPro: | 88.56 | |
| PF13529 | 144 | Peptidase_C39_2: Peptidase_C39 like family; PDB: 3 | 86.72 |
| >PTZ00203 cathepsin L protease; Provisional | Back alignment and domain information |
|---|
Probab=99.91 E-value=3.1e-24 Score=152.32 Aligned_cols=60 Identities=38% Similarity=0.774 Sum_probs=53.8
Q ss_pred CCCCCCCeEEEEEEEeccCCeeEEEEEcCCCCCCCCCeEEEEeccCCeeeeccccEEEEC
Q psy3964 6 NSPDGLDHAVLAVGYGELDGKPYWQVKNSWSTYWGNQGYVLMSIKDNNCGVMTAPTYVTM 65 (65)
Q Consensus 6 ~~~~~~~Hav~ivG~g~~~~~~yW~i~NSwg~~WG~~Gy~~i~~~~~~cgi~~~~~~p~v 65 (65)
|+...+||||+|||||.+++.+|||||||||++||++|||||.|+.|.|+|+.++....|
T Consensus 281 c~~~~~nHaVliVGYG~~~g~~YWiikNSWG~~WGe~GY~ri~rg~n~Cgi~~~~~~~~~ 340 (348)
T PTZ00203 281 CIGEQLNHGVLLVGYNMTGEVPYWVIKNSWGEDWGEKGYVRVTMGVNACLLTGYPVSVHV 340 (348)
T ss_pred cCCCCCCeEEEEEEEecCCCceEEEEEcCCCCCcCcCceEEEEcCCCcccccceEEEEec
Confidence 445568999999999998899999999999999999999999999999999988776543
|
|
| >cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >KOG1542|consensus | Back alignment and domain information |
|---|
| >cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification | Back alignment and domain information |
|---|
| >cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >PTZ00200 cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00021 falcipain-2; Provisional | Back alignment and domain information |
|---|
| >KOG1543|consensus | Back alignment and domain information |
|---|
| >smart00645 Pept_C1 Papain family cysteine protease | Back alignment and domain information |
|---|
| >PTZ00364 dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >PTZ00049 cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00462 Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >KOG1544|consensus | Back alignment and domain information |
|---|
| >cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) | Back alignment and domain information |
|---|
| >COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4128|consensus | Back alignment and domain information |
|---|
| >PF05543 Peptidase_C47: Staphopain peptidase C47; InterPro: IPR008750 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF13529 Peptidase_C39_2: Peptidase_C39 like family; PDB: 3ERV_A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 65 | ||||
| 8pch_A | 220 | Crystal Structure Of Porcine Cathepsin H Determined | 5e-13 | ||
| 2f7d_A | 215 | A Mutant Rabbit Cathepsin K With A Nitrile Inhibito | 2e-11 | ||
| 1vsn_A | 215 | Crystal Structure Of A Potent Small Molecule Inhibi | 4e-11 | ||
| 3ovz_A | 213 | Cathepsin K In Complex With A Covalent Inhibitor Wi | 5e-11 | ||
| 1snk_A | 214 | Cathepsin K Complexed With Carbamate Derivatized No | 5e-11 | ||
| 1mem_A | 215 | Crystal Structure Of Cathepsin K Complexed With A P | 5e-11 | ||
| 7pck_A | 314 | Crystal Structure Of Wild Type Human Procathepsin K | 5e-11 | ||
| 1u9v_A | 217 | Crystal Structure Of The Cysteine Protease Human Ca | 5e-11 | ||
| 1ms6_A | 222 | Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L | 2e-10 | ||
| 1glo_A | 217 | Crystal Structure Of Cys25ser Mutant Of Human Cathe | 2e-10 | ||
| 3kwn_A | 219 | Cathepsin S In Complex With Thioether Acetamide P3 | 2e-10 | ||
| 3n3g_A | 217 | 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri | 2e-10 | ||
| 3iej_A | 222 | Pyrazole-Based Cathepsin S Inhibitors With Arylalky | 2e-10 | ||
| 2f1g_A | 220 | Cathepsin S In Complex With Non-Covalent 2-(Benzoxa | 2e-10 | ||
| 2fq9_A | 225 | Cathepsin S With Nitrile Inhibitor Length = 225 | 2e-10 | ||
| 3mpe_A | 220 | Crystal Structure Of Human Cathepsin-S C25s Mutant | 2e-10 | ||
| 3ovx_A | 218 | Cathepsin S In Complex With A Covalent Inhibitor Wi | 2e-10 | ||
| 1npz_A | 217 | Crystal Structures Of Cathepsin S Inhibitor Complex | 2e-10 | ||
| 2c0y_A | 315 | The Crystal Structure Of A Cys25ala Mutant Of Human | 2e-10 | ||
| 2g6d_A | 217 | Human Cathepsin S Mutant With Vinyl Sulfone Inhibit | 3e-10 | ||
| 2fye_A | 217 | Mutant Human Cathepsin S With Irreversible Inhibito | 3e-10 | ||
| 1cjl_A | 312 | Crystal Structure Of A Cysteine Protease Proform Le | 7e-10 | ||
| 3h7d_A | 215 | The Crystal Structure Of The Cathepsin K Variant M5 | 8e-10 | ||
| 1cs8_A | 316 | Crystal Structure Of Procathepsin L Length = 316 | 4e-09 | ||
| 3hwn_A | 258 | Cathepsin L With Az13010160 Length = 258 | 5e-09 | ||
