Psyllid ID: psy3983


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
MSVSPLRVMDQHKMSPSEWESSITTWWKEHKGMLREDAMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEKEDNLTNVMSQDVKKENPLQFKFRAKFYPEDVVEEIIQDITLRLFYLQVSRSAGSRVRFPPGPNCLLTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKNAKQQQRDKLQLEIAAREKAEKKHQESVERLKQLEVEMAKRDQDLMEAQEMIRRLEEQLKQLQAAKEELEARQTELQLELQPIRNQSNLNKV
cccccHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccEEEEEEcccccEEEEEccccccEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccEEcccccccccccccccccccccccEEcccccEEcccccccccEEEEccccccHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
cccccHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccccEEEEEEEccccEEEEEEcccEEEEEcccccccccEEccEcccccEEEEEEEccccccHHHHcccHHHHHHHHHHHHHHHHcccccccHccccccccEEEEHHHEEEEEEEccEEEEEEcccccccEEEEcccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
msvsplrvmdqhkmspseweSSITTWWKEHKGMLREDAMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDalglniyekednltnvmsqdvkkenplqfkfrakfypedVVEEIIQDITLRLFYLQVSrsagsrvrfppgpnclltpkigfpwseirnisfndrkfiikpidkkapdfvffaprVRVNKRILALCMGnhelymrrrkpdtiDVQQMKAQAREEKNAKQQQRDKLQLEIAAREKAEKKHQESVERLKQLEVEMAKRDQDLMEAQEMIRRLEEQLKQLQAAKEELEARQTELQLElqpirnqsnlnkv
msvsplrvmdqhkmspsewessiTTWWKEHKGMLREDAMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEKEDnltnvmsqdvkkenplqFKFRAKFYPEDVVEEIIQDITLRLFYLQVSRSAgsrvrfppgpnCLLTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGnhelymrrrkpdTIDVQQMKAQAReeknakqqqrDKLQLEIAAREKAEKKHQESVERLKQLEVEMAKRDQDLMEAQEMIRRLEEQLKQLQAAKEELEARQTElqlelqpirnqsnlnkv
MSVSPLRVMDQHKMSPSEWESSITTWWKEHKGMLREDAMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEKEDNLTNVMSQDVKKENPLQFKFRAKFYPEDVVEEIIQDITLRLFYLQVSRSAGSRVRFPPGPNCLLTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKNAKQQQRDKLQLEIAAREKAEKKHQESVERLKQLEVEMAKRDQDLMEAQEMIRRLEEQLKQLQAAKEELEARQTELQLELQPIRNQSNLNKV
*********************SITTWWKEHKGMLREDAMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEKEDNLTNVMSQDVKKENPLQFKFRAKFYPEDVVEEIIQDITLRLFYLQVSRSAGSRVRFPPGPNCLLTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHELYMR****************************************************************************************************************
MSVSPLRVMDQHKMSPSEWESSITTWWKEHKGMLREDAMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEKEDNLTNVMSQDVKKENPLQFKFRAKFYPEDVVEEIIQDITLRLFYLQVSRSAGSRVRFPPGPNCLLTPKIGFPWSEIRNISF***********************************************************************************************************************************************************
*********************SITTWWKEHKGMLREDAMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEKEDNLTNVMSQDVKKENPLQFKFRAKFYPEDVVEEIIQDITLRLFYLQVSRSAGSRVRFPPGPNCLLTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHELYMRRRKPDTIDV*******************KLQLEIAAR***********ERLKQLEVEMAKRDQDLMEAQEMIRRLEEQLKQLQAAKEELEARQTELQLELQPIRNQSNLNKV
MSVSPLRVMDQHKMSPSEWESSITTWWKEHKGMLREDAMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEKEDNLTNVMSQDVKKENPLQFKFRAKFYPEDVVEEIIQDITLRLFYLQVSRSAGSRVRFPPGPNCLLTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHELYMRRRKPDTIDVQQMKAQA***********DKLQLEIAAREKAEKKHQESVERLKQLEVEMAKRDQDLMEAQEMIRRLEEQLKQLQAAKEELEARQTELQLELQPIRN*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVSPLRVMDQHKMSPSEWESSITTWWKEHKGMLREDAMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEKEDNLTNVMSQDVKKENPLQFKFRAKFYPEDVVEEIIQDITLRLFYLQVSRSAGSRVRFPPGPNCLLTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHELYMRRRKPDTIDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSNLNKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query318 2.2.26 [Sep-21-2011]
Q29GR8 593 Moesin/ezrin/radixin homo no N/A 0.487 0.261 0.784 3e-72
P46150 578 Moesin/ezrin/radixin homo no N/A 0.487 0.268 0.773 1e-71
Q170J7 583 Moesin/ezrin/radixin homo N/A N/A 0.496 0.271 0.781 2e-71
B0WYY2 572 Moesin/ezrin/radixin homo N/A N/A 0.496 0.276 0.769 1e-70
Q7PS12 581 Moesin/ezrin/radixin homo yes N/A 0.477 0.261 0.757 5e-69
P52962 572 Moesin OS=Lytechinus vari N/A N/A 0.449 0.25 0.575 2e-48
P15311 586 Ezrin OS=Homo sapiens GN= yes N/A 0.474 0.257 0.607 2e-46
P26043 583 Radixin OS=Mus musculus G yes N/A 0.462 0.252 0.636 3e-46
Q8HZQ5 586 Ezrin OS=Oryctolagus cuni yes N/A 0.477 0.259 0.588 6e-46
Q9PU45 583 Radixin OS=Gallus gallus yes N/A 0.462 0.252 0.636 8e-46
>sp|Q29GR8|MOEH_DROPS Moesin/ezrin/radixin homolog 1 OS=Drosophila pseudoobscura pseudoobscura GN=Moe PE=3 SV=3 Back     alignment and function desciption
 Score =  272 bits (695), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 153/172 (88%)

