Psyllid ID: psy3968

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080
MHMHRQKADESYLVGKGLPPVEAYLNIPEIIRVAKENDVDAIHPGYGFLSERSDFAQAVLDAGIRFIGPSPYVVQQMGDKVAARQAAIDSGVPIVPGTPGPITTTEEAMEFCLKYGLPVIFKAAYGGGGRGMRVVRKMEDVEENFQRASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGDKAGNVVHLYERDCSVQRRHQKVVEIAPAPHLDINVRNKMTDLAVKLAKHVGYSNAGTVEFLCDESGQFYFIEVNARLQVEHTVTEEITGVDLVQSQIRVAEGMTLPELGLTQEKISPQGFAIQCRVTTEDPAKNFQPDTGRIEVFRSGEGMGIRLDGASAFAGAIISPYYDSLLVKVIAHAADLQSSCAKMNRALREFRVRGVKTNIPFLLNVLTNQKFVNGAVDTYFIDENPQLFTLQPTKNRAQKLLNYLGTVLVNGPSTPLATPLLPAEVTPPVPEIPLGKLINTFDMAGLLKPRAAKLLIGAIREKHPDIPIHIHTHDTSGAGVASMIACAEAGADVVDVAVDSMSGMTSQPSMGAVVASLQGSDIDTGLDLKDISAYSAYWEQTRQLYAPFECTTTMKSGNADVYLNEIPGGQYTNLQFQAYSLGLGEFFEDVKKAYREANLLLGDIIKVTPSSKVVGDFAQFMVQNKLTSEEVLARAEELSFPKSVVEFLQGAIGTPYQGFPEPLRSKVLKDMPRIEGRPGASLPPFDFGKLKTELQERHPEATDRDVMSAALYPQVTEDYLTFRESFGPVDKLDTRIFLTGPKVGEEFEVKIQPPQGFRQILKSKGPEAFAKAVRQNKSLLLMDTTFRDAHQSLLATRVRSHDLLKISPFVAHKFNNLYSLENWGGATFDVALRFLHECPWERLEEMRKQIPNIPFQMLLRGANAVGYTNYPDNEMHIHPKAAKSVPGQVGAPMPGSVMEIRVKVGDKVEKGAALVVLSAMKMEMVVQAPVQGVVKSIDASMLLRGANAVGYTNYPDNVVYKFCDLSVQVGMDVFRVFDSLNYLPNLILGMEAAGKAGGVVEAAISYTGDVSDPSKKKYDLKYYQNLADELVKAGTHVLCIKVRILLSPVNKS
cccccccccccEEcccccccccccccHHHHHHHHHHccccEEccccccccccHHHHHHHHHcccEEEcccHHHHHHHccHHHHHHHHHHcccccccccccccccHHHHHHHHHHccccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEccccccEEEEEEEEcccccEEEEcccccHHHcccccEEEEcccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccEEEEEcccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccEEEEEEEccccccccccccccEEcEEEcccccEEEEcccccccccEEcccccccHHEEEEccccHHHHHHHHHHHHccEEEEcccccHHHHHHHHccccccccEEEEcccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHcHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccHHHHHcccccccccHHHHHHcccccccccccccHHHHHHHHccccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHccccccccccccccccccccEEEEEEccccEEEEEEccccHHHHHHHHcccEEEEEEEccccccccccHHHHHcHHHHHcccHHHHHHcccccccccccccHHHHHHHHccccHHHHHHHHHHHcccccEEEEEEccccccccccccccEEEEcccccccccccccccccEEEEEEEEcccEEcccccHHHHccccccccccccccccccccHHHHHccccccccccccccHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHcccEEEEEEccccccccccccccHHHHHHHHHHHHHccccEEEHHccccccccccc
cccHHEccccHEEccccccHHHccccHHHHHHHHHHHcccEEEcccccccccHHHHHHHHHcccEEccccHHHHHHHHcHHHHHHHHHHHcccEccEcccccccHHHHHHHHHHHcccEEEEEccccccccEEEEccHHHHHHHHHHHHHHHHHHcccccEEEEEcccccEEEEEEEEEEccccEEEEEEEEEEEEEccEEEEEEEccccccHHHHHHHHHHHHHHHHHHccEEEEEEEEEEEccEEEEEEEEEccccccHHHHHHHHcccHHHHHHHHHcccccccccccHHHEEEcEEEEEEEEEcccccccccccccEEEEEEcccccEEEEcccccccccEEcccccHHHEEEEEccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccccccccEccEEHcccccEEEEcccccHHHHHHHHHHHHHccccccccccccccHHccccccHcccccccccccHHHHccHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHcccHHHHHHHHHccccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccHHEHccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHccHEEEcccccHHHHHHHHHHHccccHHHHHcccccccccHHHHHHHHcccccccccccHHHHHHHHccccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHcHHHHHHHHHHHHHcccccccccccEEcccccccEEEEEEccccHHHHHHHHccccEEEEEcccccEEEEEcccHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccEEHHHcccHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccccccccEEEEEHHcccEEcccccEEEEcccccHHHHHHHHHHHcccccEEEEEEcccccccccccHHHHHHHHHHHHHccccEEEEEccHcHHHHHHHHHHHHHHcccEEEEEEEEcccccccccccccHHHHHHHHHHHHHHcccEEEEHHHHcccHHHcc
mhmhrqkadesylvgkglppveaylnIPEIIRVAkendvdaihpgygflseRSDFAQAVLDAgirfigpspyvVQQMGDKVAARQAaidsgvpivpgtpgpittTEEAMEFCLKYglpvifkaayggggrgmrVVRKMEDVEENFQRASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGDKAGNVVHLYERDCSVQRRHQKVveiapaphldinvRNKMTDLAVKLAKHvgysnagtveflcdesgqfyfiEVNARlqvehtvteeitgvdlVQSQIRVaegmtlpelgltqekispqgfaiqcrvttedpaknfqpdtgrievfrsgegmgirldgASAFAGAIISPYYDSLLVKVIAHAADLQSSCAKMNRALREFRVRGVKTNIPFLLNVLTnqkfvngavdtyfidenpqlftlqptKNRAQKLLNYLGTvlvngpstplatpllpaevtppvpeiplgklintfdmagLLKPRAAKLLIGAIrekhpdipihihthdtsgaGVASMIACAEAGADVVDVAVDsmsgmtsqpsMGAVVASLqgsdidtgldlkdISAYSAYWEQTRQlyapfectttmksgnadvylneipggqytnlQFQAYSLGLGEFFEDVKKAYREANLLLGdiikvtpsskvvgdFAQFMVQNKLTSEEVLARAEELSFPKSVVEFLQgaigtpyqgfpeplrskvlkdmpriegrpgaslppfdfgklKTELqerhpeatdrdvmsaalypqvTEDYLTFresfgpvdkldtrifltgpkvgeefevkiqppqgfRQILKSKGPEAFAKAVRQNKSLLLMDTTFRDAHQSLLATRVrshdllkispfvahkfnnlYSLENWGGATFDVALRFLHECPWERLEEMRkqipnipfqmllrganavgytnypdnemhihpkaaksvpgqvgapmpgsVMEIRVKVGDKVEKGAALVVLSAMKMEMVVQAPVQGVVKSIDASMLLRganavgytnypdnvvyKFCDLSVQVGMDVFRVFdslnylpnliLGMEAAGKAGGVVEAAISytgdvsdpskkkydlKYYQNLADELVKAGTHVLCIKVRILLSPVNKS
mhmhrqkadesylvgkglPPVEAYLNIPEIIRVAKENDVDAIHPGYGFLSERSDFAQAVLDAGIRFIGPSPYVVQQMGDKVAARQAAidsgvpivpgtpgPITTTEEAMEFCLKYGLPVIFKAAYGGGGRGMRVVRKMEDVEENFQRASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGDKAGNVVHLYERDCSVQRRHQKVVeiapaphldinvRNKMTDLAVKLAKHVGYSNAGTVEFLCDESGQFYFIEVNARLQVEHTVteeitgvdlvqSQIRVAEGMTLPELGLTQEKISPQGFAIQCRVTtedpaknfqpdtGRIEVFRSGEGMGIRLDGASAFAGAIISPYYDSLLVKVIAHAADLQSSCAKMNRALREFRVRGVKTNIPFLLNVLTNQKFVNGAVDTYFIDENPQLFTLQPTKNRAQKLLNYLGTVLVNGPSTPLATPLLPAEVTPPVPEIPLGKLINTFDMAGLLKPRAAKLLIGAIREKHPDIPIHIHTHDTSGAGVASMIACAEAGADVVDVAVDSMSGMTSQPSMGAVVASLQGSDIDTGLDLKDISAYSAYWEQTRQLYAPFECTTTMKSGNADVYLNEIPGGQYTNLQFQAYSLGLGEFFEDVKKAYREANLLLGDIIKVTPSSKVVGDFAQFMVQNKLTSEEVLARAEELSFPKSVVEFLQGAigtpyqgfpepLRSKVLKDMPRIEgrpgaslppfdFGKLKTELQERHpeatdrdvmsaaLYPQVTEDYLTFResfgpvdkldTRIFLTGPKVGEEFEVKIQPPQGFRQILKSKGPEAFAKAVRQNKSLLLMDTTFRDAHQSLLATRVRSHDLLKISPFVAHKFNNLYSLENWGGATFDVALRFLHECPWERLEEMRKQIPNIPFQMLLRGANAVGYTNYPDNEMHIHPKAAKSVPGQVGAPMPGSVMEIRVKVGDKVEKGAALVVLSAMKMEMVVQAPVQGVVKSIDASMLLRGANAVGYTNYPDNVVYKFCDLSVQVGMDVFRVFDSLNYLPNLILGMEAAGKAGGVVEAAIsytgdvsdpskkkYDLKYYQNLADELVKAGTHVLCIKVrillspvnks
MHMHRQKADESYLVGKGLPPVEAYLNIPEIIRVAKENDVDAIHPGYGFLSERSDFAQAVLDAGIRFIGPSPYVVQQMGDKVAARQAAIDSgvpivpgtpgpitttEEAMEFCLKYGLPVIFKAAYggggrgmrvvrKMEDVEENFQRASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGDKAGNVVHLYERDCSVQRRHQKVVEIAPAPHLDINVRNKMTDLAVKLAKHVGYSNAGTVEFLCDESGQFYFIEVNARLQVEHTVTEEITGVDLVQSQIRVAEGMTLPELGLTQEKISPQGFAIQCRVTTEDPAKNFQPDTGRIEVFRSGEGMGIRLDGASAFAGAIISPYYDSLLVKVIAHAADLQSSCAKMNRALREFRVRGVKTNIPFLLNVLTNQKFVNGAVDTYFIDENPQLFTLQPTKNRAQKLLNYLGTVLVNGPStplatpllpaevtppvpeIPLGKLINTFDMAGLLKPRAAKLLIGAIREKhpdipihihthdtSGAGVASMIACaeagadvvdvavdSMSGMTSQPSMGAVVASLQGSDIDTGLDLKDISAYSAYWEQTRQLYAPFECTTTMKSGNADVYLNEIPGGQYTNLQFQAYSLGLGEFFEDVKKAYREANLLLGDIIKVTPSSKVVGDFAQFMVQNKLTSEEVLARAEELSFPKSVVEFLQGAIGTPYQGFPEPLRSKVLKDMPRIEGRPGASLPPFDFGKLKTELQERHPEATDRDVMSAALYPQVTEDYLTFRESFGPVDKLDTRIFLTGPKVGEEFEVKIQPPQGFRQILKSKGPEAFAKAVRQNKSLLLMDTTFRDAHQSLLATRVRSHDLLKISPFVAHKFNNLYSLENWGGATFDVALRFLHECPWERLEEMRKQIPNIPFQMLLRGANAVGYTNYPDNEMHIHPKAAKSVPGQVGAPMPGSVMEIRVKVGDKVEKGAALVVLSAMKMEMVVQAPVQGVVKSIDASMLLRGANAVGYTNYPDNVVYKFCDLSVQVGMDVFRVFDSLNYLPNLILgmeaagkaggvveaaISYTGDVSDPSKKKYDLKYYQNLADELVKAGTHVLCIKVRILLSPVNKS
***********YLVGKGLPPVEAYLNIPEIIRVAKENDVDAIHPGYGFLSERSDFAQAVLDAGIRFIGPSPYVVQQMGDKVAARQAAIDSGVPIVPGTPGPITTTEEAMEFCLKYGLPVIFKAAYGGGGRGMRVVRK****************AAFGNGAMFIEKFIERPRHIEVQLLGDKAGNVVHLYERDCSVQRRHQKVVEIAPAPHLDINVRNKMTDLAVKLAKHVGYSNAGTVEFLCDESGQFYFIEVNARLQVEHTVTEEITGVDLVQSQIRVAEGMTLPELGLTQEKISPQGFAIQCRVTTE*********TGRIEVFRSGEGMGIRLDGASAFAGAIISPYYDSLLVKVIAHAADLQSSCAKMNRALREFRVRGVKTNIPFLLNVLTNQKFVNGAVDTYFIDENPQLFTLQPTKNRAQKLLNYLGTVLVNGPSTPLATPLLPAEVTPPVPEIPLGKLINTFDMAGLLKPRAAKLLIGAIREKHPDIPIHIHTHDTSGAGVASMIACAEAGADVVDVAVD*************VVASLQGSDIDTGLDLKDISAYSAYWEQTRQLYAPFECTTTMKSGNADVYLNEIPGGQYTNLQFQAYSLGLGEFFEDVKKAYREANLLLGDIIKVTPSSKVVGDFAQFMVQNKLTSEEVLARAEELSFPKSVVEFLQGAIGTPYQGF************************************************SAALYPQVTEDYLTFRESFGPVDKLDTRIFLTGPKVGEEFEVKIQPPQGFRQIL******AFAKAVRQNKSLLLMDTTFRDAHQSLLATRVRSHDLLKISPFVAHKFNNLYSLENWGGATFDVALRFLHECPWERLEEMRKQIPNIPFQMLLRGANAVGYTNYPDN***********************VMEIRVKVGDKVEKGAALVVLSAMKMEMVVQAPVQGVVKSIDASMLLRGANAVGYTNYPDNVVYKFCDLSVQVGMDVFRVFDSLNYLPNLILGMEAAGKAGGVVEAAISYTGDVSDPSKKKYDLKYYQNLADELVKAGTHVLCIKVRILLS*****
MHMHRQKADESYLVGKGLPPVEAYLNIPEIIRVAKENDVDAIHPGYGFLSERSDFAQAVLDAGIRFIGPSPYVVQQMGDKVAARQAAIDSGVPIVPGTPGPITTTEEAMEFCLKYGLPVIFKAAYGGGGRGMRVVRKMEDVEENFQRASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGDKAGNVVHLYERDCSVQRRHQKVVEIAPAPHLDINVRNKMTDLAVKLAKHVGYSNAGTVEFLCDESGQFYFIEVNARLQVEHTVTEEITGVDLVQSQIRVAEGMTLPELGLTQEKISPQGFAIQCRVTTEDPAKNFQPDTGRIEVFRSGEGMGIRLDGASAFAGAIISPYYDSLLVKVIAHAADLQSSCAKMNRALREFRVRGVKTNIPFLLNVLTNQKFVNGAVDTYFIDENPQLFTL*P**NRAQKLLNYLGTVLVNGP****************V************DMAGLLKPRAAKLLIGAIREKHPDIPIHIHTHDTSGAGVASMIACAEAGADVVDVAVDSMSGMTSQPSMGAVVASLQGSDIDTGLDLKDISAYSAYWEQTRQLYAPFECTTTMKSGNADVYLNEIPGGQYTNLQFQAYSLGLGEFFEDVKKAYREANLLLGDIIKVTPSSKVVGDFAQFMVQNKLTSEEVLARAEELSFPKSVVEFLQGAIGTPYQGFPEPLRSKVLKDMPRIEGRPGASLPPFDFGKLKTE*******ATDRDVMSAALYPQVTEDYLTFRESFGPVDKLDTRIFLTGPKVGEEFEVKIQPPQGFRQILKSKGPEAFAKAVRQNKSLLLMDTTFRDAHQSLLATRVRSHDLLKISPFVAHKFNNLYSLENWGGATFDVALRFLHECPWERLEEMRKQIPNIPFQMLLRGANAVGYTNYPDNEMHIHPKAAKSVPGQVGAPMPGSVMEIRVKVGDKVEKGAALVVLSAMKMEMVVQAPVQGVVKSIDASMLLRGANAVGYTNYPDNVVYKFCDLSVQVGMDVFRVFDSLNYLPNLILGMEAAGKAGGVVEAAISYTGDVSDPSKKKYDLKYYQNLADELVKAGTHVLCIKVRILLSPV***
**********SYLVGKGLPPVEAYLNIPEIIRVAKENDVDAIHPGYGFLSERSDFAQAVLDAGIRFIGPSPYVVQQMGDKVAARQAAIDSGVPIVPGTPGPITTTEEAMEFCLKYGLPVIFKAAYGGGGRGMRVVRKMEDVEENFQRASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGDKAGNVVHLYERDCSVQRRHQKVVEIAPAPHLDINVRNKMTDLAVKLAKHVGYSNAGTVEFLCDESGQFYFIEVNARLQVEHTVTEEITGVDLVQSQIRVAEGMTLPELGLTQEKISPQGFAIQCRVTTEDPAKNFQPDTGRIEVFRSGEGMGIRLDGASAFAGAIISPYYDSLLVKVIAHAADLQSSCAKMNRALREFRVRGVKTNIPFLLNVLTNQKFVNGAVDTYFIDENPQLFTLQPTKNRAQKLLNYLGTVLVNGPSTPLATPLLPAEVTPPVPEIPLGKLINTFDMAGLLKPRAAKLLIGAIREKHPDIPIHIHTHDTSGAGVASMIACAEAGADVVDVAVDSMSGMTSQPSMGAVVASLQGSDIDTGLDLKDISAYSAYWEQTRQLYAPFECTTTMKSGNADVYLNEIPGGQYTNLQFQAYSLGLGEFFEDVKKAYREANLLLGDIIKVTPSSKVVGDFAQFMVQNKLTSEEVLARAEELSFPKSVVEFLQGAIGTPYQGFPEPLRSKVLKDMPRIEGRPGASLPPFDFGKLKTELQERHPEATDRDVMSAALYPQVTEDYLTFRESFGPVDKLDTRIFLTGPKVGEEFEVKIQPPQGFRQILKSKGPEAFAKAVRQNKSLLLMDTTFRDAHQSLLATRVRSHDLLKISPFVAHKFNNLYSLENWGGATFDVALRFLHECPWERLEEMRKQIPNIPFQMLLRGANAVGYTNYPDNEMHIHPKAAKSVPGQVGAPMPGSVMEIRVKVGDKVEKGAALVVLSAMKMEMVVQAPVQGVVKSIDASMLLRGANAVGYTNYPDNVVYKFCDLSVQVGMDVFRVFDSLNYLPNLILGMEAAGKAGGVVEAAISYTGDVSDPSKKKYDLKYYQNLADELVKAGTHVLCIKVRILLSPVNKS
MHMHRQKADESYLVGKGLPPVEAYLNIPEIIRVAKENDVDAIHPGYGFLSERSDFAQAVLDAGIRFIGPSPYVVQQMGDKVAARQAAIDSGVPIVPGTPGPITTTEEAMEFCLKYGLPVIFKAAYGGGGRGMRVVRKMEDVEENFQRASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGDKAGNVVHLYERDCSVQRRHQKVVEIAPAPHLDINVRNKMTDLAVKLAKHVGYSNAGTVEFLCDESGQFYFIEVNARLQVEHTVTEEITGVDLVQSQIRVAEGMTLPELGLTQEKISPQGFAIQCRVTTEDPAKNFQPDTGRIEVFRSGEGMGIRLDGASAFAGAIISPYYDSLLVKVIAHAADLQSSCAKMNRALREFRVRGVKTNIPFLLNVLTNQKFVNGAVDTYFIDENPQLFTLQPTKNRAQKLLNYLGTVLVNGPSTPLATPLLPAEVTPPVPEIPLGKLINTFDMAGLLKPRAAKLLIGAIREKHPDIPIHIHTHDTSGAGVASMIACAEAGADVVDVAVDSMSGMTSQPSMGAVVASLQGSDIDTGLDLKDISAYSAYWEQTRQLYAPFECTTTMKSGNADVYLNEIPGGQYTNLQFQAYSLGLGEFFEDVKKAYREANLLLGDIIKVTPSSKVVGDFAQFMVQNKLTSEEVLARAEELSFPKSVVEFLQGAIGTPYQGFPEPLRSKVLKDMPRIEGRPGASLPPFDFGKLKTELQERHPEATDRDVMSAALYPQVTEDYLTFRESFGPVDKLDTRIFLTGPKVGEEFEVKIQPPQGFRQILKSKGPEAFAKAVRQNKSLLLMDTTFRDAHQSLLATRVRSHDLLKISPFVAHKFNNLYSLENWGGATFDVALRFLHECPWERLEEMRKQIPNIPFQMLLRGANAVGYTNYPDNEMHIHPKAAKSVPGQVGAPMPGSVMEIRVKVGDKVEKGAALVVLSAMKMEMVVQAPVQGVVKSIDASMLLRGANAVGYTNYPDNVVYKFCDLSVQVGMDVFRVFDSLNYLPNLILGMEAAGKAGGVVEAAISYTGDVSDPSKKKYDLKYYQNLADELVKAGTHVLCIKVRILLSPV***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHMHRQKADESYLVGKGLPPVEAYLNIPEIIRVAKENDVDAIHPGYGFLSERSDFAQAVLDAGIRFIGPSPYVVQQMGDKVAARQAAIDSGVPIVPGTPGPITTTEEAMEFCLKYGLPVIFKAAYGGGGRGMRVVRKMEDVEENFQRASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGDKAGNVVHLYERDCSVQRRHQKVVEIAPAPHLDINVRNKMTDLAVKLAKHVGYSNAGTVEFLCDESGQFYFIEVNARLQVEHTVTEEITGVDLVQSQIRVAEGMTLPELGLTQEKISPQGFAIQCRVTTEDPAKNFQPDTGRIEVFRSGEGMGIRLDGASAFAGAIISPYYDSLLVKVIAHAADLQSSCAKMNRALREFRVRGVKTNIPFLLNVLTNQKFVNGAVDTYFIDENPQLFTLQPTKNRAQKLLNYLGTVLVNGPSTPLATPLLPAEVTPPVPEIPLGKLINTFDMAGLLKPRAAKLLIGAIREKHPDIPIHIHTHDTSGAGVASMIACAEAGADVVDVAVDSMSGMTSQPSMGAVVASLQGSDIDTGLDLKDISAYSAYWEQTRQLYAPFECTTTMKSGNADVYLNEIPGGQYTNLQFQAYSLGLGEFFEDVKKAYREANLLLGDIIKVTPSSKVVGDFAQFMVQNKLTSEEVLARAEELSFPKSVVEFLQGAIGTPYQGFPEPLRSKVLKDMPRIEGRPGASLPPFDFGKLKTELQERHPEATDRDVMSAALYPQVTEDYLTFRESFGPVDKLDTRIFLTGPKVGEEFEVKIQPPQGFRQILKSKGPEAFAKAVRQNKSLLLMDTTFRDAHQSLLATRVRSHDLLKISPFVAHKFNNLYSLENWGGATFDVALRFLHECPWERLEEMRKQIPNIPFQMLLRGANAVGYTNYPDNEMHIHPKAAKSVPGQVGAPMPGSVMEIRVKVGDKVEKGAALVVLSAMKMEMVVQAPVQGVVKSIDASMLLRGANAVGYTNYPDNVVYKFCDLSVQVGMDVFRVFDSLNYLPNLILGMEAAGKAGGVVEAAISYTGDVSDPSKKKYDLKYYQNLADELVKAGTHVLCIKVRILLSPVNKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1080 2.2.26 [Sep-21-2011]
P114981178 Pyruvate carboxylase, mit yes N/A 0.426 0.391 0.716 0.0
O177321175 Pyruvate carboxylase 1 OS yes N/A 0.425 0.391 0.722 0.0
Q29RK21178 Pyruvate carboxylase, mit yes N/A 0.414 0.380 0.728 0.0
P528731178 Pyruvate carboxylase, mit yes N/A 0.415 0.381 0.720 0.0
Q059201178 Pyruvate carboxylase, mit yes N/A 0.409 0.375 0.729 0.0
Q9UUE11185 Pyruvate carboxylase OS=S yes N/A 0.423 0.385 0.596 1e-154
P323271180 Pyruvate carboxylase 2 OS yes N/A 0.432 0.395 0.588 1e-152
P111541178 Pyruvate carboxylase 1 OS no N/A 0.432 0.396 0.596 1e-150
Q9HES81192 Pyruvate carboxylase OS=A yes N/A 0.429 0.389 0.581 1e-149
O939181193 Pyruvate carboxylase OS=A N/A N/A 0.422 0.382 0.580 1e-146
>sp|P11498|PYC_HUMAN Pyruvate carboxylase, mitochondrial OS=Homo sapiens GN=PC PE=1 SV=2 Back     alignment and function desciption
 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/462 (71%), Positives = 387/462 (83%)

Query: 2   HMHRQKADESYLVGKGLPPVEAYLNIPEIIRVAKENDVDAIHPGYGFLSERSDFAQAVLD 61
            MHRQKADE+YL+G+GL PV+AYL+IP+II+VAKEN+VDA+HPGYGFLSER+DFAQA  D
Sbjct: 74  QMHRQKADEAYLIGRGLAPVQAYLHIPDIIKVAKENNVDAVHPGYGFLSERADFAQACQD 133

Query: 62  AGIRFIGPSPYVVQQMGDKVAARQAAIDSGVPIVPGTPGPITTTEEAMEFCLKYGLPVIF 121
           AG+RFIGPSP VV++MGDKV AR  AI +GVP+VPGT  PIT+  EA EF   YG P+IF
Sbjct: 134 AGVRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTDAPITSLHEAHEFSNTYGFPIIF 193

Query: 122 KAAYGGGGRGMRVVRKMEDVEENFQRASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGDK 181
           KAAYGGGGRGMRVV   E++EEN+ RA SEA AAFGNGA+F+EKFIE+PRHIEVQ+LGD+
Sbjct: 194 KAAYGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDQ 253

Query: 182 AGNVVHLYERDCSVQRRHQKVVEIAPAPHLDINVRNKMTDLAVKLAKHVGYSNAGTVEFL 241
            GN++HLYERDCS+QRRHQKVVEIAPA HLD  +R ++T  +VKLAK VGY NAGTVEFL
Sbjct: 254 YGNILHLYERDCSIQRRHQKVVEIAPAAHLDPQLRTRLTSDSVKLAKQVGYENAGTVEFL 313

Query: 242 CDESGQFYFIEVNARLQVEHTVTEEITGVDLVQSQIRVAEGMTLPELGLTQEKISPQGFA 301
            D  G+ YFIEVN+RLQVEHTVTEEIT VDLV +QI VAEG +LP+LGL QE I   G A
Sbjct: 314 VDRHGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHVAEGRSLPDLGLRQENIRINGCA 373

Query: 302 IQCRVTTEDPAKNFQPDTGRIEVFRSGEGMGIRLDGASAFAGAIISPYYDSLLVKVIAHA 361
           IQCRVTTEDPA++FQPDTGRIEVFRSGEGMGIRLD ASAF GA+ISP+YDSLLVKVIAH 
Sbjct: 374 IQCRVTTEDPARSFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVISPHYDSLLVKVIAHG 433

Query: 362 ADLQSSCAKMNRALREFRVRGVKTNIPFLLNVLTNQKFVNGAVDTYFIDENPQLFTLQPT 421
            D  ++  KM+RAL EFRVRGVKTNI FL NVL NQ+F+ G VDT FIDENP+LF L+P 
Sbjct: 434 KDHPTAATKMSRALAEFRVRGVKTNIAFLQNVLNNQQFLAGTVDTQFIDENPELFQLRPA 493

Query: 422 KNRAQKLLNYLGTVLVNGPSTPLATPLLPAEVTPPVPEIPLG 463
           +NRAQKLL+YLG V+VNGP+TP+     P+   P VP +P+G
Sbjct: 494 QNRAQKLLHYLGHVMVNGPTTPIPVKASPSPTDPVVPAVPIG 535
Pyruvate carboxylase catalyzes a 2-step reaction, involving the ATP-dependent carboxylation of the covalently attached biotin in the first step and the transfer of the carboxyl group to pyruvate in the second. Catalyzes in a tissue specific manner, the initial reactions of glucose (liver, kidney) and lipid (adipose tissue, liver, brain) synthesis from pyruvate.
Homo sapiens (taxid: 9606)
EC: 6EC: .EC: 4EC: .EC: 1EC: .EC: 1
>sp|O17732|PYC1_CAEEL Pyruvate carboxylase 1 OS=Caenorhabditis elegans GN=pyc-1 PE=1 SV=1 Back     alignment and function description
>sp|Q29RK2|PYC_BOVIN Pyruvate carboxylase, mitochondrial OS=Bos taurus GN=PC PE=2 SV=2 Back     alignment and function description
>sp|P52873|PYC_RAT Pyruvate carboxylase, mitochondrial OS=Rattus norvegicus GN=Pc PE=1 SV=2 Back     alignment and function description
>sp|Q05920|PYC_MOUSE Pyruvate carboxylase, mitochondrial OS=Mus musculus GN=Pc PE=1 SV=1 Back     alignment and function description
>sp|Q9UUE1|PYC_SCHPO Pyruvate carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pyr1 PE=3 SV=1 Back     alignment and function description
>sp|P32327|PYC2_YEAST Pyruvate carboxylase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PYC2 PE=1 SV=2 Back     alignment and function description
>sp|P11154|PYC1_YEAST Pyruvate carboxylase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PYC1 PE=1 SV=2 Back     alignment and function description
>sp|Q9HES8|PYC_ASPNG Pyruvate carboxylase OS=Aspergillus niger GN=pyc PE=3 SV=1 Back     alignment and function description
>sp|O93918|PYC_ASPTE Pyruvate carboxylase OS=Aspergillus terreus GN=pyc PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1080
328788708 1213 PREDICTED: pyruvate carboxylase, mitocho 0.441 0.393 0.857 0.0
3800212961179 PREDICTED: pyruvate carboxylase, mitocho 0.427 0.391 0.880 0.0
380021294 1196 PREDICTED: pyruvate carboxylase, mitocho 0.427 0.386 0.880 0.0
3454959931180 PREDICTED: pyruvate carboxylase, mitocho 0.452 0.414 0.824 0.0
156540073 1196 PREDICTED: pyruvate carboxylase, mitocho 0.427 0.386 0.863 0.0
3454959911124 PREDICTED: pyruvate carboxylase, mitocho 0.427 0.411 0.863 0.0
3286995511180 PREDICTED: pyruvate carboxylase, mitocho 0.428 0.392 0.876 0.0
307169536 1196 Pyruvate carboxylase, mitochondrial [Cam 0.427 0.386 0.874 0.0
328699549 1196 PREDICTED: pyruvate carboxylase, mitocho 0.426 0.385 0.878 0.0
3227996371141 hypothetical protein SINV_13812 [Solenop 0.427 0.404 0.878 0.0
>gi|328788708|ref|XP_003251170.1| PREDICTED: pyruvate carboxylase, mitochondrial-like [Apis mellifera] Back     alignment and taxonomy information
 Score =  833 bits (2153), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/484 (85%), Positives = 447/484 (92%), Gaps = 7/484 (1%)