| 2nqd_B | 221 | Crystal Structure Of Cysteine Protease Inhibitor, C | 6e-09 | ||
| 3of8_A | 221 | Structural Basis For Reversible And Irreversible In | 6e-09 | ||
| 3bc3_A | 220 | Exploring Inhibitor Binding At The S Subsites Of Ca | 6e-09 | ||
| 3iv2_A | 220 | Crystal Structure Of Mature Apo-Cathepsin L C25a Mu | 6e-09 | ||
| 3hha_A | 220 | Crystal Structure Of Cathepsin L In Complex With Az | 6e-09 | ||
| 3h89_A | 220 | A Combined Crystallographic And Molecular Dynamics | 6e-09 | ||
| 3kse_A | 220 | Unreduced Cathepsin L In Complex With Stefin A Leng | 6e-09 | ||
| 3h6s_A | 221 | Strucure Of Clitocypin - Cathepsin V Complex Length | 7e-09 | ||
| 1fh0_A | 221 | Crystal Structure Of Human Cathepsin V Complexed Wi | 7e-09 | ||
| 1aim_A | 215 | Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor | 8e-09 | ||
| 1m6d_A | 214 | Crystal Structure Of Human Cathepsin F Length = 214 | 9e-09 | ||
| 2o6x_A | 310 | Crystal Structure Of Procathepsin L1 From Fasciola | 1e-08 | ||
| 1ewp_A | 215 | Cruzain Bound To Mor-Leu-Hpq Length = 215 | 1e-08 | ||
| 3iut_A | 221 | The Crystal Structure Of Cruzain In Complex With A | 2e-08 | ||
| 3hd3_A | 215 | High Resolution Crystal Structure Of Cruzain Bound | 2e-08 | ||
| 2act_A | 220 | Crystallographic Refinement Of The Structure Of Act | 3e-08 | ||
| 1aec_A | 218 | Crystal Structure Of Actinidin-E-64 Complex+ Length | 3e-08 | ||
| 3qt4_A | 329 | Structure Of Digestive Procathepsin L 3 Of Tenebrio | 3e-08 | ||
| 1iwd_A | 215 | Proposed Amino Acid Sequence And The 1.63 Angstrom | 4e-08 | ||
| 2vhs_A | 217 | Cathsilicatein, A Chimera Length = 217 | 5e-08 | ||
| 2p7u_A | 215 | The Crystal Structure Of Rhodesain, The Major Cyste | 7e-08 | ||
| 1s4v_A | 229 | The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst | 7e-08 | ||
| 1yal_A | 218 | Carica Papaya Chymopapain At 1.7 Angstroms Resoluti | 1e-07 | ||
| 2fo5_A | 262 | Crystal Structure Of Recombinant Barley Cysteine En | 1e-07 | ||
| 4hwy_A | 340 | Trypanosoma Brucei Procathepsin B Solved From 40 Fs | 2e-07 | ||
| 3hhi_A | 325 | Crystal Structure Of Cathepsin B From T. Brucei In | 2e-07 | ||
| 3mor_A | 317 | Crystal Structure Of Cathepsin B From Trypanosoma B | 2e-07 | ||
| 3p5u_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 4e-07 | ||
| 3p5w_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 5e-07 | ||
| 3f75_A | 224 | Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In | 5e-07 | ||
| 2b1m_A | 246 | Crystal Structure Of A Papain-Fold Protein Without | 5e-07 | ||
| 3qj3_A | 331 | Structure Of Digestive Procathepsin L2 Proteinase F | 7e-07 | ||
| 3pdf_A | 441 | Discovery Of Novel Cyanamide-Based Inhibitors Of Ca | 5e-06 | ||
| 3bcn_A | 209 | Crystal Structure Of A Papain-Like Cysteine Proteas | 6e-06 | ||
| 1pbh_A | 317 | Crystal Structure Of Human Recombinant Procathepsin | 9e-06 | ||
| 1cpj_A | 260 | Crystal Structures Of Recombinant Rat Cathepsin B A | 1e-05 | ||
| 1mir_A | 322 | Rat Procathepsin B Length = 322 | 1e-05 | ||
| 1qdq_A | 253 | X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 | 1e-05 | ||
| 3ai8_B | 256 | Cathepsin B In Complex With The Nitroxoline Length | 1e-05 | ||
| 3k9m_A | 254 | Cathepsin B In Complex With Stefin A Length = 254 | 1e-05 | ||
| 3cbj_A | 266 | Chagasin-cathepsin B Complex Length = 266 | 1e-05 | ||
| 1gmy_A | 261 | Cathepsin B Complexed With Dipeptidyl Nitrile Inhib | 1e-05 | ||
| 1cte_A | 254 | Crystal Structures Of Recombinant Rat Cathepsin B A | 1e-05 | ||
| 1huc_B | 205 | The Refined 2.15 Angstroms X-Ray Crystal Structure | 1e-05 | ||
| 1ito_A | 256 | Crystal Structure Analysis Of Bovine Spleen Catheps | 1e-05 | ||
| 1jqp_A | 438 | Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric | 1e-05 | ||
| 2pns_A | 208 | 1.9 Angstrom Resolution Crystal Structure Of A Plan | 2e-05 | ||
| 1sp4_B | 205 | Crystal Structure Of Ns-134 In Complex With Bovine | 2e-05 | ||
| 1k3b_C | 69 | Crystal Structure Of Human Dipeptidyl Peptidase I ( | 2e-05 | ||
| 3d6s_A | 223 | Crystal Structure Of Mite Allergen Der F 1 Length = | 2e-05 | ||
| 1cqd_A | 221 | The 2.1 Angstrom Structure Of A Cysteine Protease W | 2e-05 | ||
| 3u8e_A | 222 | Crystal Structure Of Cysteine Protease From Bulbs O | 2e-05 | ||
| 1xkg_A | 312 | Crystal Structure Of The Major House Dust Mite Alle | 2e-05 | ||
| 3ch2_X | 265 | Crystal Structure Analysis Of Sera5e From Plasmodiu | 2e-05 | ||