Query: 147 LTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHELYMR 206
           LTPKIGFPWSEIRNISF+++KFIIKPIDKKAPDF+FFAPRVR+NKRILALCMGNHELYMR
Sbjct: 253 LTPKIGFPWSEIRNISFSEKKFIIKPIDKKAPDFMFFAPRVRINKRILALCMGNHELYMR 312

Query: 207 RRKPDTIDVQQMKAQAREEKNAKQQQRDKLQLEIAAREKAEKKHQESVERLKQLEVEMAK 266
           RRKPDTIDVQQMKAQAREEKNAKQQ+R+KLQL +AARE+AEKK QE  +RLKQ++ EM +
Sbjct: 313 RRKPDTIDVQQMKAQAREEKNAKQQEREKLQLALAARERAEKKQQEYEDRLKQMQEEMER 372

Query: 267 RDQDLMEAQEMIRRLEEQLKQLQAAKEELEARQTELQLELQPIRNQSNLNKV 318
             +DL+EAQEMIRRLEEQLKQLQAAK+ELE RQ ELQ  LQ +    N+  V
Sbjct: 373 SQRDLLEAQEMIRRLEEQLKQLQAAKDELELRQKELQSMLQRLEEAKNMEAV 424




Involved in connections of major cytoskeletal structures to the plasma membrane.
Drosophila pseudoobscura pseudoobscura (taxid: 46245)
>sp|P46150|MOEH_DROME Moesin/ezrin/radixin homolog 1 OS=Drosophila melanogaster GN=Moe PE=1 SV=2 Back     alignment and function description
>sp|Q170J7|MOEH_AEDAE Moesin/ezrin/radixin homolog 1 OS=Aedes aegypti GN=Moe PE=3 SV=1 Back     alignment and function description
>sp|B0WYY2|MOEH_CULQU Moesin/ezrin/radixin homolog 1 OS=Culex quinquefasciatus GN=Moe PE=3 SV=1 Back     alignment and function description
>sp|Q7PS12|MOEH_ANOGA Moesin/ezrin/radixin homolog 1 OS=Anopheles gambiae GN=Moe PE=3 SV=5 Back     alignment and function description
>sp|P52962|MOES_LYTVA Moesin OS=Lytechinus variegatus PE=3 SV=1 Back     alignment and function description
>sp|P15311|EZRI_HUMAN Ezrin OS=Homo sapiens GN=EZR PE=1 SV=4 Back     alignment and function description
>sp|P26043|RADI_MOUSE Radixin OS=Mus musculus GN=Rdx PE=1 SV=3 Back     alignment and function description
>sp|Q8HZQ5|EZRI_RABIT Ezrin OS=Oryctolagus cuniculus GN=EZR PE=1 SV=3 Back     alignment and function description
>sp|Q9PU45|RADI_CHICK Radixin OS=Gallus gallus GN=RDX PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query318
325296743 586 ezrin/radixin/moesin [Aplysia californic 0.757 0.411 0.519 2e-76
328697842 572 PREDICTED: moesin/ezrin/radixin homolog 0.481 0.267 0.808 7e-73
296216127 605 PREDICTED: radixin isoform 1 [Callithrix 0.726 0.381 0.518 4e-72
14348876 587 ezrin/radixin/moesin [Biomphalaria glabr 0.713 0.386 0.510 3e-71
357613203 1068 Moesin [Danaus plexippus] 0.522 0.155 0.816 4e-71
289740905 575 radixin [Glossina morsitans morsitans] 0.477 0.264 0.798 8e-71
194769276 646 GF19124 [Drosophila ananassae] gi|190618 0.537 0.264 0.784 1e-70
195163205 647 GL13033 [Drosophila persimilis] gi|19846 0.537 0.264 0.784 2e-70
195042307 645 GH12073 [Drosophila grimshawi] gi|193901 0.537 0.265 0.784 2e-70
195400983 645 GJ15179 [Drosophila virilis] gi|19414174 0.537 0.265 0.784 2e-70
>gi|325296743|ref|NP_001191607.1| ezrin/radixin/moesin [Aplysia californica] gi|71733130|gb|AAZ40190.1| ezrin/radixin/moesin [Aplysia californica] Back     alignment and taxonomy information
 Score =  292 bits (747), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 159/306 (51%), Positives = 200/306 (65%), Gaps = 65/306 (21%)

Query: 5   PLRVMDQHKMSPSEWESSITTWWKEHKGMLREDAMMEYLKIAQDLEMYGVNYFEIKNKKG 64
           P RV DQHK+S  +WE  I +W+ EHKGMLREDAM+E+LKIAQDLEMYGVNYFEIKNKKG
Sbjct: 155 PQRVYDQHKLSKDQWEDRIKSWYGEHKGMLREDAMIEFLKIAQDLEMYGVNYFEIKNKKG 214

Query: 65  TELWLGVDALGLNIYEKEDNLTNVMSQDVKKENPLQFKFRAKFYPEDVVEEIIQDITLRL 124
           T+L LGVDALGLN+YEK+D LT                                      
Sbjct: 215 TDLLLGVDALGLNVYEKDDKLT-------------------------------------- 236

Query: 125 FYLQVSRSAGSRVRFPPGPNCLLTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFA 184
                      R+ FP              WSEIRNISFND+KFIIKPIDKKAPDFVF+A
Sbjct: 237 ----------PRIGFP--------------WSEIRNISFNDKKFIIKPIDKKAPDFVFYA 272

Query: 185 PRVRVNKRILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKNAKQQQRDKLQLEIAARE 244
           PR+R+NKRILALCMGNHELYMRRRKPDTI+VQQMKAQARE+K AKQQ+R +L      RE
Sbjct: 273 PRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQAREDKLAKQQERAQLARMRQERE 332

Query: 245 KAEKKHQESVERLKQLEVEMAKRDQDLMEAQEMIRRLEEQLKQLQAAKEELEA---RQTE 301
           ++++  ++  E+++ +E E  +R ++L E Q MIR  +E++ +L   +EEL++   R  E
Sbjct: 333 ESDRLRKDLEEKVRIMEEEQKQRMKELEELQGMIRDRDEKVAELTRLREELDSERKRAEE 392

Query: 302 LQLELQ 307
           LQ +++
Sbjct: 393 LQRDIE 398




Source: Aplysia californica

Species: Aplysia californica

Genus: Aplysia

Family: Aplysiidae

Order:

Class: Gastropoda

Phylum: Mollusca

Superkingdom: Eukaryota

>gi|328697842|ref|XP_001942978.2| PREDICTED: moesin/ezrin/radixin homolog 1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|296216127|ref|XP_002754417.1| PREDICTED: radixin isoform 1 [Callithrix jacchus] gi|390469603|ref|XP_003734146.1| PREDICTED: radixin isoform 2 [Callithrix jacchus] Back     alignment and taxonomy information
>gi|14348876|gb|AAK61353.1| ezrin/radixin/moesin [Biomphalaria glabrata] Back     alignment and taxonomy information
>gi|357613203|gb|EHJ68371.1| Moesin [Danaus plexippus] Back     alignment and taxonomy information
>gi|289740905|gb|ADD19200.1| radixin [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|194769276|ref|XP_001966732.1| GF19124 [Drosophila ananassae] gi|190618253|gb|EDV33777.1| GF19124 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195163205|ref|XP_002022442.1| GL13033 [Drosophila persimilis] gi|198469306|ref|XP_001354985.2| GA10507 [Drosophila pseudoobscura pseudoobscura] gi|194104434|gb|EDW26477.1| GL13033 [Drosophila persimilis] gi|198146808|gb|EAL32041.2| GA10507 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195042307|ref|XP_001991407.1| GH12073 [Drosophila grimshawi] gi|193901165|gb|EDW00032.1| GH12073 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195400983|ref|XP_002059095.1| GJ15179 [Drosophila virilis] gi|194141747|gb|EDW58164.1| GJ15179 [Drosophila virilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query318
UNIPROTKB|Q170J7 583 Moe "Moesin/ezrin/radixin homo 0.531 0.289 0.781 1e-107
UNIPROTKB|B0WYY2 572 Moe "Moesin/ezrin/radixin homo 0.531 0.295 0.769 4.5e-107
UNIPROTKB|Q29GR8 593 Moe "Moesin/ezrin/radixin homo 0.540 0.290 0.784 1.2e-106
FB|FBgn0011661 578 Moe "Moesin" [Drosophila melan 0.540 0.297 0.773 4e-106
UNIPROTKB|Q7PS12 581 Moe "Moesin/ezrin/radixin homo 0.531 0.290 0.757 1.3e-105
UNIPROTKB|P26038 577 MSN "Moesin" [Homo sapiens (ta 0.528 0.291 0.602 6.5e-83
UNIPROTKB|A7YIJ8 604 RDX "Radixin isoform b" [Homo 0.477 0.251 0.629 8.3e-83
UNIPROTKB|P35241 583 RDX "Radixin" [Homo sapiens (t 0.477 0.260 0.629 8.3e-83
UNIPROTKB|F1MJJ8 583 RDX "Radixin" [Bos taurus (tax 0.484 0.264 0.621 8.3e-83
UNIPROTKB|Q32LP2 583 RDX "Radixin" [Bos taurus (tax 0.484 0.264 0.621 8.3e-83
UNIPROTKB|Q170J7 Moe "Moesin/ezrin/radixin homolog 1" [Aedes aegypti (taxid:7159)] Back     alignment and assigned GO terms
 Score = 685 (246.2 bits), Expect = 1.0e-107, Sum P(2) = 1.0e-107
 Identities = 132/169 (78%), Positives = 151/169 (89%)

Query:   147 LTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHELYMR 206
             LTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVR+NKRILALCMGNHELYMR
Sbjct:   240 LTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRINKRILALCMGNHELYMR 299

Query:   207 RRKPDTIDVQQMKAQAREEKNAKQQQRDKLQLEIAAREKAEKKHQESVERLKQLEVEMAK 266
             RRKPDTIDVQQMKAQAREEKNAKQQ+R+KLQL +AARE+AEKK QE  +RL+ ++ EM +
Sbjct:   300 RRKPDTIDVQQMKAQAREEKNAKQQEREKLQLALAARERAEKKQQEYEDRLRTMQEEMER 359

Query:   267 RDQDLMEAQEMIRRLEEQLKQLQAAKEELEARQTELQLELQPIRNQSNL 315
                +L+EAQEMIRRLE+QLKQLQ AK+ELEARQ ELQ+ ++ +    N+
Sbjct:   360 SQANLIEAQEMIRRLEDQLKQLQFAKDELEARQNELQVMIKRLEESKNM 408