Query: 1   MHMHRQKADESYLVGKGLPPVEAYLNIPEIIRVAKENDVDAIHPGYGFLSERSDFAQAVL 60
           M MHRQKADE Y+VG+GLPPV+AYLNIPEII+VAKEN+VDAIHPGYGFLSERSDFA+AV+
Sbjct: 89  MQMHRQKADEGYVVGRGLPPVQAYLNIPEIIKVAKENNVDAIHPGYGFLSERSDFAEAVI 148

Query: 61  DAGIRFIGPSPYVVQQMGDKVAARQAAIDSGVPIVPGTPGPITTTEEAMEFCLKYGLPVI 120
           +AGIRFIGPSP VVQQMGDKVAARQAAID+GVPIVPGT GP+TT++EAMEFC+K+GLPVI
Sbjct: 149 NAGIRFIGPSPKVVQQMGDKVAARQAAIDAGVPIVPGTDGPVTTSDEAMEFCMKHGLPVI 208

Query: 121 FKAAYGGGGRGMRVVRKMEDVEENFQRASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGD 180
           FKAAYGGGGRGMRVVR ME+V E F RASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGD
Sbjct: 209 FKAAYGGGGRGMRVVRHMEEVREMFDRASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGD 268

Query: 181 KAGNVVHLYERDCSVQRRHQKVVEIAPAPHLDINVRNKMTDLAVKLAKHVGYSNAGTVEF 240
           +AGNVVHLYERDCSVQRRHQKVVEIAPAP LD  VRNKMT+ AV+LAKHVGYSNAGTVEF
Sbjct: 269 QAGNVVHLYERDCSVQRRHQKVVEIAPAPRLDPKVRNKMTEHAVRLAKHVGYSNAGTVEF 328

Query: 241 LCDESGQFYFIEVNARLQVEHTVTEEITGVDLVQSQIRVAEGMTLPELGLTQEKISPQGF 300
           L DESG FYFIEVNARLQVEHTVTEEITG+DLVQSQIR+AEG+TLPELG+TQEKI PQGF
Sbjct: 329 LADESGNFYFIEVNARLQVEHTVTEEITGIDLVQSQIRIAEGITLPELGMTQEKIVPQGF 388

Query: 301 AIQCRVTTEDPAKNFQPDTGRIEVFRSGEGMGIRLDGASAFAGAIISPYYDSLLVKVIAH 360
           AIQCRVTTEDPAKNFQPDTGRIEVFRSGEGMGIRLDGASAFAGAIISPYYDSLLVKVIAH
Sbjct: 389 AIQCRVTTEDPAKNFQPDTGRIEVFRSGEGMGIRLDGASAFAGAIISPYYDSLLVKVIAH 448

Query: 361 AADLQSSCAKMNRALREFRVRGVKTNIPFLLNVLTNQKFVNGAVDTYFIDENPQLFTLQP 420
           A DLQSSCAKMNRALREFRVRGVKTNIPFLLNVL NQKF+NG VDTYFIDENPQLF  QP
Sbjct: 449 AGDLQSSCAKMNRALREFRVRGVKTNIPFLLNVLENQKFLNGKVDTYFIDENPQLFQFQP 508

Query: 421 TKNRAQKLLNYLGTVLVNGPSTPLATPLLPAEVTPPVPEIPL--GKLI-----NTFDMAG 473
           ++NRAQKLLNYLG+VLVNGPSTPLATPL PAE+ P +P++ L   KL      N  D  G
Sbjct: 509 SQNRAQKLLNYLGSVLVNGPSTPLATPLKPAEIKPHIPQVALDFAKLAAAEENNDPDATG 568

Query: 474 LLKP 477
           +L+P
Sbjct: 569 VLEP 572

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380021296|ref|XP_003694505.1| PREDICTED: pyruvate carboxylase, mitochondrial isoform 2 [Apis florea] Back     alignment and taxonomy information
>gi|380021294|ref|XP_003694504.1| PREDICTED: pyruvate carboxylase, mitochondrial isoform 1 [Apis florea] Back     alignment and taxonomy information
>gi|345495993|ref|XP_003427616.1| PREDICTED: pyruvate carboxylase, mitochondrial-like isoform 4 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|156540073|ref|XP_001600219.1| PREDICTED: pyruvate carboxylase, mitochondrial-like isoform 1 [Nasonia vitripennis] gi|345495988|ref|XP_003427614.1| PREDICTED: pyruvate carboxylase, mitochondrial-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345495991|ref|XP_003427615.1| PREDICTED: pyruvate carboxylase, mitochondrial-like isoform 3 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|328699551|ref|XP_003240970.1| PREDICTED: pyruvate carboxylase, mitochondrial-like isoform 3 [Acyrthosiphon pisum] gi|328699553|ref|XP_001944200.2| PREDICTED: pyruvate carboxylase, mitochondrial-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307169536|gb|EFN62178.1| Pyruvate carboxylase, mitochondrial [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328699549|ref|XP_003240969.1| PREDICTED: pyruvate carboxylase, mitochondrial-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|322799637|gb|EFZ20909.1| hypothetical protein SINV_13812 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1080
FB|FBgn00275801197 CG1516 [Drosophila melanogaste 0.407 0.367 0.813 0.0
ZFIN|ZDB-GENE-090908-31181 pcl "pyruvate carboxylase, lik 0.406 0.371 0.692 4.9e-285
ZFIN|ZDB-GENE-000831-11181 pc "pyruvate carboxylase" [Dan 0.405 0.370 0.691 1.1e-283
UNIPROTKB|Q29RK21178 PC "Pyruvate carboxylase, mito 0.406 0.372 0.692 1e-282
UNIPROTKB|F1P6G91178 PC "Pyruvate carboxylase" [Can 0.406 0.372 0.690 1.9e-281
MGI|MGI:975201178 Pcx "pyruvate carboxylase" [Mu 0.406 0.372 0.687 1.2e-279
UNIPROTKB|P114981178 PC "Pyruvate carboxylase, mito 0.406 0.372 0.690 3.1e-279
WB|WBGene000042581175 pyc-1 [Caenorhabditis elegans 0.406 0.373 0.678 8.3e-279
RGD|32621178 Pc "pyruvate carboxylase" [Rat 0.406 0.372 0.690 1.7e-278
ASPGD|ASPL00000745431196 pycA [Emericella nidulans (tax 0.408 0.368 0.557 1.4e-229
FB|FBgn0027580 CG1516 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1859 (659.5 bits), Expect = 0., Sum P(3) = 0.
 Identities = 358/440 (81%), Positives = 393/440 (89%)

Query:     1 MHMHRQKADESYLVGKGLPPVEAYLNIPEIIRVAKENDVDAIHPGYGFLSERSDFAQAVL 60
             MHMHRQKADESY+VGKGLPPVEAYLNIPE+IRV KENDVDA+HPGYGFLSERSDFAQAV+
Sbjct:    75 MHMHRQKADESYIVGKGLPPVEAYLNIPELIRVCKENDVDAVHPGYGFLSERSDFAQAVI 134

Query:    61 DAGIRFIGPSPYVVQQMGDKVAARQAAIDSXXXXXXXXXXXXXXXEEAMEFCLKYGLPVI 120
             DAG+RFIGPSP VVQ+MGDKVAAR AAI++               EEA+EFC K+GLPVI
Sbjct:   135 DAGLRFIGPSPEVVQKMGDKVAARVAAIEAGVPIVPGTDGPVTTKEEALEFCKKHGLPVI 194

Query:   121 FKAAYXXXXXXXXXXXKMEDVEENFQRASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGD 180
             FKAAY           KMEDVEE+FQRASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGD
Sbjct:   195 FKAAYGGGGRGMRVVRKMEDVEESFQRASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGD 254

Query:   181 KAGNVVHLYERDCSVQRRHQKVVEIAPAPHLDINVRNKMTDLAVKLAKHVGYSNAGTVEF 240
             KAGNVVHLYERDCSVQRRHQKVVEIAPAP L I +R+KMT+ AV+LA+HVGY NAGTVEF
Sbjct:   255 KAGNVVHLYERDCSVQRRHQKVVEIAPAPRLPIEIRDKMTEAAVRLARHVGYENAGTVEF 314

Query:   241 LCDESGQFYFIEVNARLQVEHTVTEEITGVDLVQSQIRVAEGMTLPELGLTQEKISPQGF 300
             LCDESG FYFIEVNARLQVEHTVTEEITG+DLVQSQIRVAEGMTLPELG TQ+KI P+G+
Sbjct:   315 LCDESGNFYFIEVNARLQVEHTVTEEITGIDLVQSQIRVAEGMTLPELGYTQDKIVPRGY 374

Query:   301 AIQCRVTTEDPAKNFQPDTGRIEVFRSGEGMGIRLDGASAFAGAIISPYYDSLLVKVIAH 360
             AIQCRVTTEDPA +FQP+TGR+EVFRSGEGMGIRLD ASA+AGAIISPYYDSLLVKVI+H
Sbjct:   375 AIQCRVTTEDPANDFQPNTGRLEVFRSGEGMGIRLDSASAYAGAIISPYYDSLLVKVISH 434

Query:   361 AADLQSSCAKMNRALREFRVRGVKTNIPFLLNVLTNQKFVNGAVDTYFIDENPQLFTLQP 420
             A+DLQSS +KMNRALREFR+RGVKTNIPFLLNVL NQKF++G +DTYFIDE+PQLF  +P
Sbjct:   435 ASDLQSSASKMNRALREFRIRGVKTNIPFLLNVLENQKFLHGVLDTYFIDEHPQLFKFKP 494

Query:   421 TKNRAQKLLNYLGTVLVNGP 440
             + NRAQKLLNY+G VLVNGP
Sbjct:   495 SLNRAQKLLNYMGEVLVNGP 514
GO:0004736 "pyruvate carboxylase activity" evidence=ISS
GO:0005759 "mitochondrial matrix" evidence=ISS
GO:0006090 "pyruvate metabolic process" evidence=ISS
GO:0006094 "gluconeogenesis" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0004075 "biotin carboxylase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
GO:0005875 "microtubule associated complex" evidence=IDA
ZFIN|ZDB-GENE-090908-3 pcl "pyruvate carboxylase, like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000831-1 pc "pyruvate carboxylase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q29RK2 PC "Pyruvate carboxylase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1P6G9 PC "Pyruvate carboxylase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:97520 Pcx "pyruvate carboxylase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P11498 PC "Pyruvate carboxylase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00004258 pyc-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
RGD|3262 Pc "pyruvate carboxylase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ASPGD|ASPL0000074543 pycA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q29RK2PYC_BOVIN6, ., 4, ., 1, ., 10.72820.41480.3803yesN/A
O17732PYC1_CAEEL6, ., 4, ., 1, ., 10.72230.42590.3914yesN/A
Q9KWU4PYC_BACSU6, ., 4, ., 1, ., 10.56260.40270.3789yesN/A
Q9UUE1PYC_SCHPO6, ., 4, ., 1, ., 10.59650.42310.3856yesN/A
P78992PYC_PICPA6, ., 4, ., 1, ., 10.59140.40830.3708yesN/A
Q05920PYC_MOUSE6, ., 4, ., 1, ., 10.72910.40920.3752yesN/A
P11498PYC_HUMAN6, ., 4, ., 1, ., 10.71640.42680.3913yesN/A
Q9HES8PYC_ASPNG6, ., 4, ., 1, ., 10.58110.42960.3892yesN/A
P32327PYC2_YEAST6, ., 4, ., 1, ., 10.58810.43240.3957yesN/A
P52873PYC_RAT6, ., 4, ., 1, ., 10.72020.41570.3811yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.4.10.921

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1080
PRK129991146 PRK12999, PRK12999, pyruvate carboxylase; Reviewed 0.0
TIGR012351143 TIGR01235, pyruv_carbox, pyruvate carboxylase 0.0
COG10381149 COG1038, PycA, Pyruvate carboxylase [Energy produc 0.0
PRK08591451 PRK08591, PRK08591, acetyl-CoA carboxylase biotin 0.0
COG4770645 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase 0.0
PRK08654499 PRK08654, PRK08654, pyruvate carboxylase subunit A 1e-174
COG0439449 COG0439, AccC, Biotin carboxylase [Lipid metabolis 1e-173
PRK06111450 PRK06111, PRK06111, acetyl-CoA carboxylase biotin 1e-169
TIGR012351143 TIGR01235, pyruv_carbox, pyruvate carboxylase 1e-166
TIGR00514449 TIGR00514, accC, acetyl-CoA carboxylase, biotin ca 1e-163
PRK05586447 PRK05586, PRK05586, biotin carboxylase; Validated 1e-161
PRK07178472 PRK07178, PRK07178, pyruvate carboxylase subunit A 1e-160
PRK08463478 PRK08463, PRK08463, acetyl-CoA carboxylase subunit 1e-150
PRK08462445 PRK08462, PRK08462, biotin carboxylase; Validated 1e-148
PRK129991146 PRK12999, PRK12999, pyruvate carboxylase; Reviewed 1e-145
COG10381149 COG1038, PycA, Pyruvate carboxylase [Energy produc 1e-141
PRK12833467 PRK12833, PRK12833, acetyl-CoA carboxylase biotin 1e-141
TIGR027121201 TIGR02712, urea_carbox, urea carboxylase 1e-130
pfam02786211 pfam02786, CPSase_L_D2, Carbamoyl-phosphate syntha 9e-88
pfam02436198 pfam02436, PYC_OADA, Conserved carboxylase domain 5e-85
PRK12999 1146 PRK12999, PRK12999, pyruvate carboxylase; Reviewed 4e-66
TIGR01235 1143 TIGR01235, pyruv_carbox, pyruvate carboxylase 3e-65
COG1038 1149 COG1038, PycA, Pyruvate carboxylase [Energy produc 4e-62
cd07937275 cd07937, DRE_TIM_PC_TC_5S, Pyruvate carboxylase an 2e-54
cd07937275 cd07937, DRE_TIM_PC_TC_5S, Pyruvate carboxylase an 2e-50
TIGR01235 1143 TIGR01235, pyruv_carbox, pyruvate carboxylase 6e-48
smart00878107 smart00878, Biotin_carb_C, Biotin carboxylase C-te 1e-47
PRK09282592 PRK09282, PRK09282, pyruvate carboxylase subunit B 4e-47
cd07937275 cd07937, DRE_TIM_PC_TC_5S, Pyruvate carboxylase an 7e-46
PRK12999 1146 PRK12999, PRK12999, pyruvate carboxylase; Reviewed 2e-44
COG5016472 COG5016, COG5016, Pyruvate/oxaloacetate carboxyltr 4e-44
COG1038 1149 COG1038, PycA, Pyruvate carboxylase [Energy produc 1e-42
pfam02785107 pfam02785, Biotin_carb_C, Biotin carboxylase C-ter 3e-42
PRK12331448 PRK12331, PRK12331, oxaloacetate decarboxylase; Pr 2e-39
TIGR01108582 TIGR01108, oadA, oxaloacetate decarboxylase alpha 4e-39
PRK09282 592 PRK09282, PRK09282, pyruvate carboxylase subunit B 7e-36
COG5016 472 COG5016, COG5016, Pyruvate/oxaloacetate carboxyltr 3e-34
PRK14040593 PRK14040, PRK14040, oxaloacetate decarboxylase; Pr 4e-34
PRK14041467 PRK14041, PRK14041, oxaloacetate decarboxylase; Pr 1e-32
cd03174265 cd03174, DRE_TIM_metallolyase, DRE-TIM metallolyas 2e-32
TIGR01108 582 TIGR01108, oadA, oxaloacetate decarboxylase alpha 1e-30
PRK12330499 PRK12330, PRK12330, oxaloacetate decarboxylase; Pr 1e-29
PRK14040 593 PRK14040, PRK14040, oxaloacetate decarboxylase; Pr 2e-29
PRK12331 448 PRK12331, PRK12331, oxaloacetate decarboxylase; Pr 3e-29
PRK14041 467 PRK14041, PRK14041, oxaloacetate decarboxylase; Pr 3e-29
PRK14042596 PRK14042, PRK14042, pyruvate carboxylase subunit B 3e-26
pfam00289108 pfam00289, CPSase_L_chain, Carbamoyl-phosphate syn 4e-26
PRK09282 592 PRK09282, PRK09282, pyruvate carboxylase subunit B 1e-24
COG5016 472 COG5016, COG5016, Pyruvate/oxaloacetate carboxyltr 2e-22
PRK12581468 PRK12581, PRK12581, oxaloacetate decarboxylase; Pr 2e-22
PRK14042 596 PRK14042, PRK14042, pyruvate carboxylase subunit B 3e-22
PRK12330 499 PRK12330, PRK12330, oxaloacetate decarboxylase; Pr 2e-21
PRK12581 468 PRK12581, PRK12581, oxaloacetate decarboxylase; Pr 5e-21
PRK14041 467 PRK14041, PRK14041, oxaloacetate decarboxylase; Pr 6e-21
TIGR01108 582 TIGR01108, oadA, oxaloacetate decarboxylase alpha 6e-20
PRK12331 448 PRK12331, PRK12331, oxaloacetate decarboxylase; Pr 1e-19
TIGR013691050 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synth 1e-19
TIGR012351143 TIGR01235, pyruv_carbox, pyruvate carboxylase 2e-19
PRK129991146 PRK12999, PRK12999, pyruvate carboxylase; Reviewed 6e-19
cd0685067 cd06850, biotinyl_domain, The biotinyl-domain or b 8e-19
COG10381149 COG1038, PycA, Pyruvate carboxylase [Energy produc 7e-18
PRK12330 499 PRK12330, PRK12330, oxaloacetate decarboxylase; Pr 2e-17
COG0458400 COG0458, CarB, Carbamoylphosphate synthase large s 1e-16
PRK14040 593 PRK14040, PRK14040, oxaloacetate decarboxylase; Pr 6e-16
PRK12581 468 PRK12581, PRK12581, oxaloacetate decarboxylase; Pr 5e-15
PRK09282592 PRK09282, PRK09282, pyruvate carboxylase subunit B 9e-15
PRK128151068 PRK12815, carB, carbamoyl phosphate synthase large 3e-14
COG0511140 COG0511, AccB, Biotin carboxyl carrier protein [Li 3e-14
pfam0036473 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme 5e-14
pfam13535183 pfam13535, ATP-grasp_4, ATP-grasp domain 6e-14
cd03174265 cd03174, DRE_TIM_metallolyase, DRE-TIM metallolyas 1e-13
COG4770645 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase 2e-13
pfam00682236 pfam00682, HMGL-like, HMGL-like 2e-12
TIGR013691050 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synth 3e-12
TIGR01205315 TIGR01205, D_ala_D_alaTIGR, D-alanine--D-alanine l 3e-11
PRK14042 596 PRK14042, PRK14042, pyruvate carboxylase subunit B 4e-11
PRK05641153 PRK05641, PRK05641, putative acetyl-CoA carboxylas 1e-10
PRK12767326 PRK12767, PRK12767, carbamoyl phosphate synthase-l 3e-10
PRK0822570 PRK08225, PRK08225, acetyl-CoA carboxylase biotin 4e-10
cd03174265 cd03174, DRE_TIM_metallolyase, DRE-TIM metallolyas 5e-10
TIGR027121201 TIGR02712, urea_carbox, urea carboxylase 7e-10
pfam02222171 pfam02222, ATP-grasp, ATP-grasp domain 2e-09
PRK052941066 PRK05294, carB, carbamoyl phosphate synthase large 4e-09
PLN027351102 PLN02735, PLN02735, carbamoyl-phosphate synthase 4e-09
pfam07478201 pfam07478, Dala_Dala_lig_C, D-ala D-ala ligase C-t 4e-09
PRK14040593 PRK14040, PRK14040, oxaloacetate decarboxylase; Pr 2e-08
PRK06019372 PRK06019, PRK06019, phosphoribosylaminoimidazole c 2e-08
PRK01372304 PRK01372, ddl, D-alanine--D-alanine ligase; Review 2e-08
PRK14042596 PRK14042, PRK14042, pyruvate carboxylase subunit B 4e-08
COG0119409 COG0119, LeuA, Isopropylmalate/homocitrate/citrama 4e-08
TIGR00768277 TIGR00768, rimK_fam, alpha-L-glutamate ligases, Ri 4e-08
COG1181317 COG1181, DdlA, D-alanine-D-alanine ligase and rela 6e-08
PRK0588971 PRK05889, PRK05889, putative acetyl-CoA carboxylas 7e-08
cd07938274 cd07938, DRE_TIM_HMGL, 3-hydroxy-3-methylglutaryl- 8e-08
PRK06549130 PRK06549, PRK06549, acetyl-CoA carboxylase biotin 2e-07
TIGR01108582 TIGR01108, oadA, oxaloacetate decarboxylase alpha 3e-07
COG0026375 COG0026, PurK, Phosphoribosylaminoimidazole carbox 2e-06
cd07943263 cd07943, DRE_TIM_HOA, 4-hydroxy-2-oxovalerate aldo 4e-06
TIGR02144280 TIGR02144, LysX_arch, Lysine biosynthesis enzyme L 6e-06
PRK11858378 PRK11858, aksA, trans-homoaconitate synthase; Revi 8e-06
cd0666373 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_ 1e-05
TIGR02660365 TIGR02660, nifV_homocitr, homocitrate synthase Nif 1e-05
TIGR03217333 TIGR03217, 4OH_2_O_val_ald, 4-hydroxy-2-oxovalerat 1e-05
PRK14573809 PRK14573, PRK14573, bifunctional D-alanyl-alanine 2e-05
PRK128151068 PRK12815, carB, carbamoyl phosphate synthase large 4e-05
PRK08195337 PRK08195, PRK08195, 4-hyroxy-2-oxovalerate/4-hydro 4e-05
TIGR01348 546 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase 7e-05
cd07940268 cd07940, DRE_TIM_IPMS, 2-isopropylmalate synthase 1e-04
PRK11854 633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipo 2e-04
cd0684974 cd06849, lipoyl_domain, Lipoyl domain of the dihyd 2e-04
PRK052941066 PRK05294, carB, carbamoyl phosphate synthase large 3e-04
TIGR01348 546 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase 3e-04
PRK11854 633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipo 3e-04
PRK11854 633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipo 3e-04
cd07939259 cd07939, DRE_TIM_NifV, Streptomyces rubellomurinus 3e-04
PRK06524493 PRK06524, PRK06524, biotin carboxylase-like protei 3e-04
PLN027351102 PLN02735, PLN02735, carbamoyl-phosphate synthase 4e-04
PRK05692287 PRK05692, PRK05692, hydroxymethylglutaryl-CoA lyas 4e-04
PRK06302155 PRK06302, PRK06302, acetyl-CoA carboxylase biotin 5e-04
PRK02186887 PRK02186, PRK02186, argininosuccinate lyase; Provi 6e-04
TIGR02090363 TIGR02090, LEU1_arch, isopropylmalate/citramalate/ 7e-04
cd07945280 cd07945, DRE_TIM_CMS, Leptospira interrogans citra 7e-04
PRK09389488 PRK09389, PRK09389, (R)-citramalate synthase; Prov 8e-04
cd07941273 cd07941, DRE_TIM_LeuA3, Desulfobacterium autotroph 0.001
PRK06015201 PRK06015, PRK06015, keto-hydroxyglutarate-aldolase 0.001
PRK11855 547 PRK11855, PRK11855, dihydrolipoamide acetyltransfe 0.002
COG0151428 COG0151, PurD, Phosphoribosylamine-glycine ligase 0.003
COG0027394 COG0027, PurT, Formate-dependent phosphoribosylgly 0.003
>gnl|CDD|237263 PRK12999, PRK12999, pyruvate carboxylase; Reviewed Back     alignment and domain information 
 Score =  798 bits (2065), Expect = 0.0
 Identities = 283/467 (60%), Positives = 347/467 (74%), Gaps = 10/467 (2%)

Query: 3   MHRQKADESYLVGKGLPPVEAYLNIPEIIRVAKENDVDAIHPGYGFLSERSDFAQAVLDA 62
           +HR KADE+YL+G+G  PV AYL+I EIIRVAK+  VDAIHPGYGFLSE  +FA+A  +A
Sbjct: 43  LHRFKADEAYLIGEGKHPVRAYLDIDEIIRVAKQAGVDAIHPGYGFLSENPEFARACAEA 102

Query: 63  GIRFIGPSPYVVQQMGDKVAARQAAIDSGVPIVPGTPGPITTTEEAMEFCLKYGLPVIFK 122
           GI FIGP+  V++ +GDKVAAR AAI +GVP++PG+ GPI   EEA+EF  + G P++ K
Sbjct: 103 GITFIGPTAEVLRLLGDKVAARNAAIKAGVPVIPGSEGPIDDIEEALEFAEEIGYPIMLK 162

Query: 123 AAYGGGGRGMRVVRKMEDVEENFQRASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGDKA 182
           A+ GGGGRGMR+VR  E++EE F+RA  EAKAAFGN  +++EK++E PRHIEVQ+LGDK 
Sbjct: 163 ASAGGGGRGMRIVRSEEELEEAFERAKREAKAAFGNDEVYLEKYVENPRHIEVQILGDKH 222

Query: 183 GNVVHLYERDCSVQRRHQKVVEIAPAPHLDINVRNKMTDLAVKLAKHVGYSNAGTVEFLC 242
           GNVVHLYERDCSVQRRHQKVVEIAPAP L   +R ++ + AVKLA+ VGY NAGTVEFL 
Sbjct: 223 GNVVHLYERDCSVQRRHQKVVEIAPAPGLSEELRERICEAAVKLARAVGYVNAGTVEFLV 282

Query: 243 DESGQFYFIEVNARLQVEHTVTEEITGVDLVQSQIRVAEGMTLPELG---LTQEKISPQG 299
           D  G FYFIEVN R+QVEHTVTEE+TG+D+VQSQI +AEG TL +L     +QE I  +G
Sbjct: 283 DADGNFYFIEVNPRIQVEHTVTEEVTGIDIVQSQILIAEGATLHDLEIGIPSQEDIRLRG 342

Query: 300 FAIQCRVTTEDPAKNFQPDTGRIEVFRSGEGMGIRLDGASAFAGAIISPYYDSLLVKVIA 359
           +AIQCR+TTEDPA NF PDTGRI  +RS  G G+RLDG +AFAGA I+PYYDSLLVK+ A
Sbjct: 343 YAIQCRITTEDPANNFMPDTGRITAYRSPGGFGVRLDGGNAFAGAEITPYYDSLLVKLTA 402

Query: 360 HAADLQSSCAKMNRALREFRVRGVKTNIPFLLNVLTNQKFVNGAVDTYFIDENPQLFTLQ 419
                + + A+M RALREFR+RGVKTNIPFL NVL +  F  G   T FIDE P+LF   
Sbjct: 403 WGRTFEQAVARMRRALREFRIRGVKTNIPFLENVLKHPDFRAGDYTTSFIDETPELFDFP 462

Query: 420 PTKNRAQKLLNYLGTVLVNGP------STPLATPLLPA-EVTPPVPE 459
             ++R  KLL Y+  V VNG             P LP  +++ P P 
Sbjct: 463 KRRDRGTKLLTYIADVTVNGFPGVKKKPPVFPDPRLPKVDLSAPPPA 509