| 2wbf_X | 265 | Crystal Structure Analysis Of Sera5e From Plasmodiu | 2e-05 | ||
| 2as8_A | 222 | Crystal Structure Of Mature And Fully Active Der P | 4e-05 | ||
| 3rvw_A | 222 | Crystal Structure Of Der P 1 Complexed With Fab 4c1 | 4e-05 | ||
| 3f5v_A | 222 | C2 Crystal Form Of Mite Allergen Der P 1 Length = 2 | 4e-05 | ||
| 3ioq_A | 213 | Crystal Structure Of The Carica Candamarcensis Cyst | 7e-05 | ||
| 2bdz_A | 214 | Mexicain From Jacaratia Mexicana Length = 214 | 3e-04 | ||
| 3ima_A | 212 | Complex Strcuture Of Tarocystatin And Papain Length | 3e-04 | ||
| 3qsd_A | 254 | Structure Of Cathepsin B1 From Schistosoma Mansoni | 3e-04 | ||
| 2cio_A | 212 | The High Resolution X-Ray Structure Of Papain Compl | 3e-04 | ||
| 1khp_A | 212 | Monoclinic Form Of Papain/zlfg-dam Covalent Complex | 3e-04 | ||
| 1stf_E | 212 | The Refined 2.4 Angstroms X-Ray Crystal Structure O | 3e-04 | ||
| 1ppp_A | 212 | Crystal Structure Of Papain-E64-C Complex. Binding | 3e-04 | ||
| 1pip_A | 212 | Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Al | 3e-04 | ||
| 3tnx_A | 363 | Structure Of The Precursor Of A Thermostable Varian | 4e-04 | ||
| 1o0e_A | 208 | 1.9 Angstrom Crystal Structure Of A Plant Cysteine | 4e-04 | ||
| 1icf_B | 42 | Crystal Structure Of Mhc Class Ii Associated P41 Ii | 5e-04 |
| >pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 | Back alignment and structure |
|
| >pdb|2F7D|A Chain A, A Mutant Rabbit Cathepsin K With A Nitrile Inhibitor Length = 215 | Back alignment and structure |
| >pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 | Back alignment and structure |
| >pdb|3OVZ|A Chain A, Cathepsin K In Complex With A Covalent Inhibitor With A Ketoamide Warhead Length = 213 | Back alignment and structure |
| >pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 | Back alignment and structure |
| >pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 | Back alignment and structure |
| >pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Human Procathepsin K Length = 314 | Back alignment and structure |
| >pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 | Back alignment and structure |
| >pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 | Back alignment and structure |
| >pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 | Back alignment and structure |
| >pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 | Back alignment and structure |
| >pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 | Back alignment and structure |
| >pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 | Back alignment and structure |
| >pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 | Back alignment and structure |
| >pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 | Back alignment and structure |
| >pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 | Back alignment and structure |
| >pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 | Back alignment and structure |
| >pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 | Back alignment and structure |
| >pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 | Back alignment and structure |
| >pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 | Back alignment and structure |
| >pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 | Back alignment and structure |
| >pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 | Back alignment and structure |
| >pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 | Back alignment and structure |
| >pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 | Back alignment and structure |
| >pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 | Back alignment and structure |
| >pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 | Back alignment and structure |
| >pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 | Back alignment and structure |
| >pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 | Back alignment and structure |
| >pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 | Back alignment and structure |
| >pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 | Back alignment and structure |
| >pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 | Back alignment and structure |