GO:0003779 "actin binding" evidence=ISS
GO:0005912 "adherens junction" evidence=ISS
GO:0045197 "establishment or maintenance of epithelial cell apical/basal polarity" evidence=ISS
UNIPROTKB|B0WYY2 Moe "Moesin/ezrin/radixin homolog 1" [Culex quinquefasciatus (taxid:7176)] Back     alignment and assigned GO terms
UNIPROTKB|Q29GR8 Moe "Moesin/ezrin/radixin homolog 1" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms
FB|FBgn0011661 Moe "Moesin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q7PS12 Moe "Moesin/ezrin/radixin homolog 1" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
UNIPROTKB|P26038 MSN "Moesin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A7YIJ8 RDX "Radixin isoform b" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P35241 RDX "Radixin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MJJ8 RDX "Radixin" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q32LP2 RDX "Radixin" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P26043RADI_MOUSENo assigned EC number0.63690.46220.2521yesN/A
Q8HZQ5EZRI_RABITNo assigned EC number0.58820.47790.2593yesN/A
Q9PU45RADI_CHICKNo assigned EC number0.63690.46220.2521yesN/A
Q32LP2RADI_BOVINNo assigned EC number0.61580.48420.2641yesN/A
Q7PS12MOEH_ANOGANo assigned EC number0.75730.47790.2616yesN/A
P15311EZRI_HUMANNo assigned EC number0.60750.47480.2576yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query318
cd1319497 cd13194, FERM_C_ERM, ERM family FERM domain C-lobe 9e-44
pfam0938090 pfam09380, FERM_C, FERM C-terminal PH-like domain 3e-21
cd1319497 cd13194, FERM_C_ERM, ERM family FERM domain C-lobe 1e-19
cd0083691 cd00836, FERM_C-lobe, FERM domain C-lobe 2e-12
pfam00373113 pfam00373, FERM_M, FERM central domain 1e-11
smart00295201 smart00295, B41, Band 4 1e-11
pfam00769 244 pfam00769, ERM, Ezrin/radixin/moesin family 7e-09
cd13189123 cd13189, FERM_C_PTPN4_PTPN3_like, Protein tyrosine 7e-08
cd13187124 cd13187, FERM_C_PTPH13, Protein tyrosine phosphata 1e-06
cd13199176 cd13199, FERM_C2_MyoVII, Myosin VII (MyoVII, Myo7) 2e-06
cd13184113 cd13184, FERM_C_4_1_family, Protein 4 7e-06
TIGR04211198 TIGR04211, SH3_and_anchor, SH3 domain protein 1e-05
pfam0938090 pfam09380, FERM_C, FERM C-terminal PH-like domain 2e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-05
cd13191115 cd13191, FERM_C_FRMD4A_FRMD4B, FERM domain-contain 2e-05
COG1842225 COG1842, PspA, Phage shock protein A (IM30), suppr 2e-05
cd13185109 cd13185, FERM_C_FRMD1_FRMD6, FERM domain containin 2e-05
TIGR04211198 TIGR04211, SH3_and_anchor, SH3 domain protein 3e-05
cd13195131 cd13195, FERM_C_MYLIP_IDOL, The E3 ubiquitin ligas 3e-05
cd13202111 cd13202, FERM_C_MyoX, Myosin X (MyoX, Myo10) FERM 3e-05
smart00295201 smart00295, B41, Band 4 4e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 5e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 5e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 9e-05
COG3064 387 COG3064, TolA, Membrane protein involved in colici 9e-05
cd13187124 cd13187, FERM_C_PTPH13, Protein tyrosine phosphata 1e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-04
PRK04863 1486 PRK04863, mukB, cell division protein MukB; Provis 2e-04
cd13192105 cd13192, FERM_C_FRMD3_FRMD5, FERM domain-containin 2e-04
TIGR03346 852 TIGR03346, chaperone_ClpB, ATP-dependent chaperone 2e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 3e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 4e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 4e-04
COG1579239 COG1579, COG1579, Zn-ribbon protein, possibly nucl 4e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 4e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 7e-04
COG4372 499 COG4372, COG4372, Uncharacterized protein conserve 7e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 8e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.001
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.001
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.001
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.001
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.001
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.001
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.001
COG4372 499 COG4372, COG4372, Uncharacterized protein conserve 0.001
TIGR01843 423 TIGR01843, type_I_hlyD, type I secretion membrane 0.001
PRK00409 782 PRK00409, PRK00409, recombination and DNA strand e 0.001
PRK12705 508 PRK12705, PRK12705, hypothetical protein; Provisio 0.001
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 0.001
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.002
PRK04863 1486 PRK04863, mukB, cell division protein MukB; Provis 0.002
pfam03961450 pfam03961, DUF342, Protein of unknown function (DU 0.002
pfam12795239 pfam12795, MscS_porin, Mechanosensitive ion channe 0.002
COG3096 1480 COG3096, MukB, Uncharacterized protein involved in 0.002
cd13188111 cd13188, FERM_C_PTPN14_PTPN21, Protein tyrosine ph 0.002
PRK11637 428 PRK11637, PRK11637, AmiB activator; Provisional 0.002
TIGR03346 852 TIGR03346, chaperone_ClpB, ATP-dependent chaperone 0.003
PRK11281 1113 PRK11281, PRK11281, hypothetical protein; Provisio 0.003
pfam08703181 pfam08703, PLC-beta_C, PLC-beta C terminal 0.003
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.004
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.004
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.004
TIGR02794 346 TIGR02794, tolA_full, TolA protein 0.004
pfam04012220 pfam04012, PspA_IM30, PspA/IM30 family 0.004
pfam00012598 pfam00012, HSP70, Hsp70 protein 0.004
>gnl|CDD|241348 cd13194, FERM_C_ERM, ERM family FERM domain C-lobe/F3 Back     alignment and domain information
 Score =  145 bits (367), Expect = 9e-44
 Identities = 56/67 (83%), Positives = 62/67 (92%)