Length = 1146
>gnl|CDD|130302 TIGR01235, pyruv_carbox, pyruvate carboxylase Back     alignment and domain information
>gnl|CDD|223968 COG1038, PycA, Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|236307 PRK08591, PRK08591, acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>gnl|CDD|227111 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|236325 PRK08654, PRK08654, pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>gnl|CDD|223516 COG0439, AccC, Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|180406 PRK06111, PRK06111, acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>gnl|CDD|130302 TIGR01235, pyruv_carbox, pyruvate carboxylase Back     alignment and domain information
>gnl|CDD|129605 TIGR00514, accC, acetyl-CoA carboxylase, biotin carboxylase subunit Back     alignment and domain information
>gnl|CDD|180150 PRK05586, PRK05586, biotin carboxylase; Validated Back     alignment and domain information
>gnl|CDD|180865 PRK07178, PRK07178, pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>gnl|CDD|169452 PRK08463, PRK08463, acetyl-CoA carboxylase subunit A; Validated Back     alignment and domain information
>gnl|CDD|236269 PRK08462, PRK08462, biotin carboxylase; Validated Back     alignment and domain information
>gnl|CDD|237263 PRK12999, PRK12999, pyruvate carboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|223968 COG1038, PycA, Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|183781 PRK12833, PRK12833, acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>gnl|CDD|233980 TIGR02712, urea_carbox, urea carboxylase Back     alignment and domain information
>gnl|CDD|190425 pfam02786, CPSase_L_D2, Carbamoyl-phosphate synthase L chain, ATP binding domain Back     alignment and domain information
>gnl|CDD|217032 pfam02436, PYC_OADA, Conserved carboxylase domain Back     alignment and domain information
>gnl|CDD|237263 PRK12999, PRK12999, pyruvate carboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|130302 TIGR01235, pyruv_carbox, pyruvate carboxylase Back     alignment and domain information
>gnl|CDD|223968 COG1038, PycA, Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|163675 cd07937, DRE_TIM_PC_TC_5S, Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>gnl|CDD|163675 cd07937, DRE_TIM_PC_TC_5S, Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>gnl|CDD|130302 TIGR01235, pyruv_carbox, pyruvate carboxylase Back     alignment and domain information
>gnl|CDD|214878 smart00878, Biotin_carb_C, Biotin carboxylase C-terminal domain Back     alignment and domain information
>gnl|CDD|236449 PRK09282, PRK09282, pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>gnl|CDD|163675 cd07937, DRE_TIM_PC_TC_5S, Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>gnl|CDD|237263 PRK12999, PRK12999, pyruvate carboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|227349 COG5016, COG5016, Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|223968 COG1038, PycA, Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|202395 pfam02785, Biotin_carb_C, Biotin carboxylase C-terminal domain Back     alignment and domain information
>gnl|CDD|183446 PRK12331, PRK12331, oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|233273 TIGR01108, oadA, oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>gnl|CDD|236449 PRK09282, PRK09282, pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>gnl|CDD|227349 COG5016, COG5016, Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|237592 PRK14040, PRK14040, oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|237593 PRK14041, PRK14041, oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|163674 cd03174, DRE_TIM_metallolyase, DRE-TIM metallolyase superfamily Back     alignment and domain information
>gnl|CDD|233273 TIGR01108, oadA, oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>gnl|CDD|183445 PRK12330, PRK12330, oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|237592 PRK14040, PRK14040, oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|183446 PRK12331, PRK12331, oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|237593 PRK14041, PRK14041, oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|172536 PRK14042, PRK14042, pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|201133 pfam00289, CPSase_L_chain, Carbamoyl-phosphate synthase L chain, N-terminal domain Back     alignment and domain information
>gnl|CDD|236449 PRK09282, PRK09282, pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>gnl|CDD|227349 COG5016, COG5016, Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|79056 PRK12581, PRK12581, oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|172536 PRK14042, PRK14042, pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|183445 PRK12330, PRK12330, oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|79056 PRK12581, PRK12581, oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|237593 PRK14041, PRK14041, oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|233273 TIGR01108, oadA, oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>gnl|CDD|183446 PRK12331, PRK12331, oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|233379 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>gnl|CDD|130302 TIGR01235, pyruv_carbox, pyruvate carboxylase Back     alignment and domain information
>gnl|CDD|237263 PRK12999, PRK12999, pyruvate carboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>gnl|CDD|223968 COG1038, PycA, Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|183445 PRK12330, PRK12330, oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|223534 COG0458, CarB, Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|237592 PRK14040, PRK14040, oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|79056 PRK12581, PRK12581, oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|236449 PRK09282, PRK09282, pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>gnl|CDD|237215 PRK12815, carB, carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>gnl|CDD|223585 COG0511, AccB, Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|201182 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme Back     alignment and domain information
>gnl|CDD|222206 pfam13535, ATP-grasp_4, ATP-grasp domain Back     alignment and domain information
>gnl|CDD|163674 cd03174, DRE_TIM_metallolyase, DRE-TIM metallolyase superfamily Back     alignment and domain information
>gnl|CDD|227111 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|201390 pfam00682, HMGL-like, HMGL-like Back     alignment and domain information
>gnl|CDD|233379 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>gnl|CDD|233310 TIGR01205, D_ala_D_alaTIGR, D-alanine--D-alanine ligase Back     alignment and domain information
>gnl|CDD|172536 PRK14042, PRK14042, pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|235540 PRK05641, PRK05641, putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>gnl|CDD|237195 PRK12767, PRK12767, carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|181304 PRK08225, PRK08225, acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>gnl|CDD|163674 cd03174, DRE_TIM_metallolyase, DRE-TIM metallolyase superfamily Back     alignment and domain information
>gnl|CDD|233980 TIGR02712, urea_carbox, urea carboxylase Back     alignment and domain information
>gnl|CDD|216935 pfam02222, ATP-grasp, ATP-grasp domain Back     alignment and domain information
>gnl|CDD|235393 PRK05294, carB, carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>gnl|CDD|215391 PLN02735, PLN02735, carbamoyl-phosphate synthase Back     alignment and domain information
>gnl|CDD|203643 pfam07478, Dala_Dala_lig_C, D-ala D-ala ligase C-terminus Back     alignment and domain information
>gnl|CDD|237592 PRK14040, PRK14040, oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|235674 PRK06019, PRK06019, phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>gnl|CDD|234948 PRK01372, ddl, D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>gnl|CDD|172536 PRK14042, PRK14042, pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|223197 COG0119, LeuA, Isopropylmalate/homocitrate/citramalate synthases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|233121 TIGR00768, rimK_fam, alpha-L-glutamate ligases, RimK family Back     alignment and domain information
>gnl|CDD|224102 COG1181, DdlA, D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|180306 PRK05889, PRK05889, putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>gnl|CDD|163676 cd07938, DRE_TIM_HMGL, 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information
>gnl|CDD|235826 PRK06549, PRK06549, acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>gnl|CDD|233273 TIGR01108, oadA, oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>gnl|CDD|223105 COG0026, PurK, Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|163681 cd07943, DRE_TIM_HOA, 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>gnl|CDD|131199 TIGR02144, LysX_arch, Lysine biosynthesis enzyme LysX Back     alignment and domain information
>gnl|CDD|183341 PRK11858, aksA, trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>gnl|CDD|233965 TIGR02660, nifV_homocitr, homocitrate synthase NifV Back     alignment and domain information
>gnl|CDD|132261 TIGR03217, 4OH_2_O_val_ald, 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>gnl|CDD|184752 PRK14573, PRK14573, bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>gnl|CDD|237215 PRK12815, carB, carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>gnl|CDD|181282 PRK08195, PRK08195, 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|163678 cd07940, DRE_TIM_IPMS, 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain Back     alignment and domain information
>gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|133458 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>gnl|CDD|235393 PRK05294, carB, carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|163677 cd07939, DRE_TIM_NifV, Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>gnl|CDD|180605 PRK06524, PRK06524, biotin carboxylase-like protein; Validated Back     alignment and domain information
>gnl|CDD|215391 PLN02735, PLN02735, carbamoyl-phosphate synthase Back     alignment and domain information
>gnl|CDD|180206 PRK05692, PRK05692, hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>gnl|CDD|235777 PRK06302, PRK06302, acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>gnl|CDD|235010 PRK02186, PRK02186, argininosuccinate lyase; Provisional Back     alignment and domain information
>gnl|CDD|233719 TIGR02090, LEU1_arch, isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>gnl|CDD|163683 cd07945, DRE_TIM_CMS, Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>gnl|CDD|236493 PRK09389, PRK09389, (R)-citramalate synthase; Provisional Back     alignment and domain information
>gnl|CDD|163679 cd07941, DRE_TIM_LeuA3, Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>gnl|CDD|168348 PRK06015, PRK06015, keto-hydroxyglutarate-aldolase/keto-deoxy- phosphogluconate aldolase; Provisional Back     alignment and domain information
>gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|223229 COG0151, PurD, Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|223106 COG0027, PurT, Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1080
COG10381149 PycA Pyruvate carboxylase [Energy production and c 100.0
KOG0369|consensus1176 100.0
TIGR012351143 pyruv_carbox pyruvate carboxylase. This enzyme pla 100.0
PRK129991146 pyruvate carboxylase; Reviewed 100.0
COG4770645 Acetyl/propionyl-CoA carboxylase, alpha subunit [L 100.0
PRK14042596 pyruvate carboxylase subunit B; Provisional 100.0
KOG0238|consensus670 100.0
TIGR01108582 oadA oxaloacetate decarboxylase alpha subunit. Thi 100.0
PRK09282592 pyruvate carboxylase subunit B; Validated 100.0
PRK14040593 oxaloacetate decarboxylase; Provisional 100.0
COG5016472 Pyruvate/oxaloacetate carboxyltransferase [Energy 100.0
PRK12581468 oxaloacetate decarboxylase; Provisional 100.0
COG0439449 AccC Biotin carboxylase [Lipid metabolism] 100.0
PRK12330499 oxaloacetate decarboxylase; Provisional 100.0
PRK14041467 oxaloacetate decarboxylase; Provisional 100.0
PRK12331448 oxaloacetate decarboxylase; Provisional 100.0
PRK08654499 pyruvate carboxylase subunit A; Validated 100.0
PRK07178472 pyruvate carboxylase subunit A; Validated 100.0
PRK08463478 acetyl-CoA carboxylase subunit A; Validated 100.0
PRK12833467 acetyl-CoA carboxylase biotin carboxylase subunit; 100.0
TIGR027121201 urea_carbox urea carboxylase. Members of this fami 100.0
PRK05586447 biotin carboxylase; Validated 100.0
TIGR00514449 accC acetyl-CoA carboxylase, biotin carboxylase su 100.0
PRK08462445 biotin carboxylase; Validated 100.0
KOG0368|consensus 2196 100.0
PRK08591451 acetyl-CoA carboxylase biotin carboxylase subunit; 100.0
PF02436196 PYC_OADA: Conserved carboxylase domain; InterPro: 100.0
PRK06111450 acetyl-CoA carboxylase biotin carboxylase subunit; 100.0
COG1038 1149 PycA Pyruvate carboxylase [Energy production and c 100.0
COG5016 472 Pyruvate/oxaloacetate carboxyltransferase [Energy 100.0
KOG0369|consensus 1176 100.0
TIGR01235 1143 pyruv_carbox pyruvate carboxylase. This enzyme pla 100.0
PF02786211 CPSase_L_D2: Carbamoyl-phosphate synthase L chain, 100.0
PRK14042 596 pyruvate carboxylase subunit B; Provisional 100.0
PLN027351102 carbamoyl-phosphate synthase 100.0
PRK12581 468 oxaloacetate decarboxylase; Provisional 100.0
PRK12999 1146 pyruvate carboxylase; Reviewed 100.0
PLN02257434 phosphoribosylamine--glycine ligase 100.0
PRK13790379 phosphoribosylamine--glycine ligase; Provisional 100.0
PRK13789426 phosphoribosylamine--glycine ligase; Provisional 100.0
TIGR01142380 purT phosphoribosylglycinamide formyltransferase 2 100.0
PRK00885420 phosphoribosylamine--glycine ligase; Provisional 100.0
PRK12330 499 oxaloacetate decarboxylase; Provisional 100.0
TIGR013691050 CPSaseII_lrg carbamoyl-phosphate synthase, large s 100.0
PRK09288395 purT phosphoribosylglycinamide formyltransferase 2 100.0
PLN02948577 phosphoribosylaminoimidazole carboxylase 100.0
PLN027351102 carbamoyl-phosphate synthase 100.0
TIGR00877423 purD phosphoribosylamine--glycine ligase. This enz 100.0
PRK06395435 phosphoribosylamine--glycine ligase; Provisional 100.0
PRK06019372 phosphoribosylaminoimidazole carboxylase ATPase su 100.0
PRK05784486 phosphoribosylamine--glycine ligase; Provisional 100.0
TIGR01161352 purK phosphoribosylaminoimidazole carboxylase, Pur 100.0
PRK02186887 argininosuccinate lyase; Provisional 100.0
COG0151428 PurD Phosphoribosylamine-glycine ligase [Nucleotid 100.0
PRK14040 593 oxaloacetate decarboxylase; Provisional 99.98
PRK052941066 carB carbamoyl phosphate synthase large subunit; R 99.98
PRK052941066 carB carbamoyl phosphate synthase large subunit; R 99.98
PRK128151068 carB carbamoyl phosphate synthase large subunit; R 99.98
TIGR013691050 CPSaseII_lrg carbamoyl-phosphate synthase, large s 99.98
PRK07206416 hypothetical protein; Provisional 99.98
PRK128151068 carB carbamoyl phosphate synthase large subunit; R 99.98
COG0458400 CarB Carbamoylphosphate synthase large subunit (sp 99.97
PRK12767326 carbamoyl phosphate synthase-like protein; Provisi 99.97
PRK09282 592 pyruvate carboxylase subunit B; Validated 99.97
PRK06524493 biotin carboxylase-like protein; Validated 99.96
PF15632329 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathwa 99.96
COG0027394 PurT Formate-dependent phosphoribosylglycinamide f 99.96
PRK14041 467 oxaloacetate decarboxylase; Provisional 99.96
PRK12331 448 oxaloacetate decarboxylase; Provisional 99.96
TIGR01108 582 oadA oxaloacetate decarboxylase alpha subunit. Thi 99.95
PRK14569296 D-alanyl-alanine synthetase A; Provisional 99.95
COG0026375 PurK Phosphoribosylaminoimidazole carboxylase (NCA 99.95
PRK12344524 putative alpha-isopropylmalate/homocitrate synthas 99.95
PLN02321632 2-isopropylmalate synthase 99.95
PLN03228503 methylthioalkylmalate synthase; Provisional 99.95
PRK01966333 ddl D-alanyl-alanine synthetase A; Reviewed 99.95
PRK00915513 2-isopropylmalate synthase; Validated 99.95
TIGR02660365 nifV_homocitr homocitrate synthase NifV. This fami 99.94
TIGR00973494 leuA_bact 2-isopropylmalate synthase, bacterial ty 99.94
PRK11858378 aksA trans-homoaconitate synthase; Reviewed 99.94
PLN02746347 hydroxymethylglutaryl-CoA lyase 99.94
PRK14568343 vanB D-alanine--D-lactate ligase; Provisional 99.94
PRK01372304 ddl D-alanine--D-alanine ligase; Reviewed 99.94
PRK14570364 D-alanyl-alanine synthetase A; Provisional 99.94
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 99.94
PRK14572347 D-alanyl-alanine synthetase A; Provisional 99.93
TIGR01205315 D_ala_D_alaTIGR D-alanine--D-alanine ligase. but a 99.93
PRK09389488 (R)-citramalate synthase; Provisional 99.93
TIGR00977526 LeuA_rel 2-isopropylmalate synthase/homocitrate sy 99.93
COG0119409 LeuA Isopropylmalate/homocitrate/citramalate synth 99.93
TIGR02090363 LEU1_arch isopropylmalate/citramalate/homocitrate 99.93
cd07938274 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, 99.93
cd07945280 DRE_TIM_CMS Leptospira interrogans citramalate syn 99.93
KOG0237|consensus788 99.93
TIGR00970564 leuA_yeast 2-isopropylmalate synthase, yeast type. 99.92
PRK06849389 hypothetical protein; Provisional 99.92
PRK03739552 2-isopropylmalate synthase; Validated 99.92
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 99.92
cd07940268 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N- 99.92
PRK14571299 D-alanyl-alanine synthetase A; Provisional 99.92
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 99.91
PRK14573809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 99.91
PF02785107 Biotin_carb_C: Biotin carboxylase C-terminal domai 99.91
PRK14847333 hypothetical protein; Provisional 99.91
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 99.91
COG2232389 Predicted ATP-dependent carboligase related to bio 99.9
KOG2368|consensus316 99.9
cd07942284 DRE_TIM_LeuA Mycobacterium tuberculosis LeuA3 and 99.9
PF13535184 ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A 99.9
smart00878107 Biotin_carb_C Biotin carboxylase C-terminal domain 99.9
KOG2367|consensus560 99.89
cd07947279 DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synt 99.89
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 99.89
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 99.88
TIGR00768277 rimK_fam alpha-L-glutamate ligases, RimK family. T 99.88
KOG0370|consensus1435 99.88
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 99.88
cd07941273 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 99.87
PRK08195337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 99.87
TIGR02144280 LysX_arch Lysine biosynthesis enzyme LysX. The fam 99.87
PRK10446300 ribosomal protein S6 modification protein; Provisi 99.87
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 99.86
PF00682237 HMGL-like: HMGL-like of this family is not conserv 99.86
PF07478203 Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; In 99.84
PF02222172 ATP-grasp: ATP-grasp domain; InterPro: IPR003135 T 99.84
PRK13277366 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribo 99.84
PRK13278358 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D 99.84
KOG0370|consensus1435 99.83
COG1181317 DdlA D-alanine-D-alanine ligase and related ATP-gr 99.82
), forming GARS-AIRS-GART. This entry represents the A-domain of the enzyme, and is related to the ATP-grasp domain of biotin carboxylase/carbamoyl phosphate synthetase.; PDB: 1GSO_A 3LP8_A 2IP4_A 1VKZ_A 2QK4_A 2XD4_A 2XCL_A 3MJF_A 2YRW_A 2YS6_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF01071">PF01071194 GARS_A: Phosphoribosylglycinamide synthetase, ATP- 99.79
PRK14016727 cyanophycin synthetase; Provisional 99.77
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 99.77
PF02655161 ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806 99.76
TIGR03103547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 99.76
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabo 99.75
COG0189318 RimK Glutathione synthase/Ribosomal protein S6 mod 99.71
PF08443190 RimK: RimK-like ATP-grasp domain; InterPro: IPR013 99.7
COG1821307 Predicted ATP-utilizing enzyme (ATP-grasp superfam 99.63
PRK06549130 acetyl-CoA carboxylase biotin carboxyl carrier pro 99.62
COG3919415 Predicted ATP-grasp enzyme [General function predi 99.6
PRK05641153 putative acetyl-CoA carboxylase biotin carboxyl ca 99.59
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl ca 99.57
TIGR02146344 LysS_fung_arch homocitrate synthase. This model in 99.56
TIGR02068864 cya_phycin_syn cyanophycin synthetase. Cyanophycin 99.56
PRK12458338 glutathione synthetase; Provisional 99.55
TIGR01435737 glu_cys_lig_rel glutamate--cysteine ligase/gamma-g 99.54
PRK02471752 bifunctional glutamate--cysteine ligase/glutathion 99.51
PRK0674883 hypothetical protein; Validated 99.49
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier pro 99.48
PF0036474 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: 99.48
TIGR00531156 BCCP acetyl-CoA carboxylase, biotin carboxyl carri 99.45
PLN02941328 inositol-tetrakisphosphate 1-kinase 99.42
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 99.42
TIGR01380312 glut_syn glutathione synthetase, prokaryotic. This 99.41
PRK05246316 glutathione synthetase; Provisional 99.39
PLN02983274 biotin carboxyl carrier protein of acetyl-CoA carb 99.37
PRK06302155 acetyl-CoA carboxylase biotin carboxyl carrier pro 99.36
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 99.33
TIGR03217 333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 99.31
TIGR02291317 rimK_rel_E_lig alpha-L-glutamate ligase-related pr 99.31
PRK0705180 hypothetical protein; Validated 99.3
PRK08195 337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 99.29
PRK05704 407 dihydrolipoamide succinyltransferase; Validated 99.18
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 99.18
COG1759361 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofu 99.17
cd0685067 biotinyl_domain The biotinyl-domain or biotin carb 99.16
PF00289110 CPSase_L_chain: Carbamoyl-phosphate synthase L cha 99.14
TIGR01347 403 sucB 2-oxoglutarate dehydrogenase complex dihydrol 99.06
cd07940268 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N- 99.03
PLN02226 463 2-oxoglutarate dehydrogenase E2 component 99.0
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar 98.97
COG0508 404 AceF Pyruvate/2-oxoglutarate dehydrogenase complex 98.97
cd07938274 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, 98.95
PTZ00144 418 dihydrolipoamide succinyltransferase; Provisional 98.94
PLN02528 416 2-oxoisovalerate dehydrogenase E2 component 98.92
PRK14875 371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 98.9
PRK11854 633 aceF pyruvate dehydrogenase dihydrolipoyltransacet 98.89
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 98.87
PF14398262 ATPgrasp_YheCD: YheC/D like ATP-grasp 98.85
TIGR01348 546 PDHac_trf_long pyruvate dehydrogenase complex dihy 98.84
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 98.82
PRK12344 524 putative alpha-isopropylmalate/homocitrate synthas 98.82
TIGR02660 365 nifV_homocitr homocitrate synthase NifV. This fami 98.82
PF14397285 ATPgrasp_ST: Sugar-transfer associated ATP-grasp 98.82
TIGR02090 363 LEU1_arch isopropylmalate/citramalate/homocitrate 98.79
TIGR01016386 sucCoAbeta succinyl-CoA synthetase, beta subunit. 98.79
PRK00696388 sucC succinyl-CoA synthetase subunit beta; Provisi 98.78
PRK11858 378 aksA trans-homoaconitate synthase; Reviewed 98.78
PRK11855 547 dihydrolipoamide acetyltransferase; Reviewed 98.73
cd07941273 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 98.67
PRK11856 411 branched-chain alpha-keto acid dehydrogenase subun 98.63
PRK11854 633 aceF pyruvate dehydrogenase dihydrolipoyltransacet 98.6
TIGR01349 435 PDHac_trf_mito pyruvate dehydrogenase complex dihy 98.56
TIGR01348 546 PDHac_trf_long pyruvate dehydrogenase complex dihy 98.49
PLN02744 539 dihydrolipoyllysine-residue acetyltransferase comp 98.48
TIGR02927 590 SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo 98.48
PLN02746 347 hydroxymethylglutaryl-CoA lyase 98.43
PRK09389 488 (R)-citramalate synthase; Provisional 98.27
PF13549222 ATP-grasp_5: ATP-grasp domain; PDB: 1WR2_A. 98.26
cd0684974 lipoyl_domain Lipoyl domain of the dihydrolipoyl a 98.24
PRK11855 547 dihydrolipoamide acetyltransferase; Reviewed 98.22
PF00682237 HMGL-like: HMGL-like of this family is not conserv 98.21
KOG0558|consensus 474 98.2
COG0045387 SucC Succinyl-CoA synthetase, beta subunit [Energy 98.18
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 98.18
PLN00124422 succinyl-CoA ligase [GDP-forming] subunit beta; Pr 98.15
PF02955173 GSH-S_ATP: Prokaryotic glutathione synthetase, ATP 98.15
PRK00915 513 2-isopropylmalate synthase; Validated 98.13
PRK11892 464 pyruvate dehydrogenase subunit beta; Provisional 98.13
PRK14046392 malate--CoA ligase subunit beta; Provisional 98.11
PRK13380144 glycine cleavage system protein H; Provisional 98.1
TIGR02927 590 SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo 98.05
KOG0557|consensus 470 97.94
PLN02235423 ATP citrate (pro-S)-lyase 97.93
PF08442202 ATP-grasp_2: ATP-grasp domain; InterPro: IPR013650 97.89
cd0684896 GCS_H Glycine cleavage H-protein. Glycine cleavage 97.86
TIGR03077110 not_gcvH glycine cleavage protein H-like protein, 97.71
PF1353350 Biotin_lipoyl_2: Biotin-lipoyl like 97.69
PF05770307 Ins134_P3_kin: Inositol 1, 3, 4-trisphosphate 5/6- 97.67
KOG0559|consensus 457 97.56
PRK01202127 glycine cleavage system protein H; Provisional 97.55
PF14305239 ATPgrasp_TupA: TupA-like ATPgrasp 97.55
TIGR00527127 gcvH glycine cleavage system H protein. The genome 97.53
PRK00624114 glycine cleavage system protein H; Provisional 97.45
PLN02321 632 2-isopropylmalate synthase 97.44
PRK09783409 copper/silver efflux system membrane fusion protei 97.39
PF02750203 Synapsin_C: Synapsin, ATP binding domain; InterPro 97.3
PLN03228 503 methylthioalkylmalate synthase; Provisional 97.25
TIGR00998 334 8a0101 efflux pump membrane protein (multidrug res 97.24
TIGR00977 526 LeuA_rel 2-isopropylmalate synthase/homocitrate sy 97.22
PF03133292 TTL: Tubulin-tyrosine ligase family; InterPro: IPR 97.13
PRK10476 346 multidrug resistance protein MdtN; Provisional 97.06
TIGR00973 494 leuA_bact 2-isopropylmalate synthase, bacterial ty 97.06
PRK10559310 p-hydroxybenzoic acid efflux subunit AaeA; Provisi 97.04
TIGR01730322 RND_mfp RND family efflux transporter, MFP subunit 97.03
PRK03598 331 putative efflux pump membrane fusion protein; Prov 96.87
cd07947279 DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synt 96.76
PRK15136 390 multidrug efflux system protein EmrA; Provisional 96.73
PRK09578385 periplasmic multidrug efflux lipoprotein precursor 96.72
cd07945 280 DRE_TIM_CMS Leptospira interrogans citramalate syn 96.71
KOG3895|consensus488 96.41
PRK15030397 multidrug efflux system transporter AcrA; Provisio 96.4
PRK11578 370 macrolide transporter subunit MacA; Provisional 96.39
TIGR03309256 matur_yqeB selenium-dependent molybdenum hydroxyla 96.37
PRK11556415 multidrug efflux system subunit MdtA; Provisional 96.37
PF06973188 DUF1297: Domain of unknown function (DUF1297); Int 96.35
PF13375101 RnfC_N: RnfC Barrel sandwich hybrid domain 96.33
PRK09859385 multidrug efflux system protein MdtE; Provisional 96.31
PF01597122 GCV_H: Glycine cleavage H-protein; InterPro: IPR00 96.19
COG0509131 GcvH Glycine cleavage system H protein (lipoate-bi 95.98
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier pro 95.96
COG3608331 Predicted deacylase [General function prediction o 95.79
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl ca 95.67
TIGR02146 344 LysS_fung_arch homocitrate synthase. This model in 95.6
), forming GARS-AIRS-GART. This entry represents the N-domain, which is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (IPR005481 from INTERPRO).; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process; PDB: 3MJF_A 2XD4_A 2XCL_A 2IP4_A 2YW2_B 2YYA_A 3LP8_A 1VKZ_A 2YS6_A 2YRX_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF02844">PF02844100 GARS_N: Phosphoribosylglycinamide synthetase, N do 95.51
PF12700 328 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 95.45
cd06252316 M14_ASTE_ASPA_like_2 A functionally uncharacterize 95.43
PRK0705180 hypothetical protein; Validated 95.36
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabo 95.25
cd06251287 M14_ASTE_ASPA_like_1 A functionally uncharacterize 95.25
cd06253298 M14_ASTE_ASPA_like_3 A functionally uncharacterize 95.2
TIGR02994325 ectoine_eutE ectoine utilization protein EutE. Mem 95.09
PRK0674883 hypothetical protein; Validated 95.02
), forming GARS-AIRS-GART. This entry represents the C-domain, which is related to the C-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (IPR005480 from INTERPRO).; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process; PDB: 2YW2_B 2YYA_A 3MJF_A 2IP4_A 3LP8_A 1VKZ_A 2YS6_A 2YRX_A 2YRW_A 2YS7_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF02843">PF0284393 GARS_C: Phosphoribosylglycinamide synthetase, C do 94.81
PF1353350 Biotin_lipoyl_2: Biotin-lipoyl like 94.77
PRK1278484 hypothetical protein; Provisional 94.77
PF11379355 DUF3182: Protein of unknown function (DUF3182); In 94.57
PF14243130 DUF4343: Domain of unknown function (DUF4343) 94.52
COG0119 409 LeuA Isopropylmalate/homocitrate/citramalate synth 94.37
cd06254288 M14_ASTE_ASPA_like_4 A functionally uncharacterize 94.34
PRK14847 333 hypothetical protein; Provisional 94.1
cd06250359 M14_PaAOTO_like An uncharacterized subgroup of the 93.86
PF0036474 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: 93.79
cd0685067 biotinyl_domain The biotinyl-domain or biotin carb 92.27
KOG2156|consensus662 92.22
PF14403445 CP_ATPgrasp_2: Circularly permuted ATP-grasp type 92.13
PRK06549130 acetyl-CoA carboxylase biotin carboxyl carrier pro 92.0
TIGR02971 327 heterocyst_DevB ABC exporter membrane fusion prote 91.88
PF00529 305 HlyD: HlyD family secretion protein the correspond 91.74
PF13437105 HlyD_3: HlyD family secretion protein 91.55
PF05896257 NQRA: Na(+)-translocating NADH-quinone reductase s 91.27
PRK06302155 acetyl-CoA carboxylase biotin carboxyl carrier pro 91.21
TIGR00531156 BCCP acetyl-CoA carboxylase, biotin carboxyl carri 91.06
TIGR01843 423 type_I_hlyD type I secretion membrane fusion prote 90.97
TIGR01936 447 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo 90.83
TIGR03794 421 NHPM_micro_HlyD NHPM bacteriocin system secretion 90.29
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar 90.11
PRK05352 448 Na(+)-translocating NADH-quinone reductase subunit 89.57
PF06898385 YqfD: Putative stage IV sporulation protein YqfD; 89.46
KOG2157|consensus497 89.16
PRK05641153 putative acetyl-CoA carboxylase biotin carboxyl ca 88.9
PF07065299 D123: D123; InterPro: IPR009772 This family contai 88.16
PRK05849783 hypothetical protein; Provisional 87.97
PLN02983274 biotin carboxyl carrier protein of acetyl-CoA carb 87.81
TIGR02876382 spore_yqfD sporulation protein YqfD. YqfD is part 87.56
KOG0559|consensus 457 87.49
PRK14875 371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 86.64
TIGR01000 457 bacteriocin_acc bacteriocin secretion accessory pr 86.6
COG4656 529 RnfC Predicted NADH:ubiquinone oxidoreductase, sub 86.57
TIGR03551343 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflav 86.25
PF09891150 DUF2118: Uncharacterized protein conserved in arch 86.11
COG1726 447 NqrA Na+-transporting NADH:ubiquinone oxidoreducta 85.96
PLN02226 463 2-oxoglutarate dehydrogenase E2 component 85.89
cd06255293 M14_ASTE_ASPA_like_5 A functionally uncharacterize 85.74
COG2190156 NagE Phosphotransferase system IIA components [Car 85.27
TIGR01945 435 rnfC electron transport complex, RnfABCDGE type, C 85.07
TIGR00830121 PTBA PTS system, glucose subfamily, IIA component. 83.94
PTZ00144 418 dihydrolipoamide succinyltransferase; Provisional 83.19
KOG2799|consensus434 83.14
KOG3373|consensus172 83.04
PRK11556 415 multidrug efflux system subunit MdtA; Provisional 82.34
PRK05035 695 electron transport complex protein RnfC; Provision 82.27
PF04952292 AstE_AspA: Succinylglutamate desuccinylase / Aspar 80.88
PF00358132 PTS_EIIA_1: phosphoenolpyruvate-dependent sugar ph 80.32
PF06849124 DUF1246: Protein of unknown function (DUF1246); In 80.19
PRK09439169 PTS system glucose-specific transporter subunit; P 80.19
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=6.1e-192  Score=1627.20  Aligned_cols=899  Identities=55%  Similarity=0.896  Sum_probs=859.3