| >pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 | Back alignment and structure |
| >pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 | Back alignment and structure |
| >pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 | Back alignment and structure |
| >pdb|1M6D|A Chain A, Crystal Structure Of Human Cathepsin F Length = 214 | Back alignment and structure |
| >pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 | Back alignment and structure |
| >pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 | Back alignment and structure |
| >pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 | Back alignment and structure |
| >pdb|2ACT|A Chain A, Crystallographic Refinement Of The Structure Of Actinidin At 1.7 Angstroms Resolution By Fast Fourier Least-Squares Methods Length = 220 | Back alignment and structure |
| >pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 | Back alignment and structure |
| >pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 | Back alignment and structure |
| >pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray Crystal Structure Of A Plant Cysteine Protease Ervatamin B: Insight Into The Structural Basis Of Its Stability And Substrate Specificity Length = 215 | Back alignment and structure |
| >pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 | Back alignment and structure |
| >pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 | Back alignment and structure |
| >pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 | Back alignment and structure |
| >pdb|1YAL|A Chain A, Carica Papaya Chymopapain At 1.7 Angstroms Resolution Length = 218 | Back alignment and structure |
| >pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 | Back alignment and structure |
| >pdb|4HWY|A Chain A, Trypanosoma Brucei Procathepsin B Solved From 40 Fs Free-electron Laser Pulse Data By Serial Femtosecond X-ray Crystallography Length = 340 | Back alignment and structure |
| >pdb|3HHI|A Chain A, Crystal Structure Of Cathepsin B From T. Brucei In Complex With Ca074 Length = 325 | Back alignment and structure |
| >pdb|3MOR|A Chain A, Crystal Structure Of Cathepsin B From Trypanosoma Brucei Length = 317 | Back alignment and structure |
| >pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|3F75|A Chain A, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 224 | Back alignment and structure |
| >pdb|2B1M|A Chain A, Crystal Structure Of A Papain-Fold Protein Without The Catalytic Cysteine From Seeds Of Pachyrhizus Erosus Length = 246 | Back alignment and structure |
| >pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 | Back alignment and structure |
| >pdb|3PDF|A Chain A, Discovery Of Novel Cyanamide-Based Inhibitors Of Cathepsin C Length = 441 | Back alignment and structure |
| >pdb|3BCN|A Chain A, Crystal Structure Of A Papain-Like Cysteine Protease Ervatamin-A Complexed With Irreversible Inhibitor E-64 Length = 209 | Back alignment and structure |
| >pdb|1PBH|A Chain A, Crystal Structure Of Human Recombinant Procathepsin B At 3.2 Angstrom Resolution Length = 317 | Back alignment and structure |
| >pdb|1CPJ|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 260 | Back alignment and structure |
| >pdb|1MIR|A Chain A, Rat Procathepsin B Length = 322 | Back alignment and structure |
| >pdb|1QDQ|A Chain A, X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 Complex Length = 253 | Back alignment and structure |
| >pdb|3AI8|B Chain B, Cathepsin B In Complex With The Nitroxoline Length = 256 | Back alignment and structure |
| >pdb|3K9M|A Chain A, Cathepsin B In Complex With Stefin A Length = 254 | Back alignment and structure |
| >pdb|3CBJ|A Chain A, Chagasin-cathepsin B Complex Length = 266 | Back alignment and structure |
| >pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipeptidyl Nitrile Inhibitor Length = 261 | Back alignment and structure |
| >pdb|1CTE|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 254 | Back alignment and structure |
| >pdb|1HUC|B Chain B, The Refined 2.15 Angstroms X-Ray Crystal Structure Of Human Liver Cathepsin B: The Structural Basis For Its Specificity Length = 205 | Back alignment and structure |
| >pdb|1ITO|A Chain A, Crystal Structure Analysis Of Bovine Spleen Cathepsin B- E64c Complex Length = 256 | Back alignment and structure |