Query: 143 PNCLLTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHE 202
               LTPKIGFPWSEIRNISFND+KF+IKPIDKKAPDFVF++PR+R+NKRIL LCMGNHE
Sbjct: 31  LENKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYSPRLRINKRILDLCMGNHE 90

Query: 203 LYMRRRK 209
           LYMRRRK
Sbjct: 91  LYMRRRK 97


The ERM family includes ezrin, radixin, moesin and merlin. They are composed of a N-terminal FERM (ERM) domain (also called N-ERMAD (N-terminal ERM association domain)), a coiled coil region (CRR), and a C-terminal domain CERMAD (C-terminal ERM association domain) which has an F-actin-binding site (ABD). Two actin-binding sites have been identified in the middle and N-terminal domains. Merlin is structurally similar to the ERM proteins, but instead of an actin-binding domain (ABD), it contains a C-terminal domain (CTD), just like the proteins from the 4.1 family. Activated ezrin, radixin and moesin are thought to be involved in the linking of actin filaments to CD43, CD44, ICAM1-3 cell adhesion molecules, various membrane channels and receptors, such as the Na+/H+ exchanger-3 (NHE3), cystic fibrosis transmembrane conductance regulator (CFTR), and the beta2-adrenergic receptor. The ERM proteins exist in two states, a dormant state in which the FERM domain binds to its own C-terminal tail and thereby precludes binding of some partner proteins, and an activated state, in which the FERM domain binds to one of many membrane binding proteins and the C-terminal tail binds to F-actin. The FERM domain has a cloverleaf tripart structure (FERM_N, FERM_M, FERM_C/N, alpha-, and C-lobe/A-lobe, B-lobe, C-lobe/F1, F2, F3). The C-lobe/F3 within the FERM domain of ERM is part of the PH domain family. The FERM domain is found in the cytoskeletal-associated proteins such as ezrin, moesin, radixin, 4.1R, and merlin. These proteins provide a link between the membrane and cytoskeleton and are involved in signal transduction pathways. The FERM domain is also found in protein tyrosine phosphatases (PTPs) , the tyrosine kinases FAK and JAK, in addition to other proteins involved in signaling. This domain is structurally similar to the PH and PTB domains and consequently is capable of binding to both peptides and phospholipids at different sites. Length = 97