Q ss_pred             CCcchhccceEEEccCCCCCCCCCCCHHHHHHHHHHcCCCEEEeCCCcccccHHHHHHHHHcCCcEeCCcHHHHHHhcCH
Q psy3968           1 MHMHRQKADESYLVGKGLPPVEAYLNIPEIIRVAKENDVDAIHPGYGFLSERSDFAQAVLDAGIRFIGPSPYVVQQMGDK   80 (1080)
Q Consensus         1 ~s~~~~~ADea~~v~~~~~~~~~yld~e~Ii~~a~~~~iDaVipg~g~lsE~~~~a~~l~~~gi~~iGps~eai~~~~DK   80 (1080)
                      .|.|+..|||+|.+|.+..|.++||++|.|+++|++.++|+|||||||||||++|++.|.+.||.|+||+++.+..++||
T Consensus        43 ~S~HR~KADEsY~iG~~~~Pi~aYL~IdeII~iAk~~gaDaIhPGYGfLSEn~efA~~c~eaGI~FIGP~~e~ld~~GdK  122 (1149)
T COG1038          43 LSLHRFKADESYLIGEGKGPVEAYLSIDEIIRIAKRSGADAIHPGYGFLSENPEFARACAEAGITFIGPKPEVLDMLGDK  122 (1149)
T ss_pred             chhhhccccceeeecCCCCchHHhccHHHHHHHHHHcCCCeecCCcccccCCHHHHHHHHHcCCEEeCCCHHHHHHhccH
Confidence            48999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHhCCcEEEEeCCCCCCcCeEEECCHhHHHHHHHHHHHHHHHhcCCCc
Q psy3968          81 VAARQAAIDSGVPIVPGTPGPITTTEEAMEFCLKYGLPVIFKAAYGGGGRGMRVVRKMEDVEENFQRASSEAKAAFGNGA  160 (1080)
Q Consensus        81 ~~~r~~l~~~GIpvp~~~~~~v~s~ee~~~~~~~igfPvVVKP~~g~Gg~GV~iv~s~eeL~~a~~~~~~~a~~~~g~~~  160 (1080)
                      ..+|..+.++|+|+.|++...+++.+++.+++++.|||+|||++.|+||||||+|+++++|.+++.++.++++++||+++
T Consensus       123 v~Ar~~A~~agvPvipgt~~~~~~~ee~~~fa~~~gyPvmiKA~~GGGGRGMR~vr~~~~l~~~~~~AksEAkaAFG~~e  202 (1149)
T COG1038         123 VKARNAAIKAGVPVIPGTDGPIETIEEALEFAEEYGYPVMIKAAAGGGGRGMRVVRSEADLAEAFERAKSEAKAAFGNDE  202 (1149)
T ss_pred             HHHHHHHHHcCCCccCCCCCCcccHHHHHHHHHhcCCcEEEEEccCCCccceeeecCHHHHHHHHHHHHHHHHHhcCCCc
Confidence            99999999999999999888889999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEeeccCCCcEEEEEEEEecCCcEEEEEeeeccccccccEEEEEcCCCCCCHHHHHHHHHHHHHHHHHcCCcceEEEEE
Q psy3968         161 MFIEKFIERPRHIEVQLLGDKAGNVVHLYERDCSVQRRHQKVVEIAPAPHLDINVRNKMTDLAVKLAKHVGYSNAGTVEF  240 (1080)
Q Consensus       161 vlVEeyI~G~~ei~v~vl~d~~G~vv~l~~r~~~~~~~~~~~~~~~Pa~~l~~~~~~~l~~~a~~i~~alg~~G~~~vEf  240 (1080)
                      ++||+||++|+|++||+++|.+|+++|+++|+||+||+||++++.+|++.++++++++|++.+.++++.+||.|++++||
T Consensus       203 VyvEk~ve~pkHIEVQiLgD~~GnvvHLfERDCSvQRRhQKVVE~APa~~L~~~~R~~ic~~Avkla~~~~Y~~AGTvEF  282 (1149)
T COG1038         203 VYVEKLVENPKHIEVQILGDTHGNVVHLFERDCSVQRRHQKVVEVAPAPYLSPELRDEICDDAVKLARNIGYINAGTVEF  282 (1149)
T ss_pred             EEhhhhhcCcceeEEEEeecCCCCEEEEeecccchhhccceeEEecCCCCCCHHHHHHHHHHHHHHHHHcCCcccceEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEcCCCCEEEEEEeccCCCCccchhcccCCCHHHHHHHHHcCCCCC--CCCCCccc-cccCeEEEEeeeccCCCCCCCCC
Q psy3968         241 LCDESGQFYFIEVNARLQVEHTVTEEITGVDLVQSQIRVAEGMTLP--ELGLTQEK-ISPQGFAIQCRVTTEDPAKNFQP  317 (1080)
Q Consensus       241 ivd~dG~~~~iEvNpR~~g~~~~~e~~tGvdl~~~~l~~alG~~l~--~l~~~~~~-i~~~g~ai~~ri~ae~p~~~f~p  317 (1080)
                      ++|.+|++||||||||+|++|++||++||+|+++.|+.++.|..|+  ++++++.. |..+|+|+|||++.|||.++|.|
T Consensus       283 Lvd~~~~fyFIEvNPRiQVEHTiTE~vTgiDIV~aQi~ia~G~~l~~~e~glp~q~dI~~~G~AiQcRITTEDP~n~F~P  362 (1149)
T COG1038         283 LVDEDGKFYFIEVNPRIQVEHTITEEITGIDIVKAQIHIAAGATLHTPELGLPQQKDIRTHGYAIQCRITTEDPENGFIP  362 (1149)
T ss_pred             EEcCCCcEEEEEecCceeeEEeeeeeeechhHHHHHHHHhccCccCCcccCCCccccccccceEEEEEeeccCcccCCCC
Confidence            9999999999999999999999999999999999999999999997  78876654 99999999999999999999999


Q ss_pred             CCCceEEEEcCCcceEEEcCCccCCCceeccccCCeeEEEEEecCChHHHHHHHHHHhhccEEcccccCHHHHHHhcccc
Q psy3968         318 DTGRIEVFRSGEGMGIRLDGASAFAGAIISPYYDSLLVKVIAHAADLQSSCAKMNRALREFRVRGVKTNIPFLLNVLTNQ  397 (1080)
Q Consensus       318 ~~G~i~~~~~~~~~gvr~d~~~~~~G~~i~~~~ds~l~~Via~G~t~~eA~~~a~ral~~i~I~Gv~tni~~l~~il~~~  397 (1080)
                      ++|+|..++++++.|||+|.+..+.|..|+|+|||++.++.+||.|+++|++||.|+|.+++|+||+|||+||.++|.|+
T Consensus       363 DtGrI~aYRs~gGfGVRLD~Gn~~~GavItpyyDslLVK~t~~~~t~e~a~~km~RaL~EfrIrGVkTNi~FL~~vl~h~  442 (1149)
T COG1038         363 DTGRITAYRSAGGFGVRLDGGNAYAGAVITPYYDSLLVKVTCWGSTFEEAIRKMIRALREFRIRGVKTNIPFLEAVLNHP  442 (1149)
T ss_pred             CCceEEEEecCCCceEEecCCcccccceeccccccceeeEeecCCCHHHHHHHHHHHHHHheecceecCcHHHHHHhcCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccCCceeeeeecCCccccccCCcchHHHHHHHhhheeeecCCCCCCCCCCCCCCCCCCCCCC------CCCC-------
Q psy3968         398 KFVNGAVDTYFIDENPQLFTLQPTKNRAQKLLNYLGTVLVNGPSTPLATPLLPAEVTPPVPEI------PLGK-------  464 (1080)
Q Consensus       398 ~F~~g~~~T~fie~~~elf~~~~~~dra~~L~~yla~V~Vng~~~p~~~~~~~~~~~~~~~~~------~~G~-------  464 (1080)
                      .|.+|+++|+||+++|+||.+....+|+++++.|++.|+||||. +..++..|..-.+..+.+      ..|+       
T Consensus       443 ~F~~g~y~T~FId~tPeLf~~~~~~Dr~tK~L~yl~dvtVNg~P-~~~~r~kp~~~~~~~~~~~~~~~~~~Gtkq~Ld~~  521 (1149)
T COG1038         443 DFRSGRYTTSFIDTTPELFQFPKSQDRGTKLLTYLADVTVNGFP-GLKSRPKPAYDDAKLPVINVSKPPPRGTKQILDEL  521 (1149)
T ss_pred             ccccCcceeeeccCCHHHhccccccchhHHHHHHHHHheecCCC-ccCCCCCcccccccCCcccccCCCCccHHHHHHhh
Confidence            99999999999999999999999999999999999999999974 333344444333322211      1231       


Q ss_pred             --------------------------------------------------------------------------------
Q psy3968         465 --------------------------------------------------------------------------------  464 (1080)
Q Consensus       465 --------------------------------------------------------------------------------  464 (1080)
                                                                                                      
T Consensus       522 GP~~fa~wvr~q~~vlltDTT~RDaHQSLLATRvRt~dl~~IA~~~a~~lp~lfSlE~WGGATfDVamRFL~EdPWeRL~  601 (1149)
T COG1038         522 GPEGFARWVREQKAVLLTDTTFRDAHQSLLATRVRTHDLARIAPATARALPQLFSLEMWGGATFDVAMRFLKEDPWERLE  601 (1149)
T ss_pred             ChHHHHHHHHhccceeeeecchhhHHHHHHHHHHhhhhhhhhhHHHHHhhhhhhchhhhCCchHHHHHHHhccCHHHHHH
Confidence                                                                                            


Q ss_pred             --------------------------------------------------------------------------------
Q psy3968         465 --------------------------------------------------------------------------------  464 (1080)
Q Consensus       465 --------------------------------------------------------------------------------  464 (1080)
                                                                                                      
T Consensus       602 ~lRk~~PNvlfQMLLRgaN~VgY~nyPDnVi~~Fvkqaa~~GIDvFRiFDsLNwv~~M~vaidAV~e~gkv~EatiCYTG  681 (1149)
T COG1038         602 RLRKAVPNVLFQMLLRGANGVGYKNYPDNVIREFVKQAAKSGIDVFRIFDSLNWVEQMRVAIDAVREAGKVAEATICYTG  681 (1149)
T ss_pred             HHHHhCCchHHHHHhccccccCcCCCchHHHHHHHHHHHhcCccEEEeehhhcchhhhhhHHHHHHhcCCeEEEEEEecc
Confidence                                                                                            


Q ss_pred             ----------------------------eeeeccccCccChHHHHHHHHHHHHHCCCCceEEeeCCCCchhHHHHHHHHH
Q psy3968         465 ----------------------------LINTFDMAGLLKPRAAKLLIGAIREKHPDIPIHIHTHDTSGAGVASMIACAE  516 (1080)
Q Consensus       465 ----------------------------~i~i~Dt~G~~~P~~~~~lv~~l~~~~p~~~i~~H~H~t~Gla~an~l~Ai~  516 (1080)
                                                  .|.||||+|++.|..++.||++||+.+ ++|||+|+|||.|.++|++++|++
T Consensus       682 Dildp~r~kY~L~YY~~lA~el~~~GaHIlaIKDMAGLLKP~AA~~Li~aLr~~~-dlPIHlHTHDTsG~~~at~~aA~~  760 (1149)
T COG1038         682 DILDPGRKKYTLDYYVKLAKELEKAGAHILAIKDMAGLLKPAAAYRLISALRETV-DLPIHLHTHDTSGNGVATYLAAVE  760 (1149)
T ss_pred             ccCCCCcccccHHHHHHHHHHHHhcCCcEEEehhhhhccCHHHHHHHHHHHHHhc-CCceEEeccCCCccHHHHHHHHHH
Confidence                                        123999999999999999999999999 999999999999999999999999


Q ss_pred             cCCCEEeeccCCCCCCCCCCcHHHHHHHHhcCCCCCCCCHHHHHHHHHHHHHHHhccCCCCccCCCCcCCcceeccCCCC
Q psy3968         517 AGADVVDVAVDSMSGMTSQPSMGAVVASLQGSDIDTGLDLKDISAYSAYWEQTRQLYAPFECTTTMKSGNADVYLNEIPG  596 (1080)
Q Consensus       517 aG~~~vd~s~~glg~~~g~~~~e~~v~~l~~~g~~~~~d~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~iPG  596 (1080)
                      ||||+||+++++|+|.||||++.+++++|.+..+++++|.+.+..++.||+.+|..|.+||+  .++++++.||.|+|||
T Consensus       761 AGvDivD~A~~smsG~TSQPsl~si~~al~~~~r~~~ld~~~~~~i~~YWe~vR~~Ya~FEs--~lkgp~~eVY~HEmPG  838 (1149)
T COG1038         761 AGVDIVDVAMASMSGLTSQPSLNSIVAALAGTERDTGLDIEAVRELSFYWEAVRKLYAPFES--GLKGPATEVYLHEMPG  838 (1149)
T ss_pred             cCCchhhhhhhhccCCCCCccHHHHHHHhcCCCCCCCCCHHHHHHHHHHHHHHHHhhhhhhc--CCCCCCcceeeeecCC
Confidence            99999999999999999999999999999999999999999999999999999999999998  5899999999999999


Q ss_pred             chhhcHHHHHHHCCCCccHHHHHHHHHHHHHhCCCccccCCCchhhHHhhHHHHhhcccHHHHhhhcccccCcHHHHHhh
Q psy3968         597 GQYTNLQFQAYSLGLGEFFEDVKKAYREANLLLGDIIKVTPSSKVVGDFAQFMVQNKLTSEEVLARAEELSFPKSVVEFL  676 (1080)
Q Consensus       597 G~~snl~~ql~~~g~~~~~~ev~~~~~~vr~~lG~~~~VTP~Sqivg~qA~~~v~n~l~~~~~~~~~~~~~~~~~~~~~~  676 (1080)
                      ||+|||++|++.+|+.+||+||.+.|.+|+++||++++|||||++||++|+|||+|.||.+++.+++..+.||+||+.|+
T Consensus       839 GQ~tNLk~QA~slGLg~Rw~evk~~Y~~vN~mfGdivKVTPSSKVVGDmAl~MV~n~Lt~~dv~~~~~~l~fPdSVv~ff  918 (1149)
T COG1038         839 GQLTNLKQQARSLGLGDRWEEVKEAYREVNRMFGDIVKVTPSSKVVGDLALFMVQNDLTEEDVENDANDLDFPDSVVSFF  918 (1149)
T ss_pred             cccccHHHHHHhccchhhHHHHHHHHHHHHHHhCCceEecccchhHHHHHHHHHhcCCCHHHHhcccccCCCcHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCCCCCCChhHHhhhhcCCCcccCCCCCCCCCcchHHHHHHHHhhCCC-CChHHHHHHhcCChhhHHHHHHHHhcC
Q psy3968         677 QGAIGTPYQGFPEPLRSKVLKDMPRIEGRPGASLPPFDFGKLKTELQERHPE-ATDRDVMSAALYPQVTEDYLTFRESFG  755 (1080)
Q Consensus       677 ~G~~G~~~~~~~~~~~~~~l~~~~~~~~~p~~~~~~~~~~~~~~~l~~~~~~-~~~ed~l~~~~~p~~~~~f~~~~~~~~  755 (1080)
                      +|..|+|||+||++|++++|||++++++||+.++||.||++.|++|+++.++ .+|.|+++|+|||+++++|.++|+.||
T Consensus       919 ~G~lGqP~gGfPe~Lqk~vLkg~~p~t~Rpg~~l~~~d~~a~r~~l~~~~~~~~~d~d~~sy~lyPkvf~dy~~~~~~yG  998 (1149)
T COG1038         919 RGELGQPPGGFPEPLQKKVLKGREPLTDRPGELLEPADFEAIRKELEEKLGREVSDQDVASYLLYPKVFEDYQKHRETYG  998 (1149)
T ss_pred             hcccCCCCCCCCHHHHHHHhcCCCccccCccccCCccchHHHHHHHHHHhCCCchhHHHHHHHhcchhHHHHHHHHHhcC
Confidence            9999999999999999999999999999999999999999999999999886 899999999999999999999999999


Q ss_pred             CCCCCCccccccCCCCCceEEEEecCCcchHHhhhhcCCccchhhhhcccceeeeecccccccccccceecccccccccc
Q psy3968         756 PVDKLDTRIFLTGPKVGEEFEVKIQPPQGFRQILKSKGPEAFAKAVRQNKSLLLMDTTFRDAHQSLLATRVRSHDLLKIS  835 (1080)
Q Consensus       756 ~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~  835 (1080)
                      +++.|||+.||+|++.|||++|++++||           +++|++                     .++    +++++. 
T Consensus       999 d~S~L~t~~ff~gm~~gEe~~v~ie~Gk-----------tLii~l---------------------~ai----ge~d~~- 1041 (1149)
T COG1038         999 DVSVLPTPTFFYGLRPGEEIEVEIEKGK-----------TLIIKL---------------------QAI----GEPDEK- 1041 (1149)
T ss_pred             CccccCcchhhccCCCCceEEEEecCCc-----------EEEEEe---------------------ccc----CCCCcC-
Confidence            9999999999999999999999999999           999999                     555    666666 


Q ss_pred             hhhhhccCccceeeccCCccchheecccccCCeEEEEEECCccccccccceeccccccccccCCCCccccCCCcCCCCCC
Q psy3968         836 PFVAHKFNNLYSLENWGGATFDVALRFLHECPWERLEEMRKQIPNIPFQMLLRGANAVGYTNYPDNEMHIHPKAAKSVPG  915 (1080)
Q Consensus       836 ~~~~~~~~~~~~~e~~G~~~~~~~~r~~~~~~~~~~~~v~g~~~~vp~q~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~  915 (1080)
                                      |.              ++++|++||++|++    .|.+++.       ......+++++++|++
T Consensus      1042 ----------------G~--------------r~v~felNGq~R~i----~v~Drs~-------~~~~~~r~KAd~~Np~ 1080 (1149)
T COG1038        1042 ----------------GM--------------RTVYFELNGQPREI----KVKDRSV-------GSSVVARRKADPGNPG 1080 (1149)
T ss_pred             ----------------Cc--------------EEEEEEeCCceeee----eeccccc-------ccccccccccCCCCcc
Confidence                            77              89999999999999    8888765       3345678899999999


Q ss_pred             cccCCCCeEEEEEEecCCCeeecCCEEEEEEccCCceeEecCCCeEEeEeeee--eeeecCceeEEec
Q psy3968         916 QVGAPMPGSVMEIRVKVGDKVEKGAALVVLSAMKMEMVVQAPVQGVVKSIDAS--MLLRGANAVGYTN  981 (1080)
Q Consensus       916 ~v~aPm~G~v~~~~v~~G~~V~~g~~~~~ieamKm~~~i~a~~~G~v~~~~~~--~~v~~g~~l~~~~  981 (1080)
                      ||.|||||+|+++.|++||+|++||+|+++||||||+.|.||.+|+|++++|+  ++|..||+|+.++
T Consensus      1081 higApmpG~Vv~v~V~~G~~Vk~Gd~l~~ieAMKMEt~i~Ap~dG~i~~v~V~~gd~i~~gDLLi~~~ 1148 (1149)
T COG1038        1081 HIGAPMPGVVVEVKVKKGDKVKKGDVLAVIEAMKMETTISAPFDGTVKEVLVKDGDQIDGGDLLVVVE 1148 (1149)
T ss_pred             ccCCCCCCceEEEEEccCCeecCCCeeeehhhhhhceeeecCCCceEeEEEecCCCccccCceEEEcc
Confidence            99999999999999999999999999999999999999999999999999999  9999999999874