| >pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric Cysteine Protease Of The Papain Family Length = 438 | Back alignment and structure |
| >pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 | Back alignment and structure |
| >pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In Complex With Bovine Cathepsin B: A Two Headed Epoxysuccinyl Inhibitor Extends Along The Whole Active Site Cleft Length = 205 | Back alignment and structure |
| >pdb|1K3B|C Chain C, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 69 | Back alignment and structure |
| >pdb|3D6S|A Chain A, Crystal Structure Of Mite Allergen Der F 1 Length = 223 | Back alignment and structure |
| >pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale Length = 221 | Back alignment and structure |
| >pdb|3U8E|A Chain A, Crystal Structure Of Cysteine Protease From Bulbs Of Crocus Sativus At 1.3 A Resolution Length = 222 | Back alignment and structure |
| >pdb|1XKG|A Chain A, Crystal Structure Of The Major House Dust Mite Allergen Der P 1 In Its Pro Form At 1.61 A Resolution Length = 312 | Back alignment and structure |
| >pdb|3CH2|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum Length = 265 | Back alignment and structure |
| >pdb|2WBF|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum With Loop 690-700 Ordered Length = 265 | Back alignment and structure |
| >pdb|2AS8|A Chain A, Crystal Structure Of Mature And Fully Active Der P 1 Allergen Length = 222 | Back alignment and structure |
| >pdb|3RVW|A Chain A, Crystal Structure Of Der P 1 Complexed With Fab 4c1 Length = 222 | Back alignment and structure |
| >pdb|3F5V|A Chain A, C2 Crystal Form Of Mite Allergen Der P 1 Length = 222 | Back alignment and structure |
| >pdb|3IOQ|A Chain A, Crystal Structure Of The Carica Candamarcensis Cysteine Protease Cms1ms2 In Complex With E-64 Length = 213 | Back alignment and structure |
| >pdb|2BDZ|A Chain A, Mexicain From Jacaratia Mexicana Length = 214 | Back alignment and structure |
| >pdb|3IMA|A Chain A, Complex Strcuture Of Tarocystatin And Papain Length = 212 | Back alignment and structure |
| >pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In Complex With Ca074 Inhibitor Length = 254 | Back alignment and structure |
| >pdb|2CIO|A Chain A, The High Resolution X-Ray Structure Of Papain Complexed With Fragments Of The Trypanosoma Brucei Cysteine Protease Inhibitor Icp Length = 212 | Back alignment and structure |
| >pdb|1KHP|A Chain A, Monoclinic Form Of Papain/zlfg-dam Covalent Complex Length = 212 | Back alignment and structure |
| >pdb|1STF|E Chain E, The Refined 2.4 Angstroms X-Ray Crystal Structure Of Recombinant Human Stefin B In Complex With The Cysteine Proteinase Papain: A Novel Type Of Proteinase Inhibitor Interaction Length = 212 | Back alignment and structure |
| >pdb|1PPP|A Chain A, Crystal Structure Of Papain-E64-C Complex. Binding Diversity Of E64-C To Papain S2 And S3 Subsites Length = 212 | Back alignment and structure |
| >pdb|1PIP|A Chain A, Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Ala-Ala-P- Nitroanilide Complex At 1.7 Angstroms Resolution: Noncovalent Binding Mode Of A Common Sequence Of Endogenous Thiol Protease Inhibitors Length = 212 | Back alignment and structure |
| >pdb|3TNX|A Chain A, Structure Of The Precursor Of A Thermostable Variant Of Papain At 2.6 Angstroem Resolution Length = 363 | Back alignment and structure |
| >pdb|1O0E|A Chain A, 1.9 Angstrom Crystal Structure Of A Plant Cysteine Protease Ervatamin C Length = 208 | Back alignment and structure |
| >pdb|1ICF|B Chain B, Crystal Structure Of Mhc Class Ii Associated P41 Ii Fragment In Complex With Cathepsin L Length = 42 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 65 | |||