>gnl|CDD|220216 pfam09380, FERM_C, FERM C-terminal PH-like domain Back     alignment and domain information
>gnl|CDD|241348 cd13194, FERM_C_ERM, ERM family FERM domain C-lobe/F3 Back     alignment and domain information
>gnl|CDD|241233 cd00836, FERM_C-lobe, FERM domain C-lobe Back     alignment and domain information
>gnl|CDD|215882 pfam00373, FERM_M, FERM central domain Back     alignment and domain information
>gnl|CDD|214604 smart00295, B41, Band 4 Back     alignment and domain information
>gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family Back     alignment and domain information
>gnl|CDD|241343 cd13189, FERM_C_PTPN4_PTPN3_like, Protein tyrosine phosphatase non-receptor proteins 3 and 4 (PTPN4 and PTPN3) FERM domain C-lobe Back     alignment and domain information
>gnl|CDD|241341 cd13187, FERM_C_PTPH13, Protein tyrosine phosphatase non-receptor 13 (PTPH13) FERM domain C-lobe Back     alignment and domain information
>gnl|CDD|241353 cd13199, FERM_C2_MyoVII, Myosin VII (MyoVII, Myo7) FERM domain C-lobe, repeat 2 Back     alignment and domain information
>gnl|CDD|241338 cd13184, FERM_C_4_1_family, Protein 4 Back     alignment and domain information
>gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein Back     alignment and domain information
>gnl|CDD|220216 pfam09380, FERM_C, FERM C-terminal PH-like domain Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|241345 cd13191, FERM_C_FRMD4A_FRMD4B, FERM domain-containing protein 4A and 4B (FRMD4A and 4B) FERM domain C-lobe Back     alignment and domain information
>gnl|CDD|224755 COG1842, PspA, Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|241339 cd13185, FERM_C_FRMD1_FRMD6, FERM domain containing 1 and 6 proteins FERM domain C-lobe Back     alignment and domain information
>gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein Back     alignment and domain information
>gnl|CDD|241349 cd13195, FERM_C_MYLIP_IDOL, The E3 ubiquitin ligase myosin regulatory light chain-interacting protein (MYLIP; also called inducible degrader of the LDL receptor, IDOL) FERM domain C-lobe Back     alignment and domain information
>gnl|CDD|241356 cd13202, FERM_C_MyoX, Myosin X (MyoX, Myo10) FERM domain C-lobe Back     alignment and domain information
>gnl|CDD|214604 smart00295, B41, Band 4 Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|241341 cd13187, FERM_C_PTPH13, Protein tyrosine phosphatase non-receptor 13 (PTPH13) FERM domain C-lobe Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional Back     alignment and domain information
>gnl|CDD|241346 cd13192, FERM_C_FRMD3_FRMD5, FERM domain-containing protein 3 and 5 FERM (FRMD3 and 5) domain C-lobe Back     alignment and domain information
>gnl|CDD|234173 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>gnl|CDD|130902 TIGR01843, type_I_hlyD, type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|237178 PRK12705, PRK12705, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional Back     alignment and domain information
>gnl|CDD|217817 pfam03961, DUF342, Protein of unknown function (DUF342) Back     alignment and domain information