>KOG0369|consensus Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>KOG0238|consensus Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>COG0439 AccC Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK08654 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>PRK07178 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>PRK08463 acetyl-CoA carboxylase subunit A; Validated Back     alignment and domain information
>PRK12833 acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase Back     alignment and domain information
>PRK05586 biotin carboxylase; Validated Back     alignment and domain information
>TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase subunit Back     alignment and domain information
>PRK08462 biotin carboxylase; Validated Back     alignment and domain information
>KOG0368|consensus Back     alignment and domain information
>PRK08591 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PF02436 PYC_OADA: Conserved carboxylase domain; InterPro: IPR003379 This domain represents a conserved region in pyruvate carboxylase (PYC) (6 Back     alignment and domain information
>PRK06111 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>KOG0369|consensus Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>PF02786 CPSase_L_D2: Carbamoyl-phosphate synthase L chain, ATP binding domain; InterPro: IPR005479 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>PLN02735 carbamoyl-phosphate synthase Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PLN02257 phosphoribosylamine--glycine ligase Back     alignment and domain information
>PRK13790 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK13789 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2 Back     alignment and domain information
>PRK00885 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>PLN02735 carbamoyl-phosphate synthase Back     alignment and domain information
>TIGR00877 purD phosphoribosylamine--glycine ligase Back     alignment and domain information
>PRK06395 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>PRK05784 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, PurK protein Back     alignment and domain information
>PRK02186 argininosuccinate lyase; Provisional Back     alignment and domain information
>COG0151 PurD Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>PRK07206 hypothetical protein; Provisional Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>COG0458 CarB Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>PRK06524 biotin carboxylase-like protein; Validated Back     alignment and domain information
>PF15632 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathway with Ter operon Back     alignment and domain information
>COG0027 PurT Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>PRK14569 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12344 putative alpha-isopropylmalate/homocitrate synthase family transferase; Provisional Back     alignment and domain information
>PLN02321 2-isopropylmalate synthase Back     alignment and domain information
>PLN03228 methylthioalkylmalate synthase; Provisional Back     alignment and domain information
>PRK01966 ddl D-alanyl-alanine synthetase A; Reviewed Back     alignment and domain information
>PRK00915 2-isopropylmalate synthase; Validated Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase NifV Back     alignment and domain information
>TIGR00973 leuA_bact 2-isopropylmalate synthase, bacterial type Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>PRK14568 vanB D-alanine--D-lactate ligase; Provisional Back     alignment and domain information
>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>PRK14570 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>PRK14572 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>TIGR01205 D_ala_D_alaTIGR D-alanine--D-alanine ligase Back     alignment and domain information
>PRK09389 (R)-citramalate synthase; Provisional Back     alignment and domain information
>TIGR00977 LeuA_rel 2-isopropylmalate synthase/homocitrate synthase family protein Back     alignment and domain information
>COG0119 LeuA Isopropylmalate/homocitrate/citramalate synthases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information
>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>KOG0237|consensus Back     alignment and domain information
>TIGR00970 leuA_yeast 2-isopropylmalate synthase, yeast type Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PRK03739 2-isopropylmalate synthase; Validated Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK14571 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PF02785 Biotin_carb_C: Biotin carboxylase C-terminal domain; InterPro: IPR005482 Acetyl-CoA carboxylase is found in all animals, plants, and bacteria and catalyzes the first committed step in fatty acid synthesis Back     alignment and domain information
>PRK14847 hypothetical protein; Provisional Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>COG2232 Predicted ATP-dependent carboligase related to biotin carboxylase [General function prediction only] Back     alignment and domain information
>KOG2368|consensus Back     alignment and domain information
>cd07942 DRE_TIM_LeuA Mycobacterium tuberculosis LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PF13535 ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A 3LN7_B 2PN1_A 4DIM_A Back     alignment and domain information
>smart00878 Biotin_carb_C Biotin carboxylase C-terminal domain Back     alignment and domain information
>KOG2367|consensus Back     alignment and domain information
>cd07947 DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>TIGR00768 rimK_fam alpha-L-glutamate ligases, RimK family Back     alignment and domain information
>KOG0370|consensus Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>TIGR02144 LysX_arch Lysine biosynthesis enzyme LysX Back     alignment and domain information
>PRK10446 ribosomal protein S6 modification protein; Provisional Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>PF07478 Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; InterPro: IPR011095 This entry represents the C-terminal, catalytic domain of the D-alanine--D-alanine ligase enzyme 6 Back     alignment and domain information
>PF02222 ATP-grasp: ATP-grasp domain; InterPro: IPR003135 The ATP-grasp domain has an unusual nucleotide-binding fold, also referred to as palmate, and is found in a superfamily of enzymes including D-alanine-D-alanine ligase, glutathione synthetase, biotin carboxylase, and carbamoyl phosphate synthetase, the ribosomal protein S6 modification enzyme (RimK), urea amidolyase, tubulin-tyrosine ligase, and three enzymes of purine biosynthesis Back     alignment and domain information
>PRK13277 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase-like protein; Provisional Back     alignment and domain information
>PRK13278 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase; Provisional Back     alignment and domain information
>KOG0370|consensus Back     alignment and domain information
>COG1181 DdlA D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01071 GARS_A: Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain; InterPro: IPR020561 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>PRK14016 cyanophycin synthetase; Provisional Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>PF02655 ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806 The ATP-grasp fold is one of several distinct ATP-binding folds, and is found in enzymes that catalyze the formation of amide bonds, catalyzing the ATP-dependent ligation of a carboxylate-containing molecule to an amino or thiol group-containing molecule [] Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>COG0189 RimK Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08443 RimK: RimK-like ATP-grasp domain; InterPro: IPR013651 This ATP-grasp domain is found in the ribosomal S6 modification enzyme RimK [] Back     alignment and domain information
>COG1821 Predicted ATP-utilizing enzyme (ATP-grasp superfamily) [General function prediction only] Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>COG3919 Predicted ATP-grasp enzyme [General function prediction only] Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>TIGR02146 LysS_fung_arch homocitrate synthase Back     alignment and domain information
>TIGR02068 cya_phycin_syn cyanophycin synthetase Back     alignment and domain information
>PRK12458 glutathione synthetase; Provisional Back     alignment and domain information
>TIGR01435 glu_cys_lig_rel glutamate--cysteine ligase/gamma-glutamylcysteine synthetase, Streptococcus agalactiae type Back     alignment and domain information
>PRK02471 bifunctional glutamate--cysteine ligase/glutathione synthetase; Provisional Back     alignment and domain information
>PRK06748 hypothetical protein; Validated Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid Back     alignment and domain information
>TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein Back     alignment and domain information
>PLN02941 inositol-tetrakisphosphate 1-kinase Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>TIGR01380 glut_syn glutathione synthetase, prokaryotic Back     alignment and domain information
>PRK05246 glutathione synthetase; Provisional Back     alignment and domain information
>PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>TIGR02291 rimK_rel_E_lig alpha-L-glutamate ligase-related protein Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>PRK05704 dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>COG1759 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate synthetase (purine biosynthesis) [Nucleotide transport and metabolism] Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>PF00289 CPSase_L_chain: Carbamoyl-phosphate synthase L chain, N-terminal domain; InterPro: IPR005481 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PLN02226 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>PLN02528 2-oxoisovalerate dehydrogenase E2 component Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>PF14398 ATPgrasp_YheCD: YheC/D like ATP-grasp Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PRK12344 putative alpha-isopropylmalate/homocitrate synthase family transferase; Provisional Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase NifV Back     alignment and domain information
>PF14397 ATPgrasp_ST: Sugar-transfer associated ATP-grasp Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>TIGR01016 sucCoAbeta succinyl-CoA synthetase, beta subunit Back     alignment and domain information
>PRK00696 sucC succinyl-CoA synthetase subunit beta; Provisional Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>PLN02744 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Back     alignment and domain information
>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>PRK09389 (R)-citramalate synthase; Provisional Back     alignment and domain information
>PF13549 ATP-grasp_5: ATP-grasp domain; PDB: 1WR2_A Back     alignment and domain information
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>KOG0558|consensus Back     alignment and domain information
>COG0045 SucC Succinyl-CoA synthetase, beta subunit [Energy production and conversion] Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PLN00124 succinyl-CoA ligase [GDP-forming] subunit beta; Provisional Back     alignment and domain information
>PF02955 GSH-S_ATP: Prokaryotic glutathione synthetase, ATP-grasp domain; InterPro: IPR004218 Prokaryotic glutathione synthetase 6 Back     alignment and domain information
>PRK00915 2-isopropylmalate synthase; Validated Back     alignment and domain information
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>PRK14046 malate--CoA ligase subunit beta; Provisional Back     alignment and domain information
>PRK13380 glycine cleavage system protein H; Provisional Back     alignment and domain information
>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>KOG0557|consensus Back     alignment and domain information
>PLN02235 ATP citrate (pro-S)-lyase Back     alignment and domain information
>PF08442 ATP-grasp_2: ATP-grasp domain; InterPro: IPR013650 The ATP-grasp superfamily currently includes 17 groups of enzymes, catalyzing ATP-dependent ligation of a carboxylate containing molecule to an amino or thiol group-containing molecule [] Back     alignment and domain information
>cd06848 GCS_H Glycine cleavage H-protein Back     alignment and domain information
>TIGR03077 not_gcvH glycine cleavage protein H-like protein, Chlamydial Back     alignment and domain information
>PF13533 Biotin_lipoyl_2: Biotin-lipoyl like Back     alignment and domain information
>PF05770 Ins134_P3_kin: Inositol 1, 3, 4-trisphosphate 5/6-kinase; InterPro: IPR008656 This entry represents inositol-tetrakisphosphate 1-kinase which is also called inositol 1,3,4-trisphosphate 5/6-kinase Back     alignment and domain information
>KOG0559|consensus Back     alignment and domain information
>PRK01202 glycine cleavage system protein H; Provisional Back     alignment and domain information
>PF14305 ATPgrasp_TupA: TupA-like ATPgrasp Back     alignment and domain information
>TIGR00527 gcvH glycine cleavage system H protein Back     alignment and domain information
>PRK00624 glycine cleavage system protein H; Provisional Back     alignment and domain information
>PLN02321 2-isopropylmalate synthase Back     alignment and domain information
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional Back     alignment and domain information
>PF02750 Synapsin_C: Synapsin, ATP binding domain; InterPro: IPR020898 The synapsins are a family of neuron-specific phosphoproteins that coat synaptic vesicles and are involved in the binding between these vesicles and the cytoskeleton (including actin filaments) Back     alignment and domain information
>PLN03228 methylthioalkylmalate synthase; Provisional Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) Back     alignment and domain information
>TIGR00977 LeuA_rel 2-isopropylmalate synthase/homocitrate synthase family protein Back     alignment and domain information
>PF03133 TTL: Tubulin-tyrosine ligase family; InterPro: IPR004344 Tubulins and microtubules are subjected to several post-translational modifications of which the reversible detyrosination/tyrosination of the carboxy-terminal end of most alpha-tubulins has been extensively analysed Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>TIGR00973 leuA_bact 2-isopropylmalate synthase, bacterial type Back     alignment and domain information
>PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional Back     alignment and domain information
>TIGR01730 RND_mfp RND family efflux transporter, MFP subunit Back     alignment and domain information
>PRK03598 putative efflux pump membrane fusion protein; Provisional Back     alignment and domain information
>cd07947 DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PRK15136 multidrug efflux system protein EmrA; Provisional Back     alignment and domain information
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed Back     alignment and domain information
>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>KOG3895|consensus Back     alignment and domain information
>PRK15030 multidrug efflux system transporter AcrA; Provisional Back     alignment and domain information
>PRK11578 macrolide transporter subunit MacA; Provisional Back     alignment and domain information
>TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>PF06973 DUF1297: Domain of unknown function (DUF1297); InterPro: IPR009720 The last two steps of de novo purine biosynthesis are: i) conversion of 5-aminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate (AICAR) to 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate (FAICAR) ii) conversion of FAICAR to inosine5'-monophopsphate (IMP) In bacteria and eukaryotes, these steps are catalysed by the well-characterised bifunctional enzyme PurH [] Back     alignment and domain information
>PF13375 RnfC_N: RnfC Barrel sandwich hybrid domain Back     alignment and domain information
>PRK09859 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>PF01597 GCV_H: Glycine cleavage H-protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes Back     alignment and domain information
>COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>COG3608 Predicted deacylase [General function prediction only] Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>TIGR02146 LysS_fung_arch homocitrate synthase Back     alignment and domain information
>PF02844 GARS_N: Phosphoribosylglycinamide synthetase, N domain; InterPro: IPR020562 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C Back     alignment and domain information
>cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>TIGR02994 ectoine_eutE ectoine utilization protein EutE Back     alignment and domain information
>PRK06748 hypothetical protein; Validated Back     alignment and domain information
>PF02843 GARS_C: Phosphoribosylglycinamide synthetase, C domain; InterPro: IPR020560 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>PF13533 Biotin_lipoyl_2: Biotin-lipoyl like Back     alignment and domain information
>PRK12784 hypothetical protein; Provisional Back     alignment and domain information
>PF11379 DUF3182: Protein of unknown function (DUF3182); InterPro: IPR021519 This family of proteins with unknown function appears to be restricted to Proteobacteria Back     alignment and domain information
>PF14243 DUF4343: Domain of unknown function (DUF4343) Back     alignment and domain information
>COG0119 LeuA Isopropylmalate/homocitrate/citramalate synthases [Amino acid transport and metabolism] Back     alignment and domain information
>cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PRK14847 hypothetical protein; Provisional Back     alignment and domain information
>cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>KOG2156|consensus Back     alignment and domain information
>PF14403 CP_ATPgrasp_2: Circularly permuted ATP-grasp type 2 Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry Back     alignment and domain information
>PF13437 HlyD_3: HlyD family secretion protein Back     alignment and domain information
>PF05896 NQRA: Na(+)-translocating NADH-quinone reductase subunit A (NQRA); InterPro: IPR008703 This family consists of several bacterial Na+-translocating NADH-quinone reductase subunit A (NQRA) proteins Back     alignment and domain information
>PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit Back     alignment and domain information
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional Back     alignment and domain information
>PF06898 YqfD: Putative stage IV sporulation protein YqfD; InterPro: IPR010690 This family consists of several putative bacterial stage IV sporulation (SpoIV) proteins Back     alignment and domain information
>KOG2157|consensus Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PF07065 D123: D123; InterPro: IPR009772 This family contains a number of eukaryotic D123 proteins approximately 330 residues long Back     alignment and domain information
>PRK05849 hypothetical protein; Provisional Back     alignment and domain information
>PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>TIGR02876 spore_yqfD sporulation protein YqfD Back     alignment and domain information
>KOG0559|consensus Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] Back     alignment and domain information
>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit Back     alignment and domain information
>PF09891 DUF2118: Uncharacterized protein conserved in archaea (DUF2118); InterPro: IPR019217 This entry represents a family of hypothetical proteins of unknown function Back     alignment and domain information
>COG1726 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA [Energy production and conversion] Back     alignment and domain information
>PLN02226 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>COG2190 NagE Phosphotransferase system IIA components [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit Back     alignment and domain information
>TIGR00830 PTBA PTS system, glucose subfamily, IIA component Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>KOG2799|consensus Back     alignment and domain information
>KOG3373|consensus Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>PRK05035 electron transport complex protein RnfC; Provisional Back     alignment and domain information
>PF04952 AstE_AspA: Succinylglutamate desuccinylase / Aspartoacylase family; InterPro: IPR007036 This family describes both succinylglutamate desuccinylase that catalyses the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway and also includes aspartoacylase 3 Back     alignment and domain information
>PF00358 PTS_EIIA_1: phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1; InterPro: IPR001127 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) [, ] is a major carbohydrate transport system in bacteria Back     alignment and domain information
>PF06849 DUF1246: Protein of unknown function (DUF1246); InterPro: IPR010672 The last two steps of de novo purine biosynthesis are: i) conversion of 5-aminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate (AICAR) to 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate (FAICAR) ii) conversion of FAICAR to inosine5'-monophopsphate (IMP) In bacteria and eukaryotes, these steps are catalysed by the well-characterised bifunctional enzyme PurH [] Back     alignment and domain information
>PRK09439 PTS system glucose-specific transporter subunit; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1080
3hbl_A1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 1e-128
3hbl_A1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 5e-61
3hbl_A 1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 7e-40
3hbl_A 1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 7e-21
3hb9_A1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 1e-128
3hb9_A1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 1e-61
3hb9_A 1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 2e-39
3hb9_A 1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 8e-21
3bg5_A1173 Crystal Structure Of Staphylococcus Aureus Pyruvate 1e-128
3bg5_A1173 Crystal Structure Of Staphylococcus Aureus Pyruvate 1e-61
3bg5_A 1173 Crystal Structure Of Staphylococcus Aureus Pyruvate 7e-40
3bg5_A 1173 Crystal Structure Of Staphylococcus Aureus Pyruvate 7e-21
3ho8_A1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 1e-128
3ho8_A1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 1e-61
3ho8_A 1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 7e-40
3ho8_A 1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 8e-21
4hnv_A1173 Crystal Structure Of R54e Mutant Of S. Aureus Pyruv 1e-128
4hnv_A1173 Crystal Structure Of R54e Mutant Of S. Aureus Pyruv 2e-61
4hnv_A 1173 Crystal Structure Of R54e Mutant Of S. Aureus Pyruv 8e-40
4hnv_A 1173 Crystal Structure Of R54e Mutant Of S. Aureus Pyruv 7e-21
4hnt_A1173 Crystal Structure Of F403a Mutant Of S. Aureus Pyru 1e-127
4hnt_A1173 Crystal Structure Of F403a Mutant Of S. Aureus Pyru 1e-61
4hnt_A 1173 Crystal Structure Of F403a Mutant Of S. Aureus Pyru 7e-40
4hnt_A 1173 Crystal Structure Of F403a Mutant Of S. Aureus Pyru 7e-21
4hnu_A1173 Crystal Structure Of K442e Mutant Of S. Aureus Pyru 1e-127
4hnu_A1173 Crystal Structure Of K442e Mutant Of S. Aureus Pyru 1e-61
4hnu_A 1173 Crystal Structure Of K442e Mutant Of S. Aureus Pyru 7e-40
4hnu_A 1173 Crystal Structure Of K442e Mutant Of S. Aureus Pyru 7e-21
2dzd_A461 Crystal Structure Of The Biotin Carboxylase Domain 1e-125
3tw7_A1165 Structure Of Rhizobium Etli Pyruvate Carboxylase T8 1e-116
3tw7_A1165 Structure Of Rhizobium Etli Pyruvate Carboxylase T8 4e-55
3tw7_A 1165 Structure Of Rhizobium Etli Pyruvate Carboxylase T8 2e-37
3tw7_A 1165 Structure Of Rhizobium Etli Pyruvate Carboxylase T8 2e-23
2qf7_A1165 Crystal Structure Of A Complete Multifunctional Pyr 1e-116
2qf7_A1165 Crystal Structure Of A Complete Multifunctional Pyr 9e-56
2qf7_A 1165 Crystal Structure Of A Complete Multifunctional Pyr 2e-37
2qf7_A 1165 Crystal Structure Of A Complete Multifunctional Pyr 2e-23
3bg9_A718 Crystal Structure Of Human Pyruvate Carboxylase (Mi 1e-103
3bg9_A 718 Crystal Structure Of Human Pyruvate Carboxylase (Mi 7e-56
3bg9_A 718 Crystal Structure Of Human Pyruvate Carboxylase (Mi 2e-36
3bg3_A718 Crystal Structure Of Human Pyruvate Carboxylase (Mi 1e-103
3bg3_A 718 Crystal Structure Of Human Pyruvate Carboxylase (Mi 7e-56
3bg3_A 718 Crystal Structure Of Human Pyruvate Carboxylase (Mi 7e-36
1ulz_A451 Crystal Structure Of The Biotin Carboxylase Subunit 2e-95
2vpq_A451 Crystal Structure Of Biotin Carboxylase From S. Aur 8e-91
2vqd_A464 Crystal Structure Of Biotin Carboxylase From Pseudo 3e-83
3n6r_A681 Crystal Structure Of The Holoenzyme Of Propionyl-co 5e-81
3n6r_A681 Crystal Structure Of The Holoenzyme Of Propionyl-co 5e-06
3jzf_A486 Crystal Structure Of Biotin Carboxylase From E. Col 6e-81
2gps_A469 Crystal Structure Of The Biotin Carboxylase Subunit 9e-81
2gpw_A469 Crystal Structure Of The Biotin Carboxylase Subunit 9e-81
3rv4_A452 Crystal Structure Of E.Coli Biotin Carboxylase R16e 9e-81
3rup_B452 Crystal Structure Of E.Coli Biotin Carboxylase In C 9e-81
3g8c_A444 Crystal Stucture Of Biotin Carboxylase In Complex W 1e-80
1bnc_A449 Three-Dimensional Structure Of The Biotin Carboxyla 1e-80
1dv2_A452 The Structure Of Biotin Carboxylase, Mutant E288k, 3e-80
3g8d_A444 Crystal Structure Of The Biotin Carboxylase Subunit 5e-80
3u9s_A655 Crystal Structure Of P. Aeruginosa 3-methylcrotonyl 5e-80
3u9s_A655 Crystal Structure Of P. Aeruginosa 3-methylcrotonyl 3e-07
3ouz_A446 Crystal Structure Of Biotin Carboxylase-Adp Complex 5e-74
3va7_A1236 Crystal Structure Of The Kluyveromyces Lactis Urea 2e-64
3jrx_A587 Crystal Structure Of The Bc Domain Of Acc2 In Compl 4e-49
3gid_A540 The Biotin Carboxylase (Bc) Domain Of Human Acetyl- 4e-49
2hjw_A573 Crystal Structure Of The Bc Domain Of Acc2 Length = 4e-49
3jrw_A587 Phosphorylated Bc Domain Of Acc2 Length = 587 4e-49
2yl2_A540 Crystal Structure Of Human Acetyl-Coa Carboxylase 1 4e-48
1w93_A553 Crystal Structure Of Biotin Carboxylase Domain Of A 7e-46
1w96_A554 Crystal Structure Of Biotin Carboxylase Domain Of A 8e-46
2nx9_A 464 Crystal Structure Of The Carboxyltransferase Domain 2e-22
2nx9_A 464 Crystal Structure Of The Carboxyltransferase Domain 8e-09
1rqe_A 539 Propionibacterium Shermanii Transcarboxylase 5s Sub 4e-19
1rqe_A 539 Propionibacterium Shermanii Transcarboxylase 5s Sub 7e-09
1u5j_A 539 Propionibacterium Shermanii Transcarboxylase 5s Sub 4e-19
1u5j_A 539 Propionibacterium Shermanii Transcarboxylase 5s Sub 2e-08
1rqh_A 472 Propionibacterium Shermanii Transcarboxylase 5s Sub 4e-19
1rqh_A 472 Propionibacterium Shermanii Transcarboxylase 5s Sub 4e-08
1rr2_A 473 Propionibacterium Shermanii Transcarboxylase 5s Sub 5e-19
1rr2_A 473 Propionibacterium Shermanii Transcarboxylase 5s Sub 4e-08
1s3h_A 539 Propionibacterium Shermanii Transcarboxylase 5s Sub 1e-18
1s3h_A 539 Propionibacterium Shermanii Transcarboxylase 5s Sub 3e-08
1rqb_A 539 Propionibacterium Shermanii Transcarboxylase 5s Sub 3e-17
1rqb_A 539 Propionibacterium Shermanii Transcarboxylase 5s Sub 3e-06
1a9x_A1073 Carbamoyl Phosphate Synthetase: Caught In The Act O 3e-07
1ce8_A1073 Carbamoyl Phosphate Synthetase From Escherichis Col 1e-06
1jdb_B1073 Carbamoyl Phosphate Synthetase From Escherichia Col 1e-06
2d5d_A74 Structure Of Biotin Carboxyl Carrier Protein (74val 1e-06
2cqy_A108 Solution Structure Of B Domain From Human Propionyl 6e-06
2ejm_A99 Solution Structure Of Ruh-072, An Apo-Biotnyl Domai 1e-05
1dcz_A77 Biotin Carboxyl Carrier Domain Of Transcarboxylase 5e-05
1o78_A84 Biotin Carboxyl Carrier Domain Of Transcarboxylase 5e-05
1z6h_A72 Solution Structure Of Bacillus Subtilis Blap Biotin 4e-04
>pdb|3HBL|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase T908a Mutant Length = 1150 Back     alignment and structure 
Iteration: 1

 Score =  455 bits (1170), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 225/440 (51%), Positives = 298/440 (67%), Gaps = 4/440 (0%)
Query: 3   MHRQKADESYLVGKGLPPVEAYLNIPEIIRVAKENDVDAIHPGYGFLSERSDFAQAVLDA 62
           +HR KADESYLVG  L P E+YLNI  II VAK+ +VDAIHPGYGFLSE   FA+   + 
Sbjct: 42  LHRYKADESYLVGSDLGPAESYLNIERIIDVAKQANVDAIHPGYGFLSENEQFARRCAEE 101
Query: 63  GIRFIGPSPYVVQQMGDKVAARQAAIDSXXXXXXXXXXXXXXXEEAMEFCLKYGLPVIFK 122
           GI+FIGP    +   GDKV AR  AI +               E A EF  + G P++ K
Sbjct: 102 GIKFIGPHLEHLDMFGDKVKARTTAIKADLPVIPGTDGPIKSYELAKEFAEEAGFPLMIK 161
Query: 123 AAYXXXXXXXXXXXKMEDVEENFQRASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGDKA 182
           A             +  ++E+ F RA SEA+ +FGN  ++IE++I+ P+HIEVQ++GD+ 
Sbjct: 162 ATSGGGGKGMRIVREESELEDAFHRAKSEAEKSFGNSEVYIERYIDNPKHIEVQVIGDEH 221
Query: 183 GNVVHLYERDCSVQRRHQKVVEIAPAPHLDINVRNKMTDLAVKLAKHVGYSNAGTVEFLC 242
           GN+VHL+ERDCSVQRRHQKVVE+AP+  L   +R ++ D A++L +++ Y NAGTVEFL 
Sbjct: 222 GNIVHLFERDCSVQRRHQKVVEVAPSVGLSPTLRQRICDAAIQLMENIKYVNAGTVEFLV 281
Query: 243 DESGQFYFIEVNARLQVEHTVTEEITGVDLVQSQIRVAEGMTL--PELGLTQEK-ISPQG 299
               +F+FIEVN R+QVEHT+TE +TG+D+V++QI VA G  L   E+ + Q+K I+  G
Sbjct: 282 -SGDEFFFIEVNPRVQVEHTITEMVTGIDIVKTQILVAAGADLFGEEINMPQQKDITTLG 340
Query: 300 FAIQCRVTTEDPAKNFQPDTGRIEVFRSGEGMGIRLDGASAFAGAIISPYYDSLLVKVIA 359
           +AIQCR+TTEDP  +F PDTG I  +RS  G G+RLD    F GA ISPYYDSLLVK+  
Sbjct: 341 YAIQCRITTEDPLNDFMPDTGTIIAYRSSGGFGVRLDAGDGFQGAEISPYYDSLLVKLST 400
Query: 360 HAADLQSSCAKMNRALREFRVRGVKTNIPFLLNVLTNQKFVNGAVDTYFIDENPQLFTLQ 419
           HA   + +  KM R+LRE R+RGVKTNIPFL+NV+ N+KF +G   T FI+E P+LF +Q
Sbjct: 401 HAISFKQAEEKMVRSLREMRIRGVKTNIPFLINVMKNKKFTSGDYTTKFIEETPELFDIQ 460
Query: 420 PTKNRAQKLLNYLGTVLVNG 439
           P+ +R  K L Y+G V +NG
Sbjct: 461 PSLDRGTKTLEYIGNVTING 480
>pdb|3HBL|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase T908a Mutant Length = 1150 Back     alignment and structure
>pdb|3HBL|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase T908a Mutant Length = 1150 Back     alignment and structure
>pdb|3HBL|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase T908a Mutant Length = 1150 Back     alignment and structure
>pdb|3HB9|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase A610t Mutant Length = 1150 Back     alignment and structure
>pdb|3HB9|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase A610t Mutant Length = 1150 Back     alignment and structure
>pdb|3HB9|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase A610t Mutant Length = 1150 Back     alignment and structure
>pdb|3HB9|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase A610t Mutant Length = 1150 Back     alignment and structure
>pdb|3BG5|A Chain A, Crystal Structure Of Staphylococcus Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|3BG5|A Chain A, Crystal Structure Of Staphylococcus Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|3BG5|A Chain A, Crystal Structure Of Staphylococcus Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|3BG5|A Chain A, Crystal Structure Of Staphylococcus Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|3HO8|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase In Complex With Coenzyme A Length = 1150 Back     alignment and structure
>pdb|3HO8|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase In Complex With Coenzyme A Length = 1150 Back     alignment and structure
>pdb|3HO8|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase In Complex With Coenzyme A Length = 1150 Back     alignment and structure
>pdb|3HO8|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase In Complex With Coenzyme A Length = 1150 Back     alignment and structure
>pdb|4HNV|A Chain A, Crystal Structure Of R54e Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|4HNV|A Chain A, Crystal Structure Of R54e Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|4HNV|A Chain A, Crystal Structure Of R54e Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|4HNV|A Chain A, Crystal Structure Of R54e Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|4HNT|A Chain A, Crystal Structure Of F403a Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|4HNT|A Chain A, Crystal Structure Of F403a Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|4HNT|A Chain A, Crystal Structure Of F403a Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|4HNT|A Chain A, Crystal Structure Of F403a Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|4HNU|A Chain A, Crystal Structure Of K442e Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|4HNU|A Chain A, Crystal Structure Of K442e Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|4HNU|A Chain A, Crystal Structure Of K442e Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|4HNU|A Chain A, Crystal Structure Of K442e Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|2DZD|A Chain A, Crystal Structure Of The Biotin Carboxylase Domain Of Pyruvate Carboxylase Length = 461 Back     alignment and structure
>pdb|3TW7|A Chain A, Structure Of Rhizobium Etli Pyruvate Carboxylase T882a Crystallized Without Acetyl Coenzyme-A Length = 1165 Back     alignment and structure
>pdb|3TW7|A Chain A, Structure Of Rhizobium Etli Pyruvate Carboxylase T882a Crystallized Without Acetyl Coenzyme-A Length = 1165 Back     alignment and structure
>pdb|3TW7|A Chain A, Structure Of Rhizobium Etli Pyruvate Carboxylase T882a Crystallized Without Acetyl Coenzyme-A Length = 1165 Back     alignment and structure
>pdb|3TW7|A Chain A, Structure Of Rhizobium Etli Pyruvate Carboxylase T882a Crystallized Without Acetyl Coenzyme-A Length = 1165 Back     alignment and structure
>pdb|2QF7|A Chain A, Crystal Structure Of A Complete Multifunctional Pyruvate Carboxylase From Rhizobium Etli Length = 1165 Back     alignment and structure
>pdb|2QF7|A Chain A, Crystal Structure Of A Complete Multifunctional Pyruvate Carboxylase From Rhizobium Etli Length = 1165 Back     alignment and structure
>pdb|2QF7|A Chain A, Crystal Structure Of A Complete Multifunctional Pyruvate Carboxylase From Rhizobium Etli Length = 1165 Back     alignment and structure
>pdb|2QF7|A Chain A, Crystal Structure Of A Complete Multifunctional Pyruvate Carboxylase From Rhizobium Etli Length = 1165 Back     alignment and structure
>pdb|3BG9|A Chain A, Crystal Structure Of Human Pyruvate Carboxylase (Missing The Biotin Carboxylase Domain At The N-Terminus) F1077a Mutant Length = 718 Back     alignment and structure
>pdb|3BG9|A Chain A, Crystal Structure Of Human Pyruvate Carboxylase (Missing The Biotin Carboxylase Domain At The N-Terminus) F1077a Mutant Length = 718 Back     alignment and structure
>pdb|3BG9|A Chain A, Crystal Structure Of Human Pyruvate Carboxylase (Missing The Biotin Carboxylase Domain At The N-Terminus) F1077a Mutant Length = 718 Back     alignment and structure
>pdb|3BG3|A Chain A, Crystal Structure Of Human Pyruvate Carboxylase (Missing The Biotin Carboxylase Domain At The N-Terminus) Length = 718 Back     alignment and structure
>pdb|3BG3|A Chain A, Crystal Structure Of Human Pyruvate Carboxylase (Missing The Biotin Carboxylase Domain At The N-Terminus) Length = 718 Back     alignment and structure
>pdb|3BG3|A Chain A, Crystal Structure Of Human Pyruvate Carboxylase (Missing The Biotin Carboxylase Domain At The N-Terminus) Length = 718 Back     alignment and structure
>pdb|1ULZ|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit Of Pyruvate Carboxylase Length = 451 Back     alignment and structure
>pdb|2VPQ|A Chain A, Crystal Structure Of Biotin Carboxylase From S. Aureus Complexed With Amppnp Length = 451 Back     alignment and structure
>pdb|2VQD|A Chain A, Crystal Structure Of Biotin Carboxylase From Pseudomonas Aeruginosa Complexed With Ampcp Length = 464 Back     alignment and structure
>pdb|3N6R|A Chain A, Crystal Structure Of The Holoenzyme Of Propionyl-coa Carboxylase (pcc) Length = 681 Back     alignment and structure
>pdb|3N6R|A Chain A, Crystal Structure Of The Holoenzyme Of Propionyl-coa Carboxylase (pcc) Length = 681 Back     alignment and structure
>pdb|3JZF|A Chain A, Crystal Structure Of Biotin Carboxylase From E. Coli In Complex With Benzimidazoles Series Length = 486 Back     alignment and structure
>pdb|2GPS|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit, E23r Mutant, Of Acetyl-Coa Carboxylase From Escherichia Coli. Length = 469 Back     alignment and structure
>pdb|2GPW|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit, F363a Mutant, Of Acetyl-Coa Carboxylase From Escherichia Coli. Length = 469 Back     alignment and structure
>pdb|3G8C|A Chain A, Crystal Stucture Of Biotin Carboxylase In Complex With Biotin, Bicarbonate, Adp And Mg Ion Length = 444 Back     alignment and structure
>pdb|1BNC|A Chain A, Three-Dimensional Structure Of The Biotin Carboxylase Subunit Of Acetyl-Coa Carboxylase Length = 449 Back     alignment and structure
>pdb|1DV2|A Chain A, The Structure Of Biotin Carboxylase, Mutant E288k, Complexed With Atp Length = 452 Back     alignment and structure
>pdb|3G8D|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit, E296a Mutant, Of Acetyl-Coa Carboxylase From Escherichia Coli Length = 444 Back     alignment and structure
>pdb|3U9S|A Chain A, Crystal Structure Of P. Aeruginosa 3-methylcrotonyl-coa Carboxylase (mcc) 750 Kd Holoenzyme, Coa Complex Length = 655 Back     alignment and structure
>pdb|3U9S|A Chain A, Crystal Structure Of P. Aeruginosa 3-methylcrotonyl-coa Carboxylase (mcc) 750 Kd Holoenzyme, Coa Complex Length = 655 Back     alignment and structure
>pdb|3OUZ|A Chain A, Crystal Structure Of Biotin Carboxylase-Adp Complex From Campylobacter Jejuni Length = 446 Back     alignment and structure
>pdb|3VA7|A Chain A, Crystal Structure Of The Kluyveromyces Lactis Urea Carboxylase Length = 1236 Back     alignment and structure
>pdb|3JRX|A Chain A, Crystal Structure Of The Bc Domain Of Acc2 In Complex With Soraphen A Length = 587 Back     alignment and structure
>pdb|3GID|A Chain A, The Biotin Carboxylase (Bc) Domain Of Human Acetyl-Coa Carboxylase 2 (Acc2) In Complex With Soraphen A Length = 540 Back     alignment and structure
>pdb|2HJW|A Chain A, Crystal Structure Of The Bc Domain Of Acc2 Length = 573 Back     alignment and structure
>pdb|3JRW|A Chain A, Phosphorylated Bc Domain Of Acc2 Length = 587 Back     alignment and structure
>pdb|2YL2|A Chain A, Crystal Structure Of Human Acetyl-Coa Carboxylase 1, Biotin Carboxylase (Bc) Domain Length = 540 Back     alignment and structure
>pdb|1W93|A Chain A, Crystal Structure Of Biotin Carboxylase Domain Of Acetyl- Coenzyme A Carboxylase From Saccharomyces Cerevisiae Length = 553 Back     alignment and structure
>pdb|1W96|A Chain A, Crystal Structure Of Biotin Carboxylase Domain Of Acetyl- Coenzyme A Carboxylase From Saccharomyces Cerevisiae In Complex With Soraphen A Length = 554 Back     alignment and structure
>pdb|2NX9|A Chain A, Crystal Structure Of The Carboxyltransferase Domain Of The Oxaloacetate Decarboxylase Na+ Pump From Vibrio Cholerae Length = 464 Back     alignment and structure
>pdb|2NX9|A Chain A, Crystal Structure Of The Carboxyltransferase Domain Of The Oxaloacetate Decarboxylase Na+ Pump From Vibrio Cholerae Length = 464 Back     alignment and structure
>pdb|1RQE|A Chain A, Propionibacterium Shermanii Transcarboxylase 5s Subunit Bound To Oxaloacetate Length = 539 Back     alignment and structure
>pdb|1RQE|A Chain A, Propionibacterium Shermanii Transcarboxylase 5s Subunit Bound To Oxaloacetate Length = 539 Back     alignment and structure
>pdb|1U5J|A Chain A, Propionibacterium Shermanii Transcarboxylase 5s Subunit, Met186ile Length = 539 Back     alignment and structure
>pdb|1U5J|A Chain A, Propionibacterium Shermanii Transcarboxylase 5s Subunit, Met186ile Length = 539 Back     alignment and structure
>pdb|1S3H|A Chain A, Propionibacterium Shermanii Transcarboxylase 5s Subunit A59t Length = 539 Back     alignment and structure
>pdb|1S3H|A Chain A, Propionibacterium Shermanii Transcarboxylase 5s Subunit A59t Length = 539 Back     alignment and structure
>pdb|1RQB|A Chain A, Propionibacterium Shermanii Transcarboxylase 5s Subunit Length = 539 Back     alignment and structure
>pdb|1RQB|A Chain A, Propionibacterium Shermanii Transcarboxylase 5s Subunit Length = 539 Back     alignment and structure
>pdb|1A9X|A Chain A, Carbamoyl Phosphate Synthetase: Caught In The Act Of Glutamine Hydrolysis Length = 1073 Back     alignment and structure
>pdb|1CE8|A Chain A, Carbamoyl Phosphate Synthetase From Escherichis Coli With Complexed With The Allosteric Ligand Imp Length = 1073 Back     alignment and structure
>pdb|1JDB|B Chain B, Carbamoyl Phosphate Synthetase From Escherichia Coli Length = 1073 Back     alignment and structure
>pdb|2D5D|A Chain A, Structure Of Biotin Carboxyl Carrier Protein (74val Start) From Pyrococcus Horikoshi Ot3 Ligand Free Form Ii Length = 74 Back     alignment and structure
>pdb|2CQY|A Chain A, Solution Structure Of B Domain From Human Propionyl-Coa Carboxylase Alpha Subunit Length = 108 Back     alignment and structure
>pdb|2EJM|A Chain A, Solution Structure Of Ruh-072, An Apo-Biotnyl Domain Form Human Acetyl Coenzyme A Carboxylase Length = 99 Back     alignment and structure
>pdb|1DCZ|A Chain A, Biotin Carboxyl Carrier Domain Of Transcarboxylase (Tc 1.3s) Length = 77 Back     alignment and structure
>pdb|1O78|A Chain A, Biotin Carboxyl Carrier Domain Of Transcarboxylase (1.3s) [10-48] Deletion Mutant Length = 84 Back     alignment and structure
>pdb|1Z6H|A Chain A, Solution Structure Of Bacillus Subtilis Blap Biotinylated- Form Length = 72 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1080
2dzd_A461 Pyruvate carboxylase; biotin carboxylase, ligase; 0.0
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 0.0
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 1e-168
3hbl_A 1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 4e-62
3hbl_A 1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 8e-46
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 5e-24
2qf7_A1165 Pyruvate carboxylase protein; multi-domain, multi- 0.0
2qf7_A1165 Pyruvate carboxylase protein; multi-domain, multi- 1e-167
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi- 4e-62
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi- 8e-48
2qf7_A1165 Pyruvate carboxylase protein; multi-domain, multi- 6e-24
1ulz_A451 Pyruvate carboxylase N-terminal domain; biotin car 0.0
2vpq_A451 Acetyl-COA carboxylase; bacteria, ATP-grAsp domain 0.0
3ouz_A446 Biotin carboxylase; structural genomics, center fo 0.0
2w70_A449 Biotin carboxylase; ligase, ATP-binding, fatty aci 0.0
1w96_A554 ACC, acetyl-coenzyme A carboxylase; ligase, obesit 0.0
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein 0.0
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein 8e-18
3u9t_A675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 0.0
3u9t_A675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 3e-18
3glk_A540 Acetyl-COA carboxylase 2; ATP binding, alternative 0.0
3jrx_A587 Acetyl-COA carboxylase 2; BC domain, soraphen A, a 0.0
3va7_A1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 0.0
3va7_A1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 6e-14
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 1e-164
3bg3_A 718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 2e-69
3bg3_A 718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 1e-48
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 2e-21
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 2e-17
1rqb_A539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 1e-134
1rqb_A 539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 3e-62
1rqb_A 539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 2e-45
2nx9_A464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 1e-128
2nx9_A 464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 6e-57
2nx9_A 464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 4e-46
2cqy_A108 Propionyl-COA carboxylase alpha chain, mitochondri 1e-51
3vmm_A474 Alanine-anticapsin ligase BACD; ATP-grAsp domain, 3e-31
2pn1_A331 Carbamoylphosphate synthase large subunit; ZP_0053 6e-29
4dim_A403 Phosphoribosylglycinamide synthetase; structural g 3e-27
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta s 4e-22
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondri 1e-21
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; bio 9e-20
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; bioti 3e-19
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 6e-19
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 9e-04
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 1e-15
3df7_A305 Putative ATP-grAsp superfamily protein; putative p 3e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 3e-14
4eg0_A317 D-alanine--D-alanine ligase; structural genomics, 2e-13
3aw8_A369 PURK, phosphoribosylaminoimidazole carboxylase, AT 2e-13
1uc8_A280 LYSX, lysine biosynthesis enzyme; alpha-aminoadipa 7e-13
3k5i_A403 Phosphoribosyl-aminoimidazole carboxylase; purine 1e-12
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 1e-11
4e4t_A419 Phosphoribosylaminoimidazole carboxylase, ATPase; 1e-11
1iow_A306 DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen pho 2e-11
2dwc_A433 PH0318, 433AA long hypothetical phosphoribosylglyc 2e-10
1kjq_A391 GART 2, phosphoribosylglycinamide formyltransferas 5e-10
3dxi_A320 Putative aldolase; TIM barrel, 11107N, PSI2, NYSGX 1e-09
3eth_A355 Phosphoribosylaminoimidazole carboxylase ATPase su 1e-09
3r5x_A307 D-alanine--D-alanine ligase; alpha-beta structure, 2e-09
1e4e_A343 Vancomycin/teicoplanin A-type resistance protein; 6e-09
1ehi_A377 LMDDL2, D-alanine:D-lactate ligase; ATP-binding. g 2e-08
2z04_A365 Phosphoribosylaminoimidazole carboxylase ATPase su 2e-08
1a9x_A1073 Carbamoyl phosphate synthetase (large chain); amid 3e-08
2pvp_A367 D-alanine-D-alanine ligase; 2.40A {Helicobacter py 3e-08
3orq_A377 N5-carboxyaminoimidazole ribonucleotide synthetas; 4e-08
2r85_A334 PURP protein PF1517; ATP-grAsp superfamily, unknow 4e-08
3ax6_A380 Phosphoribosylaminoimidazole carboxylase, ATPase; 4e-08
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 9e-08
2fb9_A322 D-alanine:D-alanine ligase; 1.90A {Thermus caldoph 1e-07
1i7n_A309 Synapsin II; synapse, phosphorylation, neuropeptid 2e-07
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 2e-07
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 2e-07
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 3e-07
3se7_A346 VANA; alpha-beta structure, D-alanine-D-lactate li 3e-07
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 4e-07
2p0a_A344 Synapsin-3, synapsin III; neurotransmitter release 1e-06
2i87_A364 D-alanine-D-alanine ligase; APO; 2.00A {Staphyloco 4e-06
3tqt_A372 D-alanine--D-alanine ligase; cell envelope; 1.88A 8e-06
3e5n_A386 D-alanine-D-alanine ligase A; bacterial blight; 2. 1e-05
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl dom 1e-05
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl dom 3e-04
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component 1e-05
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component 2e-04
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase comp 2e-05
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase comp 4e-04
3i12_A364 D-alanine-D-alanine ligase A; D-alanyl-alanine syn 2e-05
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, 3e-05
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, 3e-04
3ble_A337 Citramalate synthase from leptospira interrogans; 1e-04
2r7k_A361 5-formaminoimidazole-4-carboxamide-1-(beta)-D- rib 1e-04
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transfera 2e-04
3ln6_A750 Glutathione biosynthesis bifunctional protein GSH; 4e-04
1tx2_A297 DHPS, dihydropteroate synthase; folate biosynthesi 4e-04
2vp8_A318 Dihydropteroate synthase 2; RV1207 transferase, fo 4e-04
3k3p_A383 D-alanine--D-alanine ligase; D-alanyl-alanine synt 4e-04
2vef_A314 Dihydropteroate synthase; antibiotic resistance, t 5e-04
2ztj_A382 Homocitrate synthase; (beta/alpha)8 TIM barrel, su 9e-04
>2dzd_A Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A {Geobacillus thermodenitrificans} Length = 461 Back     alignment and structure
 Score =  785 bits (2030), Expect = 0.0
 Identities = 240/419 (57%), Positives = 307/419 (73%), Gaps = 4/419 (0%)