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 2e-29 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 8e-29 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 1e-28 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 1e-27 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 1e-27 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 6e-27 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 3e-26 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 3e-26 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 7e-26 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 2e-25 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 2e-25 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 4e-25 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 8e-25 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 2e-24 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 4e-24 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 9e-24 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 1e-23 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 4e-23 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 3e-22 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 4e-22 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 4e-22 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 5e-22 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 1e-21 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 1e-21 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 2e-21 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 5e-21 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 3e-20 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 5e-20 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 5e-20 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 1e-19 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 1e-19 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 2e-19 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 2e-19 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 2e-19 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 2e-19 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 6e-19 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 5e-18 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 3e-17 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 9e-17 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 3e-07 |
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 | Back alignment and structure |
|---|
Score = 102 bits (257), Expect = 2e-29
Identities = 31/58 (53%), Positives = 38/58 (65%)
Query: 5 HNSPDGLDHAVLAVGYGELDGKPYWQVKNSWSTYWGNQGYVLMSIKDNNCGVMTAPTY 62
H +PD ++HAVLAVGYGE +G PYW VKNSW WG GY L+ N CG+ +Y
Sbjct: 158 HKTPDKVNHAVLAVGYGEENGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASY 215
|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 | Back alignment and structure |
|---|
| >3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* Length = 222 | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 | Back alignment and structure |
|---|
| >3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A Length = 220 | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 65 | |||
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 99.94 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 99.94 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 99.94 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 99.94 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 99.94 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 99.94 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 99.93 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 99.93 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 99.93 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 99.93 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 99.93 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 99.93 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 99.93 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 99.93 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 99.93 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 99.93 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 99.93 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 99.93 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 99.92 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 99.92 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 99.92 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 99.92 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 99.92 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 99.92 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 99.91 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 99.91 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 99.91 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 99.91 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 99.91 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 99.91 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 99.91 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 99.91 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 99.91 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 99.91 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 99.91 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 99.9 | |