>gnl|CDD|221776 pfam12795, MscS_porin, Mechanosensitive ion channel porin domain Back     alignment and domain information
>gnl|CDD|225638 COG3096, MukB, Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|241342 cd13188, FERM_C_PTPN14_PTPN21, Protein tyrosine phosphatase non-receptor proteins 14 and 21 (PTPN14 and 21) FERM domain Back     alignment and domain information
>gnl|CDD|236942 PRK11637, PRK11637, AmiB activator; Provisional Back     alignment and domain information
>gnl|CDD|234173 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB Back     alignment and domain information
>gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|204032 pfam08703, PLC-beta_C, PLC-beta C terminal Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|217843 pfam04012, PspA_IM30, PspA/IM30 family Back     alignment and domain information
>gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 318
KOG3529|consensus 596 100.0
KOG3530|consensus 616 99.98
KOG3527|consensus 975 99.92
KOG0792|consensus 1144 99.9
cd0083692 FERM_C FERM_C domain. The FERM_C domain is the thi 99.9
PF0938090 FERM_C: FERM C-terminal PH-like domain; InterPro: 99.85
KOG3531|consensus 1036 99.72
KOG3529|consensus 596 99.53
KOG3530|consensus 616 99.04
KOG3527|consensus 975 98.73
PF00769 246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 98.68
smart00295207 B41 Band 4.1 homologues. Also known as ezrin/radix 98.49
KOG4371|consensus 1332 98.48
PF0937980 FERM_N: FERM N-terminal domain ; InterPro: IPR0189 98.38
PF00373126 FERM_M: FERM central domain; InterPro: IPR019748 T 98.26
KOG3531|consensus 1036 98.11
KOG0792|consensus 1144 98.07
PF00373126 FERM_M: FERM central domain; InterPro: IPR019748 T 96.52
KOG0248|consensus936 95.16
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 95.1
KOG4261|consensus 1003 94.92
KOG3727|consensus664 94.29
PF09726 697 Macoilin: Transmembrane protein; InterPro: IPR0191 91.47
PF00261 237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 90.67
PF00769 246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 89.78
KOG1029|consensus 1118 89.53
PRK11637 428 AmiB activator; Provisional 88.48
TIGR03319 514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 88.31
PRK11637 428 AmiB activator; Provisional 88.22
PTZ00266 1021 NIMA-related protein kinase; Provisional 87.94
PRK12704 520 phosphodiesterase; Provisional 87.51
PTZ00266 1021 NIMA-related protein kinase; Provisional 87.48
PRK12704 520 phosphodiesterase; Provisional 86.88
PRK10884206 SH3 domain-containing protein; Provisional 85.75
KOG1029|consensus 1118 84.96
PRK09510 387 tolA cell envelope integrity inner membrane protei 84.72
PRK00106 535 hypothetical protein; Provisional 83.38
KOG0742|consensus 630 83.36
COG4372 499 Uncharacterized protein conserved in bacteria with 82.75
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 82.4
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 82.05
PF0882661 DMPK_coil: DMPK coiled coil domain like; InterPro: 80.04
>KOG3529|consensus Back     alignment and domain information
Probab=100.00  E-value=3.2e-47  Score=389.57  Aligned_cols=254  Identities=63%  Similarity=0.993  Sum_probs=243.7