Query: 3   MHRQKADESYLVGKGLPPVEAYLNIPEIIRVAKENDVDAIHPGYGFLSERSDFAQAVLDA 62
            HR KADE+YLVG+G  P+EAYL+I  II +AK +DVDAIHPGYGFLSE   FA+   + 
Sbjct: 44  YHRYKADEAYLVGEGKKPIEAYLDIEGIIEIAKAHDVDAIHPGYGFLSENIQFAKRCREE 103

Query: 63  GIRFIGPSPYVVQQMGDKVAARQAAIDSGVPIVPGTPGPITTTEEAMEFCLKYGLPVIFK 122
           GI FIGP+   +   GDKV AR AA+++G+P++PG+ GP+   E+ + F   +G P+I K
Sbjct: 104 GIIFIGPNENHLDMFGDKVKARHAAVNAGIPVIPGSDGPVDGLEDVVAFAEAHGYPIIIK 163

Query: 123 AAYGGGGRGMRVVRKMEDVEENFQRASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGDKA 182
           AA GGGGRGMR+VR   +V+E F+RA SEAKAAFG+  +++EK IE P+HIEVQ+LGD  
Sbjct: 164 AALGGGGRGMRIVRSKSEVKEAFERAKSEAKAAFGSDEVYVEKLIENPKHIEVQILGDYE 223

Query: 183 GNVVHLYERDCSVQRRHQKVVEIAPAPHLDINVRNKMTDLAVKLAKHVGYSNAGTVEFLC 242
           GN+VHLYERDCSVQRRHQKVVE+AP+  L   +R ++ + AV+L + VGY NAGTVEFL 
Sbjct: 224 GNIVHLYERDCSVQRRHQKVVEVAPSVSLSDELRQRICEAAVQLMRSVGYVNAGTVEFLV 283

Query: 243 DESGQFYFIEVNARLQVEHTVTEEITGVDLVQSQIRVAEGMTLPELGL---TQEKISPQG 299
               +FYFIEVN R+QVEHT+TE ITG+D+VQSQI +A+G +L    +    QE I   G
Sbjct: 284 SG-DEFYFIEVNPRIQVEHTITEMITGIDIVQSQILIADGCSLHSHEVGIPKQEDIRING 342

Query: 300 FAIQCRVTTEDPAKNFQPDTGRIEVFRSGEGMGIRLDGASAFAGAIISPYYDSLLVKVIA 359
           +AIQ RVTTEDP  NF PDTG+I  +RSG G G+RLD  + F GA+I+PYYDSLLVK+  
Sbjct: 343 YAIQSRVTTEDPLNNFMPDTGKIMAYRSGGGFGVRLDAGNGFQGAVITPYYDSLLVKLST 402

Query: 360 HAADLQSSCAKMNRALREFRVRGVKTNIPFLLNVLTNQKFVNGAVDTYFIDENPQLFTL 418
            A   + +  KM R LREFR+RG+KTNIPFL NV+ + KF++G  DT FID  P+LF  
Sbjct: 403 WALTFEQAARKMLRNLREFRIRGIKTNIPFLENVVQHPKFLSGEYDTSFIDTTPELFVF 461
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Length = 1150 Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Length = 1150 Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Length = 1150 Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Length = 1150 Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Length = 1150 Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Length = 1165 Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Length = 1165 Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Length = 1165 Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Length = 1165 Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Length = 1165 Back     alignment and structure
>1ulz_A Pyruvate carboxylase N-terminal domain; biotin carboxylase; 2.20A {Aquifex aeolicus} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Length = 451 Back     alignment and structure
>2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus} Length = 451 Back     alignment and structure
>3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} PDB: 3ouu_A* Length = 446 Back     alignment and structure
>2w70_A Biotin carboxylase; ligase, ATP-binding, fatty acid biosynthesis, nucleotide-BIN lipid synthesis, ATP-grAsp domain, fragment screening; HET: L22; 1.77A {Escherichia coli} PDB: 1bnc_A 2j9g_A* 2v58_A* 2v59_A* 2v5a_A* 2vr1_A* 2w6m_A* 1dv1_A* 2w6o_A* 2w6n_A* 2w6q_A* 2w6z_A* 2w6p_A* 2w71_A* 3jzf_A* 3jzi_A* 3rv3_A* 3rup_A* 1dv2_A* 3rv4_A* ... Length = 449 Back     alignment and structure
>1w96_A ACC, acetyl-coenzyme A carboxylase; ligase, obesity, diabetes, fatty acid metabolism, structure-based drug design; HET: S1A; 1.8A {Saccharomyces cerevisiae} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1w93_A Length = 554 Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Length = 681 Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Length = 681 Back     alignment and structure
>3glk_A Acetyl-COA carboxylase 2; ATP binding, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis, manganese; 2.10A {Homo sapiens} PDB: 3gid_A 2hjw_A 2yl2_A Length = 540 Back     alignment and structure
>3jrx_A Acetyl-COA carboxylase 2; BC domain, soraphen A, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis; HET: S1A; 2.50A {Homo sapiens} PDB: 3jrw_A* Length = 587 Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Length = 1236 Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Length = 1236 Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Length = 718 Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Length = 718 Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Length = 718 Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Length = 718 Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Length = 718 Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Length = 539 Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Length = 539 Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Length = 539 Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Length = 464 Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Length = 464 Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Length = 464 Back     alignment and structure
>2cqy_A Propionyl-COA carboxylase alpha chain, mitochondrial; PCCA, B domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>3vmm_A Alanine-anticapsin ligase BACD; ATP-grAsp domain, amino acid ligase, ATP binding; HET: ADP P0D; 2.50A {Bacillus subtilis} Length = 474 Back     alignment and structure
>2pn1_A Carbamoylphosphate synthase large subunit; ZP_00538348.1, ATP-grAsp domain, carbamoylphosphate synthase subunit (split gene in MJ); 2.00A {Exiguobacterium sibiricum} Length = 331 Back     alignment and structure
>4dim_A Phosphoribosylglycinamide synthetase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ligase; 2.61A {Anaerococcus prevotii} Length = 403 Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Length = 77 Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} Length = 94 Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Length = 74 Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Length = 72 Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Length = 72 Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>3df7_A Putative ATP-grAsp superfamily protein; putative protein, PSI-II, nysgrc., structural genomics, protein structure initiative; 1.87A {Archaeoglobus fulgidus} Length = 305 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>4eg0_A D-alanine--D-alanine ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.65A {Burkholderia ambifaria} PDB: 4egq_A Length = 317 Back     alignment and structure
>3aw8_A PURK, phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp; HET: AMP; 2.60A {Thermus thermophilus} Length = 369 Back     alignment and structure
>1uc8_A LYSX, lysine biosynthesis enzyme; alpha-aminoadipate pathway, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: c.30.1.6 d.142.1.7 PDB: 1uc9_A* Length = 280 Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Length = 403 Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Length = 389 Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Length = 419 Back     alignment and structure
>1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} SCOP: c.30.1.2 d.142.1.1 PDB: 1iov_A* 2dln_A* 3v4z_A* Length = 306 Back     alignment and structure
>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* Length = 433 Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Length = 391 Back     alignment and structure
>3dxi_A Putative aldolase; TIM barrel, 11107N, PSI2, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Bacteroides vulgatus atcc 8482} Length = 320 Back     alignment and structure
>3eth_A Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1b6r_A* 3etj_A* 1b6s_A* Length = 355 Back     alignment and structure
>3r5x_A D-alanine--D-alanine ligase; alpha-beta structure, cytosol, structural genomics, for structural genomics of infectious diseases, csgid; HET: MSE ATP; 2.00A {Bacillus anthracis} PDB: 3r23_A* Length = 307 Back     alignment and structure
>1e4e_A Vancomycin/teicoplanin A-type resistance protein; ligase, cell WALL, antibiotic resistance, membrane, peptidog synthesis; HET: ADP PHY; 2.5A {Enterococcus faecium} SCOP: c.30.1.2 d.142.1.1 PDB: 1e4e_B* Length = 343 Back     alignment and structure
>1ehi_A LMDDL2, D-alanine:D-lactate ligase; ATP-binding. grAsp motif for ATP.; HET: ADP PHY; 2.38A {Leuconostoc mesenteroides} SCOP: c.30.1.2 d.142.1.1 Length = 377 Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Length = 1073 Back     alignment and structure
>2pvp_A D-alanine-D-alanine ligase; 2.40A {Helicobacter pylori} Length = 367 Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Length = 377 Back     alignment and structure
>2r85_A PURP protein PF1517; ATP-grAsp superfamily, unknown function; HET: AMP; 1.70A {Pyrococcus furiosus} SCOP: c.30.1.8 d.142.1.9 PDB: 2r84_A* 2r86_A* 2r87_A* Length = 334 Back     alignment and structure
>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Length = 380 Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Length = 298 Back     alignment and structure
>2fb9_A D-alanine:D-alanine ligase; 1.90A {Thermus caldophilus} PDB: 2zdh_A* 2yzg_A 2yzn_A* 2yzm_A* 2zdg_A* 2zdq_A* Length = 322 Back     alignment and structure
>1i7n_A Synapsin II; synapse, phosphorylation, neuropeptide; 1.90A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1i7l_A 1auv_A 1aux_A* Length = 309 Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Length = 307 Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Length = 345 Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Length = 295 Back     alignment and structure
>3se7_A VANA; alpha-beta structure, D-alanine-D-lactate ligase, ligase; HET: ATP; 3.07A {} Length = 346 Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Length = 302 Back     alignment and structure
>2p0a_A Synapsin-3, synapsin III; neurotransmitter release, schizophrenia, vesicle T structural genomics, structural genomics consortium, SGC, neuropeptide; HET: ANP; 1.90A {Homo sapiens} Length = 344 Back     alignment and structure
>2i87_A D-alanine-D-alanine ligase; APO; 2.00A {Staphylococcus aureus subsp} PDB: 2i8c_A* 3n8d_A* 2i80_A* Length = 364 Back     alignment and structure
>3tqt_A D-alanine--D-alanine ligase; cell envelope; 1.88A {Coxiella burnetii} Length = 372 Back     alignment and structure
>3e5n_A D-alanine-D-alanine ligase A; bacterial blight; 2.00A {Xanthomonas oryzae PV} PDB: 3r5f_A* 3rfc_A* Length = 386 Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Length = 81 Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Length = 81 Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Length = 79 Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Length = 79 Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Length = 85 Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Length = 85 Back     alignment and structure
>3i12_A D-alanine-D-alanine ligase A; D-alanyl-alanine synthetase A, ADP binding protein, csgid, A binding, cell shape; HET: ADP; 2.20A {Salmonella typhimurium} PDB: 3q1k_A* Length = 364 Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Length = 337 Back     alignment and structure
>2r7k_A 5-formaminoimidazole-4-carboxamide-1-(beta)-D- ribofuranosyl 5'-monophosphate synthetase...; ATP-grAsp superfamily, ATP-binding; HET: ACP AMZ; 2.10A {Methanocaldococcus jannaschii} SCOP: c.30.1.8 d.142.1.9 PDB: 2r7l_A* 2r7m_A* 2r7n_A* Length = 361 Back     alignment and structure
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Length = 80 Back     alignment and structure
>3ln6_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamyl cysteine ligase domain, ATP-grAsp domain, HYB enzyme; 2.95A {Streptococcus agalactiae serogroup V} Length = 750 Back     alignment and structure
>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ... Length = 297 Back     alignment and structure
>2vp8_A Dihydropteroate synthase 2; RV1207 transferase, folate biosynthesis, antibiotic resistance; 2.64A {Mycobacterium tuberculosis} Length = 318 Back     alignment and structure
>3k3p_A D-alanine--D-alanine ligase; D-alanyl-alanine synthetase, ATP-binding, cell shape, cell W biogenesis/degradation, magnesium, manganese; 2.23A {Streptococcus mutans} Length = 383 Back     alignment and structure
>2vef_A Dihydropteroate synthase; antibiotic resistance, transferase, folate biosynthesis; 1.8A {Streptococcus pneumoniae} PDB: 2veg_A* Length = 314 Back     alignment and structure
>2ztj_A Homocitrate synthase; (beta/alpha)8 TIM barrel, substrate complex, amino-acid BIOS lysine biosynthesis, transferase; HET: AKG; 1.80A {Thermus thermophilus} PDB: 2ztk_A* 2zyf_A* 3a9i_A* Length = 382 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1080
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 100.0
2qf7_A1165 Pyruvate carboxylase protein; multi-domain, multi- 100.0
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 100.0
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein 100.0
3u9t_A675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 100.0
3jrx_A587 Acetyl-COA carboxylase 2; BC domain, soraphen A, a 100.0
2nx9_A464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 100.0
3glk_A540 Acetyl-COA carboxylase 2; ATP binding, alternative 100.0
1rqb_A539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 100.0
3ouz_A446 Biotin carboxylase; structural genomics, center fo 100.0
2dzd_A461 Pyruvate carboxylase; biotin carboxylase, ligase; 100.0
3va7_A1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 100.0
1ulz_A451 Pyruvate carboxylase N-terminal domain; biotin car 100.0
1w96_A554 ACC, acetyl-coenzyme A carboxylase; ligase, obesit 100.0
2vpq_A451 Acetyl-COA carboxylase; bacteria, ATP-grAsp domain 100.0
2w70_A449 Biotin carboxylase; ligase, ATP-binding, fatty aci 100.0
4dim_A403 Phosphoribosylglycinamide synthetase; structural g 100.0
1kjq_A391 GART 2, phosphoribosylglycinamide formyltransferas 100.0
3vot_A425 L-amino acid ligase, BL00235; ATP-grAsp motif, ATP 100.0
2dwc_A433 PH0318, 433AA long hypothetical phosphoribosylglyc 100.0
3mjf_A431 Phosphoribosylamine--glycine ligase; structural ge 100.0
3vmm_A474 Alanine-anticapsin ligase BACD; ATP-grAsp domain, 100.0
1a9x_A1073 Carbamoyl phosphate synthetase (large chain); amid 100.0
2yw2_A424 Phosphoribosylamine--glycine ligase; glycinamide r 100.0
3aw8_A369 PURK, phosphoribosylaminoimidazole carboxylase, AT 100.0
3lp8_A442 Phosphoribosylamine-glycine ligase; ssgcid, NIH, n 100.0
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 100.0
2ip4_A417 PURD, phosphoribosylamine--glycine ligase; GAR syn 100.0
4e4t_A419 Phosphoribosylaminoimidazole carboxylase, ATPase; 100.0
3k5i_A403 Phosphoribosyl-aminoimidazole carboxylase; purine 100.0
1vkz_A412 Phosphoribosylamine--glycine ligase; TM1250, struc 100.0
2qk4_A452 Trifunctional purine biosynthetic protein adenosi; 100.0
3ax6_A380 Phosphoribosylaminoimidazole carboxylase, ATPase; 100.0
2yrx_A451 Phosphoribosylglycinamide synthetase; glycinamide 100.0
2xcl_A422 Phosphoribosylamine--glycine ligase; GAR-SYN, ATP- 100.0
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 100.0
3eth_A355 Phosphoribosylaminoimidazole carboxylase ATPase su 100.0
2z04_A365 Phosphoribosylaminoimidazole carboxylase ATPase su 100.0
3orq_A377 N5-carboxyaminoimidazole ribonucleotide synthetas; 100.0
1a9x_A1073 Carbamoyl phosphate synthetase (large chain); amid 99.98
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 99.97
2pn1_A331 Carbamoylphosphate synthase large subunit; ZP_0053 99.96
3rmj_A370 2-isopropylmalate synthase; LEUA, truncation, neis 99.96
4fu0_A357 D-alanine--D-alanine ligase 7; vancomycin resistan 99.96
3bg3_A 718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 99.96
3i12_A364 D-alanine-D-alanine ligase A; D-alanyl-alanine syn 99.96
1ehi_A377 LMDDL2, D-alanine:D-lactate ligase; ATP-binding. g 99.96
3e5n_A386 D-alanine-D-alanine ligase A; bacterial blight; 2. 99.96
3tqt_A372 D-alanine--D-alanine ligase; cell envelope; 1.88A 99.95
3k3p_A383 D-alanine--D-alanine ligase; D-alanyl-alanine synt 99.95
3hbl_A 1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 99.95
4eg0_A317 D-alanine--D-alanine ligase; structural genomics, 99.95
2i87_A364 D-alanine-D-alanine ligase; APO; 2.00A {Staphyloco 99.95
2ztj_A382 Homocitrate synthase; (beta/alpha)8 TIM barrel, su 99.95
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi- 99.95
3ble_A337 Citramalate synthase from leptospira interrogans; 99.95
3lwb_A373 D-alanine--D-alanine ligase; DDL, D-alanyl--D-alan 99.95
2fb9_A322 D-alanine:D-alanine ligase; 1.90A {Thermus caldoph 99.95
3se7_A346 VANA; alpha-beta structure, D-alanine-D-lactate li 99.94
1e4e_A343 Vancomycin/teicoplanin A-type resistance protein; 99.94
1iow_A306 DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen pho 99.94
3r5x_A307 D-alanine--D-alanine ligase; alpha-beta structure, 99.94
2pvp_A367 D-alanine-D-alanine ligase; 2.40A {Helicobacter py 99.93
3ewb_X293 2-isopropylmalate synthase; LEUA, structural genom 99.93
3eeg_A325 2-isopropylmalate synthase; 11106D, beta barrel, P 99.93
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 99.93
3ivs_A423 Homocitrate synthase, mitochondrial; TIM barrel, m 99.92
1uc8_A280 LYSX, lysine biosynthesis enzyme; alpha-aminoadipa 99.91
3hq1_A644 2-isopropylmalate synthase; LEUA, mycobacterium tu 99.91
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 99.91
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 99.9
3dxi_A320 Putative aldolase; TIM barrel, 11107N, PSI2, NYSGX 99.9
3df7_A305 Putative ATP-grAsp superfamily protein; putative p 99.9
2nx9_A 464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 99.9
1rqb_A 539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 99.89
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 99.89
2r85_A334 PURP protein PF1517; ATP-grAsp superfamily, unknow 99.87
2r7k_A361 5-formaminoimidazole-4-carboxamide-1-(beta)-D- rib 99.85
2pbz_A320 Hypothetical protein; NYSGXRC, PSI-II, IMP biosynt 99.78
3ln7_A757 Glutathione biosynthesis bifunctional protein GSH; 99.77
1gsa_A316 Glutathione synthetase; ligase; HET: ADP GSH; 2.00 99.74
1z2n_X324 Inositol 1,3,4-trisphosphate 5/6-kinase; inositol 99.73
3ln6_A750 Glutathione biosynthesis bifunctional protein GSH; 99.71
1wr2_A238 Hypothetical protein PH1789; structural genomics, 99.7
1i7n_A309 Synapsin II; synapse, phosphorylation, neuropeptid 99.62
2p0a_A344 Synapsin-3, synapsin III; neurotransmitter release 99.6
1pk8_A422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 99.59
2cqy_A108 Propionyl-COA carboxylase alpha chain, mitochondri 99.55
3dxi_A 320 Putative aldolase; TIM barrel, 11107N, PSI2, NYSGX 99.54
2q7d_A346 Inositol-tetrakisphosphate 1-kinase; inositol kina 99.52
1nvm_A 345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 99.49
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 99.43
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 99.34
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase COM 99.33
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 99.31
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transfera 99.29
1ydo_A 307 HMG-COA lyase; TIM-barrel protein, structural geno 99.29
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase comp 99.29
2ztj_A 382 Homocitrate synthase; (beta/alpha)8 TIM barrel, su 99.29
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehy 99.27
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic 99.26
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase c 99.25
3ble_A 337 Citramalate synthase from leptospira interrogans; 99.25
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta s 99.24
2nu8_B388 SCS-beta, succinyl-COA synthetase beta chain; citr 99.24
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase COM 99.23
2fp4_B395 Succinyl-COA ligase [GDP-forming] beta-chain, mito 99.23
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; bioti 99.21
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl dom 99.2
3va7_A1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 99.2
2l5t_A77 Lipoamide acyltransferase; E2 lipoyl domain; NMR { 99.19
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondri 99.19
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; bio 99.19
2cw6_A 298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 99.16
3ewb_X 293 2-isopropylmalate synthase; LEUA, structural genom 99.16
2ftp_A 302 Hydroxymethylglutaryl-COA lyase; structural genomi 99.15
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate 99.13
3t7a_A330 Inositol pyrophosphate kinase; ATP-grAsp fold, tra 99.13
3dva_I 428 Dihydrolipoyllysine-residue acetyltransferase comp 99.12
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, 99.12
3eeg_A 325 2-isopropylmalate synthase; 11106D, beta barrel, P 99.1
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase comp 99.09
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component 99.08
1zy8_K229 Pyruvate dehydrogenase protein X component, mitoch 99.08
1ydn_A 295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 99.07
3ufx_B397 Succinyl-COA synthetase beta subunit; ATP-grAsp fo 99.0
3rmj_A 370 2-isopropylmalate synthase; LEUA, truncation, neis 98.94
1zko_A136 Glycine cleavage system H protein; TM0212, structu 98.94
1hpc_A131 H protein of the glycine cleavage system; transit 98.65
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 98.65
1onl_A128 Glycine cleavage system H protein; hybrid barrel-s 98.54
3a7l_A128 H-protein, glycine cleavage system H protein; lipo 98.52
3ivs_A 423 Homocitrate synthase, mitochondrial; TIM barrel, m 98.42
3klr_A125 Glycine cleavage system H protein; antiparallel be 97.88
3mxu_A143 Glycine cleavage system H protein; seattle structu 97.65
3tzu_A137 GCVH, glycine cleavage system H protein 1; ssgcid, 97.62
3tig_A380 TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Si 97.47
2f1m_A277 Acriflavine resistance protein A; helical hairpin, 97.39
3lnn_A359 Membrane fusion protein (MFP) heavy metal cation Z 97.36
3ne5_B413 Cation efflux system protein CUSB; transmembrane h 97.33
3fpp_A 341 Macrolide-specific efflux protein MACA; hexameric 97.31
3cdx_A354 Succinylglutamatedesuccinylase/aspartoacylase; str 97.16
3hgb_A155 Glycine cleavage system H protein; ssgcid, niaid, 97.12
1vf7_A369 Multidrug resistance protein MEXA; alpha hairpin, 97.05
3na6_A331 Succinylglutamate desuccinylase/aspartoacylase; st 96.92
1ax3_A162 Iiaglc, glucose permease IIA domain; phosphotransf 96.86
4dk0_A 369 Putative MACA; alpha-hairpin, lipoyl, beta-barrel, 96.69
2gpr_A154 Glucose-permease IIA component; phosphotransferase 96.5
3mwd_A425 ATP-citrate synthase; ATP-grAsp, phosphohistidine, 96.39
1f3z_A161 EIIA-GLC, glucose-specific phosphocarrier; phospho 96.36
3fmc_A368 Putative succinylglutamate desuccinylase / aspart; 96.04
3pff_A829 ATP-citrate synthase; phosphohistidine, organic ac 95.56
3hq1_A 644 2-isopropylmalate synthase; LEUA, mycobacterium tu 95.03
2l5t_A77 Lipoamide acyltransferase; E2 lipoyl domain; NMR { 94.96
2qj8_A332 MLR6093 protein; structural genomics, joint center 94.9
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transfera 94.79
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, 94.35
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component 94.3
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 94.25
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase c 93.97
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 93.88
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta s 93.56
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase comp 93.5
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehy 93.5
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; bioti 93.3
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase COM 92.73
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondri 91.12
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic 91.09
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate 90.7
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 90.61
2gpr_A154 Glucose-permease IIA component; phosphotransferase 90.5
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase COM 90.39
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase comp 90.31
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl dom 89.84
1f3z_A161 EIIA-GLC, glucose-specific phosphocarrier; phospho 89.76
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; bio 88.25
3our_B183 EIIA, phosphotransferase system IIA component; exh 88.02
1ax3_A162 Iiaglc, glucose permease IIA domain; phosphotransf 87.35
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 85.5
1aj0_A282 DHPS, dihydropteroate synthase; antibiotic, resist 81.74
4djd_C446 C/Fe-SP, corrinoid/iron-sulfur protein large subun 81.68
3d4r_A169 Domain of unknown function from the PFAM-B_34464; 81.63
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
Probab=100.00  E-value=7.7e-165  Score=1582.54  Aligned_cols=900  Identities=47%  Similarity=0.804  Sum_probs=821.2