| 3tnx_A | 363 | Papain; hydrolase, cytoplasm for recombinant expre | 99.9 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 99.9 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 99.88 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 99.71 | |
| 2e01_A | 457 | Cysteine proteinase 1; bleomycin hydrolase, thiol | 99.68 | |
| 2cb5_A | 453 | Protein (bleomycin hydrolase); aminopeptidase, cys | 99.67 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 99.61 | |
| 1pxv_A | 183 | Cysteine protease; hydrolase; 1.80A {Staphylococcu | 90.83 | |
| 1x9y_A | 367 | Cysteine proteinase; half-barrel, barrel-sandwich- | 88.64 | |
| 1cv8_A | 174 | Staphopain; cysteine protease, thiol protease, pap | 88.55 |
| >3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* | Back alignment and structure |
|---|
Probab=99.94 E-value=3.2e-27 Score=155.57 Aligned_cols=60 Identities=35% Similarity=0.618 Sum_probs=56.7
Q ss_pred CCCCCCCeEEEEEEEeccCCeeEEEEEcCCCCCCCCCeEEEEeccCCeeeeccccEEEEC
Q psy3964 6 NSPDGLDHAVLAVGYGELDGKPYWQVKNSWSTYWGNQGYVLMSIKDNNCGVMTAPTYVTM 65 (65)
Q Consensus 6 ~~~~~~~Hav~ivG~g~~~~~~yW~i~NSwg~~WG~~Gy~~i~~~~~~cgi~~~~~~p~v 65 (65)
++....+|||+|||||.+++++|||||||||++||++|||||+|+.|.|+|++.++||+|
T Consensus 163 ~~~~~~~HaV~iVGyg~~~g~~ywivkNSWG~~WGe~Gy~~i~r~~n~cgi~~~~~~p~~ 222 (222)
T 3f5v_A 163 NGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 222 (222)
T ss_dssp CSSSCEEEEEEEEEEEEETTEEEEEEECSBCTTSTBTTEEEEECSSCGGGTTTSCEEEEC
T ss_pred CCCCccCcEEEEEEEeccCCCEEEEEEcCCCCCcccCCEEEEEcCCCeecCCCceeEEeC
Confidence 445678999999999999999999999999999999999999999999999999999986
|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* | Back alignment and structure |
|---|
| >3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} SCOP: d.3.1.1 PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} | Back alignment and structure |
|---|
| >3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A | Back alignment and structure |
|---|
| >2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >1pxv_A Cysteine protease; hydrolase; 1.80A {Staphylococcus aureus} SCOP: d.3.1.1 PDB: 1y4h_A | Back alignment and structure |
|---|
| >1x9y_A Cysteine proteinase; half-barrel, barrel-sandwich-hybrid, hydrolase; 2.50A {Staphylococcus aureus} SCOP: d.3.1.1 d.17.1.4 | Back alignment and structure |
|---|
| >1cv8_A Staphopain; cysteine protease, thiol protease, papain family; HET: E64; 1.75A {Staphylococcus aureus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 65 | ||||
| d1xkga1 | 302 | d.3.1.1 (A:4-305) Major mite fecal allergen der p | 1e-18 | |
| d1cs8a_ | 316 | d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens | 1e-16 | |
| d1gmya_ | 254 | d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens | 1e-15 | |
| g8pch.1 | 228 | d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax | 2e-15 | |
| d2h7ja1 | 217 | d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa | 4e-15 | |
| d1m6da_ | 214 | d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta | 1e-14 | |
| d1me4a_ | 215 | d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 | 6e-14 | |
| d1yala_ | 218 | d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ | 1e-13 | |
| d1deua_ | 275 | d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens | 2e-13 | |
| d2r6na1 | 215 | d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa | 3e-13 | |
| g1k3b.1 | 233 | d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase | 3e-13 | |
| d1ppoa_ | 216 | d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca | 1e-12 | |
| d1aeca_ | 218 | d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi | 1e-12 | |
| d1s4va_ | 224 | d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor | 1e-11 | |
| d1cqda_ | 216 | d.3.1.1 (A:) Proline-specific cysteine protease {G | 1e-11 | |
| d2oula1 | 241 | d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip | 2e-11 | |