Q ss_pred             CCcchhccceEEEccCCCCCCCCCCCHHHHHHHHHHcCCCEEEeCCCcccccHHHHHHHHHcCCcEeCCcHHHHHHhcCH
Q psy3968           1 MHMHRQKADESYLVGKGLPPVEAYLNIPEIIRVAKENDVDAIHPGYGFLSERSDFAQAVLDAGIRFIGPSPYVVQQMGDK   80 (1080)
Q Consensus         1 ~s~~~~~ADea~~v~~~~~~~~~yld~e~Ii~~a~~~~iDaVipg~g~lsE~~~~a~~l~~~gi~~iGps~eai~~~~DK   80 (1080)
                      .++|+++||++|++|++..+.++|+|++.|+++|+++++|+|||+|||++|+..+++.|++.|++++||+++++++++||
T Consensus        40 ~s~~~~~ADe~~~ig~~~~~~~syld~~~Ii~~a~~~~~DaI~pg~gflsE~~~~a~~le~~Gi~~iGp~~eai~~~~DK  119 (1150)
T 3hbl_A           40 SSLHRYKADESYLVGSDLGPAESYLNIERIIDVAKQANVDAIHPGYGFLSENEQFARRCAEEGIKFIGPHLEHLDMFGDK  119 (1150)
T ss_dssp             TCGGGGTSSEEEECCTTSCTTGGGTCHHHHHHHHHHTTCSEEECTTTTSTTCHHHHHHHHHTTCEESSSCHHHHHHHHSH
T ss_pred             cchhhhhcceeeecCCCCCccccccCHHHHHHHHHHhCCCEEEECCCcccccHHHHHHHHHCCCCeeCCCHHHHHHhCCH
Confidence            36899999999999876677789999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHhCCcEEEEeCCCCCCcCeEEECCHhHHHHHHHHHHHHHHHhcCCCc
Q psy3968          81 VAARQAAIDSGVPIVPGTPGPITTTEEAMEFCLKYGLPVIFKAAYGGGGRGMRVVRKMEDVEENFQRASSEAKAAFGNGA  160 (1080)
Q Consensus        81 ~~~r~~l~~~GIpvp~~~~~~v~s~ee~~~~~~~igfPvVVKP~~g~Gg~GV~iv~s~eeL~~a~~~~~~~a~~~~g~~~  160 (1080)
                      ..+|++++++|||+|+++...+.+.+++.++++++|||+||||..|+||+|+++|++.+|+.++++.+.+++...|+++.
T Consensus       120 ~~~r~ll~~aGIPvpp~~~~~v~s~eea~~~a~~iGyPvVVKP~~GgGg~Gv~vv~s~eeL~~a~~~a~~~a~~~fg~~~  199 (1150)
T 3hbl_A          120 VKARTTAIKADLPVIPGTDGPIKSYELAKEFAEEAGFPLMIKATSGGGGKGMRIVREESELEDAFHRAKSEAEKSFGNSE  199 (1150)
T ss_dssp             HHHHHHHHHTTCCBCCBCSSCBCSSSTTTTTGGGTCSSEEEECCC-------CEECCSSSCTHHHHSSSSSCC------C
T ss_pred             HHHHHHHHHcCcCCCCccccCCCCHHHHHHHHHHcCCCEEEEeCCCCCCCCEEEECCHHHHHHHHHHHHHHHHhhcCCCc
Confidence            99999999999999998533678888998899999999999999999999999999999999999887766556677889


Q ss_pred             EEEeeccCCCcEEEEEEEEecCCcEEEEEeeeccccccccEEEEEcCCCCCCHHHHHHHHHHHHHHHHHcCCcceEEEEE
Q psy3968         161 MFIEKFIERPRHIEVQLLGDKAGNVVHLYERDCSVQRRHQKVVEIAPAPHLDINVRNKMTDLAVKLAKHVGYSNAGTVEF  240 (1080)
Q Consensus       161 vlVEeyI~G~~ei~v~vl~d~~G~vv~l~~r~~~~~~~~~~~~~~~Pa~~l~~~~~~~l~~~a~~i~~alg~~G~~~vEf  240 (1080)
                      +++|+||+|++|+++++++|++|+++++++++|+.++++++..+.+|++.++++.++++.+.+.++++++||+|++++||
T Consensus       200 vlVEeyI~G~reieV~vl~d~~G~vv~l~er~~s~qr~~~k~~e~~Pa~~l~~~~~~~l~~~a~~~~~alG~~G~~~vEf  279 (1150)
T 3hbl_A          200 VYIERYIDNPKHIEVQVIGDEHGNIVHLFERDCSVQRRHQKVVEVAPSVGLSPTLRQRICDAAIQLMENIKYVNAGTVEF  279 (1150)
T ss_dssp             BEEECCCSSCEEEEEEEEECSSSCEEEEEEEEEEEESSSCEEEEESSCSSCCHHHHHHHHHHHHHHHHHTTCCEEEEEEE
T ss_pred             EEEEEccCCCcEEEEEEEEeCCCCEEEEEeeccceeccCceeEEecCCCCCCHHHHHHHHHHHHHHHHHcCCCceEEEEE
Confidence            99999999999999999999999999999999999999999999999988999999999999999999999999999999


Q ss_pred             EEcCCCCEEEEEEeccCCCCccchhcccCCCHHHHHHHHHcCCCCCC--CCC-CccccccCeEEEEeeeccCCCCCCCCC
Q psy3968         241 LCDESGQFYFIEVNARLQVEHTVTEEITGVDLVQSQIRVAEGMTLPE--LGL-TQEKISPQGFAIQCRVTTEDPAKNFQP  317 (1080)
Q Consensus       241 ivd~dG~~~~iEvNpR~~g~~~~~e~~tGvdl~~~~l~~alG~~l~~--l~~-~~~~i~~~g~ai~~ri~ae~p~~~f~p  317 (1080)
                      +++++ ++||||||||++++|++++.++|+|++++++++++|.+++.  +++ .|..+..+|++++||+|++||.++|.|
T Consensus       280 lvd~d-~~y~iEINpR~~g~~~vte~~tGvDlv~~~i~ia~G~~L~~~~~~~~~q~~i~~~G~ai~~Ri~aedp~~~f~P  358 (1150)
T 3hbl_A          280 LVSGD-EFFFIEVNPRVQVEHTITEMVTGIDIVKTQILVAAGADLFGEEINMPQQKDITTLGYAIQCRITTEDPLNDFMP  358 (1150)
T ss_dssp             EEETT-EEEEEEEECSCCTTHHHHHHHHCCCHHHHHHHHHTTCCTTSTTTCCCCGGGCCCCSEEEEEEECSEEGGGTSEE
T ss_pred             EEECC-eEEEEEEeCCCCCCcceeehhcCCCHHHHHHHHHCCCCCCccccccccccccccceEEEEEEEeccCCccccCC
Confidence            99987 69999999999999999999999999999999999999875  344 567788899999999999999999999


Q ss_pred             CCCceEEEEcCCcceEEEcCCccCCCceeccccCCeeEEEEEecCChHHHHHHHHHHhhccEEcccccCHHHHHHhcccc
Q psy3968         318 DTGRIEVFRSGEGMGIRLDGASAFAGAIISPYYDSLLVKVIAHAADLQSSCAKMNRALREFRVRGVKTNIPFLLNVLTNQ  397 (1080)
Q Consensus       318 ~~G~i~~~~~~~~~gvr~d~~~~~~G~~i~~~~ds~l~~Via~G~t~~eA~~~a~ral~~i~I~Gv~tni~~l~~il~~~  397 (1080)
                      ++|+|..+++|+++|+|++.+.+++|+.++++|||++|+|+++|+|+++|+++|+++|++++|+|++|||+||+++|.|+
T Consensus       359 ~~G~i~~~~~p~~~gvr~d~~~~~~G~~v~~~yds~lakvi~~g~~~~eA~~~~~~al~~~~i~G~~tn~~~~~~~~~~~  438 (1150)
T 3hbl_A          359 DTGTIIAYRSSGGFGVRLDAGDGFQGAEISPYYDSLLVKLSTHAISFKQAEEKMVRSLREMRIRGVKTNIPFLINVMKNK  438 (1150)
T ss_dssp             CCCCCCEEECCCCTTEEEEESSCSSSCCCCTTSCCCSEEEEEEESSHHHHHHHHHHHHHHCEEESSCCSHHHHHHHHHCH
T ss_pred             CCceEEEEEcCCCCceeccccccccCCEeCCcCCCceeEEEEEeCCHHHHHHHHHHHHhceEEeCccCCHHHHHHHhCCH
Confidence            99999999999999999998767999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccCCceeeeeecCCccccccCCcchHHHHHHHhhheeeecCCCCCCCCCCCCCCCCCCCCCC------C-CCC------
Q psy3968         398 KFVNGAVDTYFIDENPQLFTLQPTKNRAQKLLNYLGTVLVNGPSTPLATPLLPAEVTPPVPEI------P-LGK------  464 (1080)
Q Consensus       398 ~F~~g~~~T~fie~~~elf~~~~~~dra~~L~~yla~V~Vng~~~p~~~~~~~~~~~~~~~~~------~-~G~------  464 (1080)
                      .|++|+++|+||+++|+||.+....+++++++.|++.++|||+. ...++..+....+.++.+      + .|+      
T Consensus       439 ~f~~~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  517 (1150)
T 3hbl_A          439 KFTSGDYTTKFIEETPELFDIQPSLDRGTKTLEYIGNVTINGFP-NVEKRPKPDYELASIPTVSSSKIASFSGTKQLLDE  517 (1150)
T ss_dssp             HHHHSCCCTTHHHHCGGGGCCCCCCCHHHHHHHHHHHHHHHCCT-TSCCCCCCCCCCCCCCCCCHHHHHTCCCHHHHHHH
T ss_pred             HHcCCCcccchhhCCHhhccCCCccchHHHHHHHhhheeecCCC-cccCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHh
Confidence            99999999999999999999999899999999999999999984 222222222111221111      0 121      


Q ss_pred             --------------------------------------------------------------------------------
Q psy3968         465 --------------------------------------------------------------------------------  464 (1080)
Q Consensus       465 --------------------------------------------------------------------------------  464 (1080)
                                                                                                      
T Consensus       518 ~~~~~~~~~~~~~~~v~I~DtTlRDG~Qs~~~~r~~~~~kl~ia~~L~~~~~G~~~lE~~Gga~~e~~~~~~~e~~~e~l  597 (1150)
T 3hbl_A          518 VGPKGVAEWVKKQDDVLLTDTTFRDAHQSLLATRVRTKDMINIASKTADVFKDGFSLEMWGGATFDVAYNFLKENPWERL  597 (1150)
T ss_dssp             HHHHHHHHHHTTCSSBEEEECTTTHHHHHHSTTCCCHHHHHHHHHHHHHHTTTCSEEEEEETTHHHHHHHTSCCCHHHHH
T ss_pred             hCHHHHHHHHHhCCceEEEECccchhhccCCCcCCCHHHHHHHHHHHHHhhCCCcEEeecCCceEEecccccCCCHHHHH
Confidence                                                                                            


Q ss_pred             --------------------------------------------------------------------------------
Q psy3968         465 --------------------------------------------------------------------------------  464 (1080)
Q Consensus       465 --------------------------------------------------------------------------------  464 (1080)
                                                                                                      
T Consensus       598 ~~l~~~~~~~~~~~l~R~~n~vgy~~~pd~v~~~~v~~a~~~Gvd~irif~~~sd~~~~~~~~~~~~e~g~~~~~~i~~~  677 (1150)
T 3hbl_A          598 ERLRKAIPNVLFQMLLRASNAVGYKNYPDNVIHKFVQESAKAGIDVFRIFDSLNWVDQMKVANEAVQEAGKISEGTICYT  677 (1150)
T ss_dssp             HHHHHHCCSSEEEEEEETTTBTCSSCCCHHHHHHHHHHHHHTTCCEEEEECTTCCGGGGHHHHHHHHHTTCEEEEEEECC
T ss_pred             HHHHHhCCCCeEEEEeccccccccccCCchhHHHHHHHHHhCCcCEEEEEeeCCHHHHHHHHHHHHHHHhhheeEEEeec
Confidence                                                                                            


Q ss_pred             ------------------------------eeeeccccCccChHHHHHHHHHHHHHCCCCceEEeeCCCCchhHHHHHHH
Q psy3968         465 ------------------------------LINTFDMAGLLKPRAAKLLIGAIREKHPDIPIHIHTHDTSGAGVASMIAC  514 (1080)
Q Consensus       465 ------------------------------~i~i~Dt~G~~~P~~~~~lv~~l~~~~p~~~i~~H~H~t~Gla~an~l~A  514 (1080)
                                                    +|+||||+|+++|.++++||+++++++ +++|++|||||+|||+||+++|
T Consensus       678 ~~~~~pe~~~~~~~~~~~~~a~~~~~~Ga~~i~l~Dt~G~~~P~~~~~lv~~l~~~~-~~~i~~H~Hnt~G~a~An~laA  756 (1150)
T 3hbl_A          678 GDILNPERSNIYTLEYYVKLAKELEREGFHILAIKDMAGLLKPKAAYELIGELKSAV-DLPIHLHTHDTSGNGLLTYKQA  756 (1150)
T ss_dssp             SCTTCTTTCSSSSHHHHHHHHHHHHHTTCSEEEEEETTCCCCHHHHHHHHHHHHHHC-CSCEEEEECBTTSCHHHHHHHH
T ss_pred             ccccChhhcCCCCHHHHHHHHHHHHHcCCCeeeEcCccCCCCHHHHHHHHHHHHHhc-CCeEEEEeCCCCcHHHHHHHHH
Confidence                                          446999999999999999999999998 9999999999999999999999


Q ss_pred             HHcCCCEEeeccCCCCCCCCCCcHHHHHHHHhcCCCCCCCCHHHHHHHHHHHHHHHhccCCCCccCCCCcCCcceeccCC
Q psy3968         515 AEAGADVVDVAVDSMSGMTSQPSMGAVVASLQGSDIDTGLDLKDISAYSAYWEQTRQLYAPFECTTTMKSGNADVYLNEI  594 (1080)
Q Consensus       515 i~aG~~~vd~s~~glg~~~g~~~~e~~v~~l~~~g~~~~~d~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~i  594 (1080)
                      ++|||++||+|++|||||+|||+||+++++|+.+|++|++|+++|.++++||++++++|.+|+.  .++++|+++|.|||
T Consensus       757 ~~aGa~~vD~ai~GlG~~~gn~~lE~lv~~L~~~g~~tgidl~~l~~~~~~~~~~~~~y~~~~~--~~~~~~~~v~~~~~  834 (1150)
T 3hbl_A          757 IDAGVDIIDTAVASMSGLTSQPSANSLYYALNGFPRHLRTDIEGMESLSHYWSTVRTYYSDFES--DIKSPNTEIYQHEM  834 (1150)
T ss_dssp             HHTTCSEEEEBCGGGCSBTSCCBHHHHHHHTTTSSCCBCSCHHHHHHHHHHHHHHHGGGGGGCC--SCCSCCTTHHHHCC
T ss_pred             HHhCCCEEEEeccccCCCCCCccHHHHHHHHHhcCCCcCccHHHHHHHHHHHHHHHhhhccccC--CCCCCccceEEeeC
Confidence            9999999999999999999999999999999999999999999999999999999999999987  47899999999999


Q ss_pred             CCchhhcHHHHHHHCCCCccHHHHHHHHHHHHHhCCCccccCCCchhhHHhhHHHHhhcccHHHHhhhcccccCcHHHHH
Q psy3968         595 PGGQYTNLQFQAYSLGLGEFFEDVKKAYREANLLLGDIIKVTPSSKVVGDFAQFMVQNKLTSEEVLARAEELSFPKSVVE  674 (1080)
Q Consensus       595 PGG~~snl~~ql~~~g~~~~~~ev~~~~~~vr~~lG~~~~VTP~Sqivg~qA~~~v~n~l~~~~~~~~~~~~~~~~~~~~  674 (1080)
                      ||||+|||++||+++|+.|||+||+++|++||++|||||||||+||||||||+|||+|+|+++++.++++|++||+||++
T Consensus       835 PGg~~snl~~q~~~~g~~~~~~~v~~~~~~v~~~~g~~~~vtp~sq~vg~~a~~~v~~~l~~~~~~~~~~~~~~~~~~~~  914 (1150)
T 3hbl_A          835 PGGQYSNLSQQAKSLGLGERFDEVKDMYRRVNFLFGDIVKVAPSSKVVGDMALYMVQNDLDEQSVITDGYKLDFPESVVS  914 (1150)
T ss_dssp             CSSHHHHHHHHHHHTTCGGGHHHHHHHHHHHHHHTTSCCCCTTHHHHHHHHHHHHHHTTCCTTHHHHSGGGCCCCHHHHH
T ss_pred             CCchhhHHHHHHHHCCcHhHHHHHHHHHHHHHHHcCCCceECchhHHHHHHHHHHHHcCCChhhhhcccccccCCHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhccccCCCCCCCChhHHhhhhcCCCcccCCCCCCCCCcchHHHHHHHHhhCCC-CChHHHHHHhcCChhhHHHHHHHHh
Q psy3968         675 FLQGAIGTPYQGFPEPLRSKVLKDMPRIEGRPGASLPPFDFGKLKTELQERHPE-ATDRDVMSAALYPQVTEDYLTFRES  753 (1080)
Q Consensus       675 ~~~G~~G~~~~~~~~~~~~~~l~~~~~~~~~p~~~~~~~~~~~~~~~l~~~~~~-~~~ed~l~~~~~p~~~~~f~~~~~~  753 (1080)
                      |++|+||+||+|||++++++||+|+++++|||+++++|.||+++|++|+++++. .+|||+|+|+|||+++.+|+++|++
T Consensus       915 ~~~G~~g~~~~~~~~~~~~~~~~~~~~~~~rp~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~  994 (1150)
T 3hbl_A          915 FFKGEIGQPVNGFNKDLQAVILKGQEALTARPGEYLEPVDFEKVRELLEEEQQGPVTEQDIISYVLYPKVYEQYIQTRNQ  994 (1150)
T ss_dssp             HTTTSSCCCTTCCCHHHHHHHHTTCCCCSSCGGGGSCCCCHHHHHHHHHHHSCSCCCHHHHHHHHHSHHHHHHHHHHHHH
T ss_pred             HhCcCCCCCCCCCCHHHHHHHhcCCCCccCCccccCChhhHHHHHHHHHHhhCCCCCHHHHHHHHcCCHHHHHHHHHHHh
Confidence            999999999999999999999999999999999999999999999999998776 8999999999999999999999999


Q ss_pred             cCCCCCCCccccccCCCCCceEEEEecCCcchHHhhhhcCCccchhhhhcccceeeeecccccccccccceecccccccc
Q psy3968         754 FGPVDKLDTRIFLTGPKVGEEFEVKIQPPQGFRQILKSKGPEAFAKAVRQNKSLLLMDTTFRDAHQSLLATRVRSHDLLK  833 (1080)
Q Consensus       754 ~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~  833 (1080)
                      ||+++.|||+.||+|++.||++++++++||           +++|++                     .++    ++.++
T Consensus       995 ~g~~~~~~~~~~~~~~~~~~~~~~~~~~g~-----------~~~i~l---------------------~~~----~~~~~ 1038 (1150)
T 3hbl_A          995 YGNLSLLDTPTFFFGMRNGETVEIEIDKGK-----------RLIIKL---------------------ETI----SEPDE 1038 (1150)
T ss_dssp             HCCGGGSCHHHHHHCCCTTCEEEEEEETTE-----------EEEEEE---------------------EEE----CCCCT
T ss_pred             cCCcccCCchhhhcCCCCCceEEEEccCCc-----------EEEEEe---------------------ccc----CCCCC
Confidence            999999999999999999999999999999           899988                     443    33222


Q ss_pred             cchhhhhccCccceeeccCCccchheecccccCCeEEEEEECCccccccccceeccccccccccCCCCccccCCCcCCCC
Q psy3968         834 ISPFVAHKFNNLYSLENWGGATFDVALRFLHECPWERLEEMRKQIPNIPFQMLLRGANAVGYTNYPDNEMHIHPKAAKSV  913 (1080)
Q Consensus       834 ~~~~~~~~~~~~~~~e~~G~~~~~~~~r~~~~~~~~~~~~v~g~~~~vp~q~~v~~~~~~~~~~~~~~~~~~~~~~~~~~  913 (1080)
                      .                 |.              +++.+++||+.+.+    .+.+...       ......++++++.+
T Consensus      1039 ~-----------------g~--------------~~~~~e~nG~~~~v----~v~~~~~-------~~~~~~~~~~~~~~ 1076 (1150)
T 3hbl_A         1039 N-----------------GN--------------RTIYYAMNGQARRI----YIKDENV-------HTNANVKPKADKSN 1076 (1150)
T ss_dssp             T-----------------SE--------------EEEEEEETTEEEEE----EEECCCS-------SSCCCCCCBCCTTC
T ss_pred             C-----------------Cc--------------eEEEEEECCeEEEE----ecccccc-------cccccccccCCCCC
Confidence            2                 33              78999999999999    6766543       12223456778889


Q ss_pred             CCcccCCCCeEEEEEEecCCCeeecCCEEEEEEccCCceeEecCCCeEEeEeeee--eeeecCceeEEecCC
Q psy3968         914 PGQVGAPMPGSVMEIRVKVGDKVEKGAALVVLSAMKMEMVVQAPVQGVVKSIDAS--MLLRGANAVGYTNYP  983 (1080)
Q Consensus       914 ~~~v~aPm~G~v~~~~v~~G~~V~~g~~~~~ieamKm~~~i~a~~~G~v~~~~~~--~~v~~g~~l~~~~~~  983 (1080)
                      +++|.|||+|+|++|+|++||+|++||+|++|||||||++|+||.+|+|++++++  +.|..|++|++|+..
T Consensus      1077 ~~~v~ap~~G~v~~~~v~~Gd~V~~G~~l~~ieamK~~~~i~ap~~G~v~~i~v~~G~~V~~g~~l~~i~~~ 1148 (1150)
T 3hbl_A         1077 PSHIGAQMPGSVTEVKVSVGETVKANQPLLITEAMKMETTIQAPFDGVIKQVTVNNGDTIATGDLLIEIEKA 1148 (1150)
T ss_dssp             SSEEECSSSEEEEEECCCTTCEECTTCEEEEEESSSCEEEEECSSSEEEEEECCCTTCEECTTBEEEEEC--
T ss_pred             CceeecCceEEEEEEEeCCCCEECCCCEEEEEEeccceeEEecCCCeEEEEEEeCCCCEeCCCCEEEEEecC
Confidence            9999999999999999999999999999999999999999999999999999999  999999999999643
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>3jrx_A Acetyl-COA carboxylase 2; BC domain, soraphen A, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis; HET: S1A; 2.50A {Homo sapiens} PDB: 3jrw_A* Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Back     alignment and structure
>3glk_A Acetyl-COA carboxylase 2; ATP binding, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis, manganese; 2.10A {Homo sapiens} PDB: 3gid_A 2hjw_A 2yl2_A Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Back     alignment and structure
>3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} PDB: 3ouu_A* Back     alignment and structure
>2dzd_A Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A {Geobacillus thermodenitrificans} Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Back     alignment and structure
>1ulz_A Pyruvate carboxylase N-terminal domain; biotin carboxylase; 2.20A {Aquifex aeolicus} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Back     alignment and structure
>1w96_A ACC, acetyl-coenzyme A carboxylase; ligase, obesity, diabetes, fatty acid metabolism, structure-based drug design; HET: S1A; 1.8A {Saccharomyces cerevisiae} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1w93_A Back     alignment and structure
>2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus} Back     alignment and structure
>2w70_A Biotin carboxylase; ligase, ATP-binding, fatty acid biosynthesis, nucleotide-BIN lipid synthesis, ATP-grAsp domain, fragment screening; HET: L22; 1.77A {Escherichia coli} PDB: 1bnc_A 2j9g_A* 2v58_A* 2v59_A* 2v5a_A* 2vr1_A* 2w6m_A* 1dv1_A* 2w6o_A* 2w6n_A* 2w6q_A* 2w6z_A* 2w6p_A* 2w71_A* 3jzf_A* 3jzi_A* 3rv3_A* 3rup_A* 1dv2_A* 3rv4_A* ... Back     alignment and structure
>4dim_A Phosphoribosylglycinamide synthetase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ligase; 2.61A {Anaerococcus prevotii} Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Back     alignment and structure
>3vot_A L-amino acid ligase, BL00235; ATP-grAsp motif, ATP-binding; HET: ADP PG4; 1.80A {Bacillus licheniformis} Back     alignment and structure
>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* Back     alignment and structure
>3mjf_A Phosphoribosylamine--glycine ligase; structural genomics, CEN structural genomics of infectious diseases, csgid; HET: MSE PGE; 1.47A {Yersinia pestis} PDB: 1gso_A Back     alignment and structure
>3vmm_A Alanine-anticapsin ligase BACD; ATP-grAsp domain, amino acid ligase, ATP binding; HET: ADP P0D; 2.50A {Bacillus subtilis} Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Back     alignment and structure
>2yw2_A Phosphoribosylamine--glycine ligase; glycinamide ribonucleotide synthetase, GAR synthetase, ATP B purine nucleotide biosynthetic pathway; HET: ATP; 1.80A {Aquifex aeolicus} PDB: 2yya_A Back     alignment and structure
>3aw8_A PURK, phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp; HET: AMP; 2.60A {Thermus thermophilus} Back     alignment and structure
>3lp8_A Phosphoribosylamine-glycine ligase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>2ip4_A PURD, phosphoribosylamine--glycine ligase; GAR synthetase, purine nucleotid structural genomics, NPPSFA; 2.80A {Thermus thermophilus} Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>1vkz_A Phosphoribosylamine--glycine ligase; TM1250, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Back     alignment and structure
>2qk4_A Trifunctional purine biosynthetic protein adenosi; purine synthesis, enzyme, protein-ATP complex, structural GE structural genomics consortium, SGC; HET: ATP; 2.45A {Homo sapiens} Back     alignment and structure
>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Back     alignment and structure
>2yrx_A Phosphoribosylglycinamide synthetase; glycinamide ribonucleotide synthetase, GAR synthetase; HET: AMP; 1.90A {Geobacillus kaustophilus} PDB: 2yrw_A* 2ys6_A* 2ys7_A Back     alignment and structure
>2xcl_A Phosphoribosylamine--glycine ligase; GAR-SYN, ATP-grAsp, metal binding; HET: ANP; 2.10A {Bacillus subtilis} PDB: 2xd4_A* Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>3eth_A Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1b6r_A* 3etj_A* 1b6s_A* Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>2pn1_A Carbamoylphosphate synthase large subunit; ZP_00538348.1, ATP-grAsp domain, carbamoylphosphate synthase subunit (split gene in MJ); 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>3rmj_A 2-isopropylmalate synthase; LEUA, truncation, neisseria MENI TIM barrel, catalytic domain, dimer, leucine biosynthesis, ketoisovalerate; 1.95A {Neisseria meningitidis} Back     alignment and structure
>4fu0_A D-alanine--D-alanine ligase 7; vancomycin resistance, peptidoglycan synthesis, D-Ala:D-Ser ATP-grAsp domain; HET: ADP; 2.35A {Enterococcus faecalis} Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>3i12_A D-alanine-D-alanine ligase A; D-alanyl-alanine synthetase A, ADP binding protein, csgid, A binding, cell shape; HET: ADP; 2.20A {Salmonella typhimurium} PDB: 3q1k_A* Back     alignment and structure
>1ehi_A LMDDL2, D-alanine:D-lactate ligase; ATP-binding. grAsp motif for ATP.; HET: ADP PHY; 2.38A {Leuconostoc mesenteroides} SCOP: c.30.1.2 d.142.1.1 Back     alignment and structure
>3e5n_A D-alanine-D-alanine ligase A; bacterial blight; 2.00A {Xanthomonas oryzae PV} PDB: 3r5f_A* 3rfc_A* Back     alignment and structure
>3tqt_A D-alanine--D-alanine ligase; cell envelope; 1.88A {Coxiella burnetii} Back     alignment and structure
>3k3p_A D-alanine--D-alanine ligase; D-alanyl-alanine synthetase, ATP-binding, cell shape, cell W biogenesis/degradation, magnesium, manganese; 2.23A {Streptococcus mutans} Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
>4eg0_A D-alanine--D-alanine ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.65A {Burkholderia ambifaria} PDB: 4egq_A 4egj_A Back     alignment and structure
>2i87_A D-alanine-D-alanine ligase; APO; 2.00A {Staphylococcus aureus subsp} PDB: 2i8c_A* 3n8d_A* 2i80_A* Back     alignment and structure
>2ztj_A Homocitrate synthase; (beta/alpha)8 TIM barrel, substrate complex, amino-acid BIOS lysine biosynthesis, transferase; HET: AKG; 1.80A {Thermus thermophilus} PDB: 2ztk_A* 2zyf_A* 3a9i_A* Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>3lwb_A D-alanine--D-alanine ligase; DDL, D-alanyl--D-alanine ligase RV2981C, structural genomics, TB structural GENO consortium, TBSGC; 2.10A {Mycobacterium tuberculosis} Back     alignment and structure
>2fb9_A D-alanine:D-alanine ligase; 1.90A {Thermus caldophilus} PDB: 2zdh_A* 2yzg_A 2yzn_A* 2yzm_A* 2zdg_A* 2zdq_A* Back     alignment and structure
>3se7_A VANA; alpha-beta structure, D-alanine-D-lactate ligase, ligase; HET: ATP; 3.07A {} Back     alignment and structure
>1e4e_A Vancomycin/teicoplanin A-type resistance protein; ligase, cell WALL, antibiotic resistance, membrane, peptidog synthesis; HET: ADP PHY; 2.5A {Enterococcus faecium} SCOP: c.30.1.2 d.142.1.1 PDB: 1e4e_B* Back     alignment and structure
>1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} SCOP: c.30.1.2 d.142.1.1 PDB: 1iov_A* 2dln_A* 3v4z_A* Back     alignment and structure
>3r5x_A D-alanine--D-alanine ligase; alpha-beta structure, cytosol, structural genomics, for structural genomics of infectious diseases, csgid; HET: MSE ATP; 2.00A {Bacillus anthracis} PDB: 3r23_A* Back     alignment and structure
>2pvp_A D-alanine-D-alanine ligase; 2.40A {Helicobacter pylori} Back     alignment and structure
>3ewb_X 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str} Back     alignment and structure
>3eeg_A 2-isopropylmalate synthase; 11106D, beta barrel, PSI-II, structural genomics, protein structure initiative; 2.78A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
>3ivs_A Homocitrate synthase, mitochondrial; TIM barrel, metalloprotein, transferase, claisen condensatio acid biosynthesis; 2.24A {Schizosaccharomyces pombe} PDB: 3ivt_A* 3ivu_A* 3mi3_A* Back     alignment and structure
>1uc8_A LYSX, lysine biosynthesis enzyme; alpha-aminoadipate pathway, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: c.30.1.6 d.142.1.7 PDB: 1uc9_A* Back     alignment and structure
>3hq1_A 2-isopropylmalate synthase; LEUA, mycobacterium tuberculosis inhibition, bromopyruvate, amino-acid biosynthesis; HET: FLC; 1.70A {Mycobacterium tuberculosis} PDB: 1sr9_A 3hpz_A 3hps_A* 3fig_A 3u6w_A 3hpx_A Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3dxi_A Putative aldolase; TIM barrel, 11107N, PSI2, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3df7_A Putative ATP-grAsp superfamily protein; putative protein, PSI-II, nysgrc., structural genomics, protein structure initiative; 1.87A {Archaeoglobus fulgidus} Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>2r85_A PURP protein PF1517; ATP-grAsp superfamily, unknown function; HET: AMP; 1.70A {Pyrococcus furiosus} SCOP: c.30.1.8 d.142.1.9 PDB: 2r84_A* 2r86_A* 2r87_A* Back     alignment and structure
>2r7k_A 5-formaminoimidazole-4-carboxamide-1-(beta)-D- ribofuranosyl 5'-monophosphate synthetase...; ATP-grAsp superfamily, ATP-binding; HET: ACP AMZ; 2.10A {Methanocaldococcus jannaschii} SCOP: c.30.1.8 d.142.1.9 PDB: 2r7l_A* 2r7m_A* 2r7n_A* Back     alignment and structure
>2pbz_A Hypothetical protein; NYSGXRC, PSI-II, IMP biosynthesis, ATP binding protein, PURP structural genomics, protein structure initiative; HET: ATP; 2.50A {Thermococcus kodakarensis} SCOP: c.30.1.8 d.142.1.9 Back     alignment and structure
>3ln7_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamylcysteine ligase domain, ATP-grAsp domain, HYBR enzyme, ATP-binding; 3.20A {Pasteurella multocida} Back     alignment and structure
>1gsa_A Glutathione synthetase; ligase; HET: ADP GSH; 2.00A {Escherichia coli} SCOP: c.30.1.3 d.142.1.1 PDB: 1gsh_A 2glt_A 1glv_A Back     alignment and structure
>1z2n_X Inositol 1,3,4-trisphosphate 5/6-kinase; inositol phosphate kinase, ATP-grAsp, transferase; HET: ADP; 1.20A {Entamoeba histolytica} PDB: 1z2o_X* 1z2p_X* Back     alignment and structure
>3ln6_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamyl cysteine ligase domain, ATP-grAsp domain, HYB enzyme; 2.95A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>1wr2_A Hypothetical protein PH1789; structural genomics, NPPSFA, national on protein structural and functional analyses; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1i7n_A Synapsin II; synapse, phosphorylation, neuropeptide; 1.90A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1i7l_A 1auv_A 1aux_A* Back     alignment and structure
>2p0a_A Synapsin-3, synapsin III; neurotransmitter release, schizophrenia, vesicle T structural genomics, structural genomics consortium, SGC, neuropeptide; HET: ANP; 1.90A {Homo sapiens} Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Back     alignment and structure
>2cqy_A Propionyl-COA carboxylase alpha chain, mitochondrial; PCCA, B domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dxi_A Putative aldolase; TIM barrel, 11107N, PSI2, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>2q7d_A Inositol-tetrakisphosphate 1-kinase; inositol kinase, ITPK1, inositol 1,3,4-5/6 phosphate, inositol phosphate, inositolphosphate; HET: ANP; 1.60A {Homo sapiens} PDB: 2qb5_A* 2odt_X Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Back     alignment and structure
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Back     alignment and structure
>2ztj_A Homocitrate synthase; (beta/alpha)8 TIM barrel, substrate complex, amino-acid BIOS lysine biosynthesis, transferase; HET: AKG; 1.80A {Thermus thermophilus} PDB: 2ztk_A* 2zyf_A* 3a9i_A* Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Back     alignment and structure
>2nu8_B SCS-beta, succinyl-COA synthetase beta chain; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.23.4.1 d.142.1.4 PDB: 1scu_B* 2nu6_B* 1jkj_B* 2nu7_B* 2nu9_B* 2nua_B* 2scu_B* 1jll_B* 1cqj_B* 1cqi_B* Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Back     alignment and structure
>2fp4_B Succinyl-COA ligase [GDP-forming] beta-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.23.4.1 d.142.1.4 PDB: 2fpg_B* 2fpi_B* 2fpp_B* 1euc_B* 1eud_B* Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Back     alignment and structure
>2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>3ewb_X 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str} Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>3t7a_A Inositol pyrophosphate kinase; ATP-grAsp fold, transferase; HET: ADP; 1.70A {Homo sapiens} PDB: 3t9a_A* 3t9b_A* 3t9c_A* 3t9d_A* 3t9e_A* 3t9f_A* 4gb4_A* 4hn2_A* 3t54_A* 3t99_A* Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>3eeg_A 2-isopropylmalate synthase; 11106D, beta barrel, PSI-II, structural genomics, protein structure initiative; 2.78A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>3ufx_B Succinyl-COA synthetase beta subunit; ATP-grAsp fold, ligase; HET: GDP; 2.35A {Thermus aquaticus} Back     alignment and structure
>3rmj_A 2-isopropylmalate synthase; LEUA, truncation, neisseria MENI TIM barrel, catalytic domain, dimer, leucine biosynthesis, ketoisovalerate; 1.95A {Neisseria meningitidis} Back     alignment and structure
>1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A Back     alignment and structure
>1hpc_A H protein of the glycine cleavage system; transit peptide; HET: LPA; 2.00A {Pisum sativum} SCOP: b.84.1.1 PDB: 1dxm_A* 1htp_A* Back     alignment and structure
>2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* Back     alignment and structure
>1onl_A Glycine cleavage system H protein; hybrid barrel-sandwich structure, structural genomics, riken structural genomics/proteomics initiative; 2.50A {Thermus thermophilus} SCOP: b.84.1.1 Back     alignment and structure
>3a7l_A H-protein, glycine cleavage system H protein; lipoic acid, lipoyl, transport protein; 1.30A {Escherichia coli} PDB: 3a7a_B 3ab9_A* 3a8i_E* 3a8j_E* 3a8k_E* Back     alignment and structure
>3ivs_A Homocitrate synthase, mitochondrial; TIM barrel, metalloprotein, transferase, claisen condensatio acid biosynthesis; 2.24A {Schizosaccharomyces pombe} PDB: 3ivt_A* 3ivu_A* 3mi3_A* Back     alignment and structure
>3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} SCOP: b.84.1.0 PDB: 2edg_A Back     alignment and structure
>3mxu_A Glycine cleavage system H protein; seattle structural genomics center for infectious disease, S CAT-scratch disease, bacteremia; HET: CIT; 1.80A {Bartonella henselae} Back     alignment and structure
>3tzu_A GCVH, glycine cleavage system H protein 1; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Mycobacterium marinum} Back     alignment and structure
>3tig_A TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Silurana} PDB: 3tii_A* 3tin_A* Back     alignment and structure
>2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} Back     alignment and structure
>3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} Back     alignment and structure
>3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B Back     alignment and structure
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Back     alignment and structure
>3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A Back     alignment and structure
>1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A Back     alignment and structure
>3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} Back     alignment and structure
>1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A Back     alignment and structure
>4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A Back     alignment and structure
>2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 Back     alignment and structure
>3mwd_A ATP-citrate synthase; ATP-grAsp, phosphohistidine, organic acid, lyase, transferas; HET: CIT; 2.10A {Homo sapiens} PDB: 3mwe_A* Back     alignment and structure
>1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A Back     alignment and structure
>3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* Back     alignment and structure
>3pff_A ATP-citrate synthase; phosphohistidine, organic acid, ATP-grAsp, lyase, transferas; HET: TLA ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3hq1_A 2-isopropylmalate synthase; LEUA, mycobacterium tuberculosis inhibition, bromopyruvate, amino-acid biosynthesis; HET: FLC; 1.70A {Mycobacterium tuberculosis} PDB: 1sr9_A 3hpz_A 3hps_A* 3fig_A 3u6w_A 3hpx_A Back     alignment and structure
>2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Back     alignment and structure
>2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} Back     alignment and structure
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Back     alignment and structure
>2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Back     alignment and structure
>1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3our_B EIIA, phosphotransferase system IIA component; exhibit no hydrolase activity1, lyase-transferase complex; 2.20A {Vibrio vulnificus} SCOP: b.84.3.1 Back     alignment and structure
>1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A Back     alignment and structure
>2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* Back     alignment and structure
>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A Back     alignment and structure
>4djd_C C/Fe-SP, corrinoid/iron-sulfur protein large subunit; TIM barrel, rossmann fold, B12-dependent methyltransferase; HET: B12; 2.38A {Moorella thermoacetica} PDB: 4dje_C* 4djf_C* Back     alignment and structure
>3d4r_A Domain of unknown function from the PFAM-B_34464; structural genomics, joint center for structural genomics; HET: MSE; 2.20A {Methanococcus maripaludis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1080
d1a9xa5275 d.142.1.2 (A:128-402) Carbamoyl phosphate syntheta 3e-67
d1ulza3214 d.142.1.2 (A:115-328) Biotin carboxylase (BC), dom 2e-64
d2j9ga3216 d.142.1.2 (A:115-330) Biotin carboxylase (BC), dom 3e-62
d1a9xa6259 d.142.1.2 (A:677-935) Carbamoyl phosphate syntheta 5e-50
d2r7ka2238 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carbo 9e-45
d1w96a3267 d.142.1.2 (A:184-450) Acetyl-CoA carboxylase, BC-M 9e-44
d1rqba1168 a.5.7.2 (A:307-474) Transcarboxylase 5S subunit, C 5e-38
d2r85a2235 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carbo 7e-34
d1ulza1123 b.84.2.1 (A:329-451) Biotin carboxylase (BC), C-do 4e-30
d1uc8a2192 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme Ly 3e-29
d1i7na2206 d.142.1.3 (A:215-420) Synapsin II {Rat (Rattus nor 1e-28
d2j9ga1116 b.84.2.1 (A:331-446) Biotin carboxylase (BC), C-do 3e-28
d1w96a1116 b.84.2.1 (A:451-566) Acetyl-CoA carboxylase, BC-C 2e-27
d1rqba2303 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N- 2e-25
d1rqba2303 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N- 3e-22
d1kjqa3206 d.142.1.2 (A:113-318) Glycinamide ribonucleotide t 2e-24
d3etja3198 d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribo 3e-22
d1ulza2114 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-term 9e-22
d2j9ga2114 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-term 1e-18
d1iowa2210 d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain 7e-18
d1ehia2228 d.142.1.1 (A:135-362) D-alanine:D-lactate ligase V 2e-17
d1w96a2170 c.30.1.1 (A:14-183) Acetyl-CoA carboxylase, BC-N s 2e-16
d1gsoa3224 d.142.1.2 (A:104-327) Glycinamide ribonucleotide s 1e-15
d1dcza_77 b.84.1.1 (A:) Biotin carboxyl carrier domain of tr 6e-13
d1vkza3220 d.142.1.2 (A:94-313) Glycinamide ribonucleotide sy 6e-12
d1e4ea2211 d.142.1.1 (A:132-342) D-alanine:D-lactate ligase V 3e-10
d1sr9a2310 c.1.10.5 (A:61-370) 2-isopropylmalate synthase Leu 5e-09
d1nvma2289 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolas 7e-09
d1nvma2289 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolas 2e-07
d1k8ma_87 b.84.1.1 (A:) Lipoyl domain of the mitochondrial b 1e-06
d1gjxa_81 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 1e-06
d1laba_80 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 2e-06
d1qjoa_80 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 2e-06
d1pmra_80 b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate 7e-06
d1ghja_79 b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate 4e-05
d1iyua_79 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 6e-05
d1y8ob1102 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoa 7e-04
>d1a9xa5 d.142.1.2 (A:128-402) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Length = 275 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: ATP-grasp
superfamily: Glutathione synthetase ATP-binding domain-like
family: BC ATP-binding domain-like
domain: Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains
species: Escherichia coli [TaxId: 562]

 Score =  225 bits (574), Expect = 3e-67
 Identities = 58/301 (19%), Positives = 111/301 (36%), Gaps = 30/301 (9%)

Query: 79  DKVAARQAAIDSGVPIVPGTPGPITTTEEAMEFCLKYGLPVIFKAAYGGGGRGMRVVRKM 138
           D+     A    G+       G   T EEA+      G P I + ++  GG G  +    
Sbjct: 1   DRRRFDVAMKKIGLETARS--GIAHTMEEALAVAADVGFPCIIRPSFTMGGSGGGIAYNR 58

Query: 139 EDVEENFQRASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGDKAGN--VVHLYERDCSVQ 196
           E+    F+   +          + I++ +   +  E++++ DK  N  +V   E   ++ 
Sbjct: 59  EE----FEEICARGLDLSPTKELLIDESLIGWKEYEMEVVRDKNDNCIIVCSIENFDAMG 114

Query: 197 RRHQKVVEIAPAPHLDINVRNKMTDLAVKLAKHVGYSNAGT-VEFLCD-ESGQFYFIEVN 254
                 + +APA  L       M + ++ + + +G    G+ V+F  + ++G+   IE+N
Sbjct: 115 IHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGGSNVQFAVNPKNGRLIVIEMN 174

Query: 255 ARLQVEHTVTEEITGVDLVQSQIRVAEGMTLPELGLTQEKISPQGFAIQCRVTTEDPAKN 314
            R+     +  + TG  + +   ++A G TL E       I+           + +P+ +
Sbjct: 175 PRVSRSSALASKATGFPIAKVAAKLAVGYTLDE---LMNDITGGRTPA-----SFEPSID 226

Query: 315 FQPDTGRIEVFRSGEGMGIRLDGASAFAGAIISPYYDSLLVKVIAHAADLQSSCAKMNRA 374
           +         F    G   RL                S + +V+A     Q S  K  R 
Sbjct: 227 YVVTKIPRFNFEKFAGANDRLT-----------TQMKS-VGEVMAIGRTQQESLQKALRG 274

Query: 375 L 375
           L
Sbjct: 275 L 275
>d1ulza3 d.142.1.2 (A:115-328) Biotin carboxylase (BC), domain 2 {Aquifex aeolicus [TaxId: 63363]} Length = 214 Back     information, alignment and structure
>d2j9ga3 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]} Length = 216 Back     information, alignment and structure
>d1a9xa6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d2r7ka2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]} Length = 238 Back     information, alignment and structure
>d1w96a3 d.142.1.2 (A:184-450) Acetyl-CoA carboxylase, BC-M subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 267 Back     information, alignment and structure
>d1rqba1 a.5.7.2 (A:307-474) Transcarboxylase 5S subunit, C-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]} Length = 168 Back     information, alignment and structure
>d2r85a2 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]} Length = 235 Back     information, alignment and structure
>d1ulza1 b.84.2.1 (A:329-451) Biotin carboxylase (BC), C-domain {Aquifex aeolicus [TaxId: 63363]} Length = 123 Back     information, alignment and structure
>d1uc8a2 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus [TaxId: 274]} Length = 192 Back     information, alignment and structure
>d1i7na2 d.142.1.3 (A:215-420) Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 206 Back     information, alignment and structure
>d2j9ga1 b.84.2.1 (A:331-446) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]} Length = 116 Back     information, alignment and structure
>d1w96a1 b.84.2.1 (A:451-566) Acetyl-CoA carboxylase, BC-C subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 116 Back     information, alignment and structure
>d1rqba2 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]} Length = 303 Back     information, alignment and structure
>d1rqba2 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]} Length = 303 Back     information, alignment and structure
>d1kjqa3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d3etja3 d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 {Escherichia coli [TaxId: 562]} Length = 198 Back     information, alignment and structure
>d1ulza2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 114 Back     information, alignment and structure
>d2j9ga2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]} Length = 114 Back     information, alignment and structure
>d1iowa2 d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain {Escherichia coli, gene ddlB [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d1ehia2 d.142.1.1 (A:135-362) D-alanine:D-lactate ligase VanA, C-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]} Length = 228 Back     information, alignment and structure
>d1w96a2 c.30.1.1 (A:14-183) Acetyl-CoA carboxylase, BC-N subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 Back     information, alignment and structure
>d1gsoa3 d.142.1.2 (A:104-327) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Escherichia coli [TaxId: 562]} Length = 224 Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Length = 77 Back     information, alignment and structure
>d1vkza3 d.142.1.2 (A:94-313) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Thermotoga maritima [TaxId: 2336]} Length = 220 Back     information, alignment and structure
>d1e4ea2 d.142.1.1 (A:132-342) D-alanine:D-lactate ligase VanA, C-domain {Enterococcus faecium [TaxId: 1352]} Length = 211 Back     information, alignment and structure
>d1sr9a2 c.1.10.5 (A:61-370) 2-isopropylmalate synthase LeuA, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 310 Back     information, alignment and structure
>d1nvma2 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain {Pseudomonas sp. [TaxId: 306]} Length = 289 Back     information, alignment and structure
>d1nvma2 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain {Pseudomonas sp. [TaxId: 306]} Length = 289 Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Length = 81 Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 80 Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Length = 79 Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 79 Back     information, alignment and structure
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1080
d1rqba1168 Transcarboxylase 5S subunit, C-terminal domain {Pr 100.0
d1a9xa5275 Carbamoyl phosphate synthetase (CPS), large subuni 100.0
d1a9xa6259 Carbamoyl phosphate synthetase (CPS), large subuni 100.0
d2j9ga3216 Biotin carboxylase (BC), domain 2 {Escherichia col 100.0
d1ulza3214 Biotin carboxylase (BC), domain 2 {Aquifex aeolicu 100.0
d1w96a3267 Acetyl-CoA carboxylase, BC-M subdomain {Baker's ye 99.98
d1ulza1123 Biotin carboxylase (BC), C-domain {Aquifex aeolicu 99.95
d1rqba2303 Transcarboxylase 5S subunit, N-terminal domain {Pr 99.95
d2j9ga1116 Biotin carboxylase (BC), C-domain {Escherichia col 99.94
d1kjqa3206 Glycinamide ribonucleotide transformylase PurT, do 99.93
d1w96a1116 Acetyl-CoA carboxylase, BC-C subdomain {Baker's ye 99.93
d1vkza3220 Glycinamide ribonucleotide synthetase (GAR-syn), d 99.92
d3etja3198 N5-carboxyaminoimidazole ribonucleotide synthetase 99.92
d1gsoa3224 Glycinamide ribonucleotide synthetase (GAR-syn), d 99.91
d2r7ka2238 5-formaminoimidazole-4-carboxamide ribonucleotide 99.89
d1iowa2210 D-ala-D-ala ligase, C-domain {Escherichia coli, ge 99.89
d1ehia2228 D-alanine:D-lactate ligase VanA, C-domain {Leucono 99.88
d1nvma2289 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic d 99.88
d1e4ea2211 D-alanine:D-lactate ligase VanA, C-domain {Enteroc 99.87
d1sr9a2310 2-isopropylmalate synthase LeuA, catalytic domain 99.86
d1uc8a2192 Lysine biosynthesis enzyme LysX ATP-binding domain 99.85
d2r85a2235 5-formaminoimidazole-4-carboxamide ribonucleotide 99.85
d1dcza_77 Biotin carboxyl carrier domain of transcarboxylase 99.72
d1i7na2206 Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116 99.69
d1bdoa_80 Biotinyl domain of acetyl-CoA carboxylase {Escheri 99.66
d2j9ga2114 Biotin carboxylase (BC), N-terminal domain {Escher 99.54
d1ulza2114 Biotin carboxylase (BC), N-terminal domain {Aquife 99.54
d1rqba2 303 Transcarboxylase 5S subunit, N-terminal domain {Pr 99.5
d1iyua_79 Lipoyl domain of dihydrolipoamide acetyltransferas 99.5
d1w96a2170 Acetyl-CoA carboxylase, BC-N subdomain {Baker's ye 99.44
d1laba_80 Lipoyl domain of dihydrolipoamide acetyltransferas 99.41
d1qjoa_80 Lipoyl domain of dihydrolipoamide acetyltransferas 99.4
d1ghja_79 Lipoyl domain of the 2-oxoglutarate dehydrogenase 99.37
d1k8ma_87 Lipoyl domain of the mitochondrial branched-chain 99.33
d1gjxa_81 Lipoyl domain of dihydrolipoamide acetyltransferas 99.29
d1pmra_80 Lipoyl domain of the 2-oxoglutarate dehydrogenase 99.24
d1y8ob1102 Lipoyl domain of dihydrolipoamide acetyltransferas 99.21
d1nvma2 289 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic d 98.91
d1gsaa2192 Prokaryotic glutathione synthetase, C-domain {Esch 98.74
d2nu7b2238 Succinyl-CoA synthetase, beta-chain, N-terminal do 98.1
d2pbza2213 5-formaminoimidazole-4-carboxamide ribonucleotide 98.03
d1eucb2246 Succinyl-CoA synthetase, beta-chain, N-terminal do 97.67
d1onla_127 Protein H of glycine cleavage system {Thermus ther 96.25
d1sr9a2310 2-isopropylmalate synthase LeuA, catalytic domain 96.24
d1hpca_131 Protein H of glycine cleavage system {Pea (Pisum s 96.2
d1bdoa_80 Biotinyl domain of acetyl-CoA carboxylase {Escheri 96.18
d1iyua_79 Lipoyl domain of dihydrolipoamide acetyltransferas 95.84
d1dcza_77 Biotin carboxyl carrier domain of transcarboxylase 95.43
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 95.3
d1gsoa199 Glycinamide ribonucleotide synthetase (GAR-syn), C 95.2
d1ghja_79 Lipoyl domain of the 2-oxoglutarate dehydrogenase 95.06
d1qjoa_80 Lipoyl domain of dihydrolipoamide acetyltransferas 94.98
d1gsoa2105 Glycinamide ribonucleotide synthetase (GAR-syn), N 94.93
d1vkza186 Glycinamide ribonucleotide synthetase (GAR-syn), C 94.91
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 94.87
d1k8ma_87 Lipoyl domain of the mitochondrial branched-chain 94.78
d1laba_80 Lipoyl domain of dihydrolipoamide acetyltransferas 94.23
d1gjxa_81 Lipoyl domain of dihydrolipoamide acetyltransferas 93.5
d1vf7a_237 Multidrug resistance protein MexA domain {Pseudomo 93.4
d1pmra_80 Lipoyl domain of the 2-oxoglutarate dehydrogenase 93.37
d2f3ga_150 Glucose-specific factor III (glsIII) {Escherichia 89.56
d1kjqa174 Glycinamide ribonucleotide transformylase PurT, C- 89.17
d1gpra_158 Glucose permease IIa domain, IIa-glc {Bacillus sub 89.08
d2gpra_154 Glucose permease IIa domain, IIa-glc {Mycoplasma c 89.03
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 88.78
d1y8ob1102 Lipoyl domain of dihydrolipoamide acetyltransferas 88.33
d1vf7a_237 Multidrug resistance protein MexA domain {Pseudomo 83.48
d1iowa196 D-Ala-D-Ala ligase, N-domain {Escherichia coli, ge 80.92
>d1rqba1 a.5.7.2 (A:307-474) Transcarboxylase 5S subunit, C-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]} Back     information, alignment and structure
class: All alpha proteins
fold: RuvA C-terminal domain-like
superfamily: post-HMGL domain-like
family: Conserved carboxylase domain
domain: Transcarboxylase 5S subunit, C-terminal domain
species: Propionibacterium freudenreichii shermanii [TaxId: 1752]

Probab=100.00  E-value=8.7e-46  Score=373.18  Aligned_cols=160  Identities=27%  Similarity=0.325  Sum_probs=150.1

Q ss_pred             CCCchhhcHHHHHHHCCCCccHHHHHHHHHHHHHhCCCccccCCCchhhHHhhHHHHhhcccHHHHhhhcccccCcHHHH
Q psy3968         594 IPGGQYTNLQFQAYSLGLGEFFEDVKKAYREANLLLGDIIKVTPSSKVVGDFAQFMVQNKLTSEEVLARAEELSFPKSVV  673 (1080)
Q Consensus       594 iPGG~~snl~~ql~~~g~~~~~~ev~~~~~~vr~~lG~~~~VTP~Sqivg~qA~~~v~n~l~~~~~~~~~~~~~~~~~~~  673 (1080)
                      |||||||||++||+++|+.|||+||+++|++||++|||||+|||+|||||+||+|||+|+    +      |+.+|+|++
T Consensus         1 ~PGG~~sNl~~Q~~~~g~~dr~~ev~~~~~~V~~~lG~~~~VTPsSqvVG~~A~~nV~~g----~------~~~~~~e~~   70 (168)
T d1rqba1           1 IPGGMLSNMESQLRAQGAEDKMDEVMAEVPRVRKAAGFPPLVTPSSQIVGTQAVFNVMMG----E------YKRMTGEFA   70 (168)
T ss_dssp             CCHHHHHHHHHHHHTTSCCTTHHHHHHHHHHHHHHTTCCCCCTTHHHHHHHHHHHHHHHC----T------TSSCCHHHH
T ss_pred             CCCchHHHHHHHHHHcCcHhHHHHHHHHHHHHHHhcCCCceeCcHHHHHHHHHHHHHHhh----h------cccccHHHH
Confidence            799999999999999999999999999999999999999999999999999999999875    2      679999999


Q ss_pred             HhhccccCCCCCCCChhHHhhh--hcCCCcccCCCCCCCCCcchHHHHHHHHhhCCC-CChHHHHHHhcCChhhHHHHHH
Q psy3968         674 EFLQGAIGTPYQGFPEPLRSKV--LKDMPRIEGRPGASLPPFDFGKLKTELQERHPE-ATDRDVMSAALYPQVTEDYLTF  750 (1080)
Q Consensus       674 ~~~~G~~G~~~~~~~~~~~~~~--l~~~~~~~~~p~~~~~~~~~~~~~~~l~~~~~~-~~~ed~l~~~~~p~~~~~f~~~  750 (1080)
                      +|++|+||+||+++++++++++  ++|++++++||++.++| ||++.++|+.++.+. .+|||||||+|||+|+.+|+++
T Consensus        71 ~~~~G~~G~~P~~~~~~~~k~~~~~~g~~pit~RPgd~l~p-d~~~~~~el~~~~g~~~sdedlLsyaLyP~V~~~f~~~  149 (168)
T d1rqba1          71 DIMLGYYGASPADRDPKVVKLAEEQSGKKPITQRPADLLPP-EWEKQSKEAATLKGFNGTDEDVLTYALFPQVAPVFFEH  149 (168)
T ss_dssp             HHHTTTTCCCSSCCCHHHHHHHHHHHCCCCCCSCGGGGCCC-CHHHHHHHHTTSTTCCSSHHHHHHHHHCTTTHHHHHHH
T ss_pred             HHhcccccCCCCCCCHHHHHHHHhccCCCCCCCCchhhccc-cHHHHHHHHHHHhCCCCCHHHHHHHHcCChhHHHHHHH
Confidence            9999999999999999999866  67999999999999998 999999999987766 8999999999999999999998


Q ss_pred             HHhcCCCCCCCcccc
Q psy3968         751 RESFGPVDKLDTRIF  765 (1080)
Q Consensus       751 ~~~~~~~~~~~~~~~  765 (1080)
                      |+ +|++++++|...
T Consensus       150 r~-~g~~~v~~t~~~  163 (168)
T d1rqba1         150 RA-EGPHSVALTDAQ  163 (168)
T ss_dssp             GG-GCCCCCSCCHHH
T ss_pred             HH-hCCCCCCcchhh
Confidence            86 799998888653
>d1a9xa5 d.142.1.2 (A:128-402) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j9ga3 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulza3 d.142.1.2 (A:115-328) Biotin carboxylase (BC), domain 2 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w96a3 d.142.1.2 (A:184-450) Acetyl-CoA carboxylase, BC-M subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ulza1 b.84.2.1 (A:329-451) Biotin carboxylase (BC), C-domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1rqba2 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]} Back     information, alignment and structure
>d2j9ga1 b.84.2.1 (A:331-446) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w96a1 b.84.2.1 (A:451-566) Acetyl-CoA carboxylase, BC-C subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vkza3 d.142.1.2 (A:94-313) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3etja3 d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsoa3 d.142.1.2 (A:104-327) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2r7ka2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1iowa2 d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain {Escherichia coli, gene ddlB [TaxId: 562]} Back     information, alignment and structure
>d1ehia2 d.142.1.1 (A:135-362) D-alanine:D-lactate ligase VanA, C-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]} Back     information, alignment and structure
>d1nvma2 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1e4ea2 d.142.1.1 (A:132-342) D-alanine:D-lactate ligase VanA, C-domain {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d1sr9a2 c.1.10.5 (A:61-370) 2-isopropylmalate synthase LeuA, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uc8a2 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2r85a2 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1i7na2 d.142.1.3 (A:215-420) Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j9ga2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulza2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1rqba2 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]} Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1w96a2 c.30.1.1 (A:14-183) Acetyl-CoA carboxylase, BC-N subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvma2 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1gsaa2 d.142.1.1 (A:123-314) Prokaryotic glutathione synthetase, C-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nu7b2 d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pbza2 d.142.1.9 (A:100-312) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1eucb2 d.142.1.4 (B:0-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1onla_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sr9a2 c.1.10.5 (A:61-370) 2-isopropylmalate synthase LeuA, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsoa1 b.84.2.1 (A:328-426) Glycinamide ribonucleotide synthetase (GAR-syn), C-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vkza1 b.84.2.1 (A:314-399) Glycinamide ribonucleotide synthetase (GAR-syn), C-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa1 b.84.2.1 (A:319-392) Glycinamide ribonucleotide transformylase PurT, C-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Mycoplasma capricolum [TaxId: 2095]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1iowa1 c.30.1.2 (A:1-96) D-Ala-D-Ala ligase, N-domain {Escherichia coli, gene ddlB [TaxId: 562]} Back     information, alignment and structure