| d1fh0a_ | 221 | d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens | 5e-11 | |
| d1iwda_ | 215 | d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia | 9e-11 | |
| d1o0ea_ | 208 | d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv | 1e-10 | |
| d1khqa_ | 212 | d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId | 9e-09 | |
| d3gcba_ | 458 | d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S | 9e-08 | |
| d2cb5a_ | 453 | d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapi | 4e-07 |
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: Major mite fecal allergen der p 1 species: House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]
Score = 74.3 bits (181), Expect = 1e-18
Identities = 21/61 (34%), Positives = 27/61 (44%)
Query: 5 HNSPDGLDHAVLAVGYGELDGKPYWQVKNSWSTYWGNQGYVLMSIKDNNCGVMTAPTYVT 64
N HAV VGY G YW V+NSW T WG+ GY + + + P V
Sbjct: 239 DNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVI 298
Query: 65 M 65
+
Sbjct: 299 L 299
|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 | Back information, alignment and structure |
|---|
| >d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 453 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 65 | |||
| d1me4a_ | 215 | Cruzain {Trypanosoma cruzi [TaxId: 5693]} | 99.95 | |
| d2h7ja1 | 217 | (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 | 99.95 | |
| d1m6da_ | 214 | Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | 99.94 | |
| d1cs8a_ | 316 | (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 | 99.94 | |
| d1xkga1 | 302 | Major mite fecal allergen der p 1 {House-dust mite | 99.94 | |
| g8pch.1 | 228 | Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} | 99.94 | |
| d1aeca_ | 218 | Actinidin {Chinese gooseberry or kiwifruit (Actini | 99.93 | |
| d2r6na1 | 215 | (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 | 99.93 | |
| d1yala_ | 218 | Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | 99.93 | |
| d1ppoa_ | 216 | Caricain (protease omega) {Papaya (Carica papaya) | 99.93 | |
| d1gmya_ | 254 | (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 | 99.92 | |
| d1cqda_ | 216 | Proline-specific cysteine protease {Ginger rhizome | 99.92 | |
| d1s4va_ | 224 | Vignain (bean endopeptidase) {Castor bean (Ricinus | 99.92 | |
| d2oula1 | 241 | Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} | 99.91 | |
| g1k3b.1 | 233 | Cathepsin C (dipeptidyl peptidase I), catalytic do | 99.91 | |
| d1iwda_ | 215 | Ervatamin B {Adam's apple (Ervatamia coronaria) [T | 99.91 | |
| d1fh0a_ | 221 | (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 | 99.91 | |
| d1khqa_ | 212 | Papain {Papaya (Carica papaya) [TaxId: 3649]} | 99.91 | |
| d1o0ea_ | 208 | Ervatamin C {East indian rosebay (Ervatamia corona | 99.91 | |
| d1deua_ | 275 | (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 | 99.9 | |
| d3gcba_ | 458 | Bleomycin hydrolase {Baker's yeast (Saccharomyces | 99.18 | |
| d2cb5a_ | 453 | Bleomycin hydrolase {Human (Homo sapiens) [TaxId: | 99.03 | |
| d1cv8a_ | 173 | Staphopain StpA {Staphylococcus aureus [TaxId: 128 | 92.36 | |
| d1pxva_ | 183 | Staphopain SspB {Staphylococcus aureus [TaxId: 128 | 92.17 |
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: Cruzain species: Trypanosoma cruzi [TaxId: 5693]
Probab=99.95 E-value=3.3e-28 Score=155.49 Aligned_cols=61 Identities=38% Similarity=0.814 Sum_probs=57.4
Q ss_pred CCCCCCCCeEEEEEEEeccCCeeEEEEEcCCCCCCCCCeEEEEeccCCeeeeccccEEEEC
Q psy3964 5 HNSPDGLDHAVLAVGYGELDGKPYWQVKNSWSTYWGNQGYVLMSIKDNNCGVMTAPTYVTM 65 (65)
Q Consensus 5 ~~~~~~~~Hav~ivG~g~~~~~~yW~i~NSwg~~WG~~Gy~~i~~~~~~cgi~~~~~~p~v 65 (65)
.+++...+|||+|||||.+++++|||||||||++||++|||||+|+.|.|+|+++++||+|
T Consensus 154 ~~~~~~~~Hav~IVGyg~~~~~~ywivrNSWG~~WGd~Gy~~i~~g~n~cgI~~~~~~~~~ 214 (215)
T d1me4a_ 154 SCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVV 214 (215)
T ss_dssp SCCCSCCCEEEEEEEEESSSSSCEEEEECSBCTTSTBTTEEEEESSSCGGGTTSSEEEEEC
T ss_pred CCccccceeEEEEEEccccCCceEEEEEcCCCCCcccCCEEEEECCCCccccCCceeeEec
Confidence 3556678999999999999999999999999999999999999999999999999999987
|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cv8a_ d.3.1.1 (A:) Staphopain StpA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1pxva_ d.3.1.1 (A:) Staphopain SspB {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|