Q ss_pred             CCCCchhhHhhcCCChHHHHHHHHHHHHHccCCCHHHHHHHHHHHHhccCcccceeEEeecCCCCeEEEeecCCceeeee
Q psy3983           1 MSVSPLRVMDQHKMSPSEWESSITTWWKEHKGMLREDAMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYE   80 (318)
Q Consensus         1 ~~~~p~~~~~q~~~~~~~~e~~I~~~hk~~kG~~~~eAe~efLkvaq~Le~yGv~YFgL~d~kg~~~WLgl~k~Gi~Iy~   80 (318)
                      ++++|.+|+++|+||..+|+.+|..||..|+|+++++|+++||+++++|++||++||.++|++|++.|||++..|++||.
T Consensus       159 ~~~lP~~~~~q~~~s~~~~e~ri~~~~~~~~~~~re~a~leylki~qdle~ygvny~~i~~k~gt~~~lgv~~~gl~~y~  238 (596)
T KOG3529|consen  159 DRLLPQRVLDQHKMTPDMWEDRIKEWYAEHRGMTREEAMLEYLKIAQDLEMYGVNYFEIKNKKGTDLWLGVDALGLNIYD  238 (596)
T ss_pred             CcccchhhhhhccccHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHhccccccccceeecCCCCCCccccccccCCccccc
Confidence            46899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCccccccccccccCCCeeEEEEEeecCCCchHHHHHhHHHHHHHHHhhhhhhcCCCCCCCcccccccccCccCccccc
Q psy3983          81 KEDNLTNVMSQDVKKENPLQFKFRAKFYPEDVVEEIIQDITLRLFYLQVSRSAGSRVRFPPGPNCLLTPKIGFPWSEIRN  160 (318)
Q Consensus        81 ~~dk~~~v~~q~i~~~~p~~~~f~vkfyp~d~~~eL~qe~TRylf~LQlK~di~~rl~C~~~~a~lL~p~~~f~W~~I~~  160 (318)
                      ..|+                                                              +.|+.+|+|++|+|
T Consensus       239 ~~~k--------------------------------------------------------------~~P~~~f~w~eirn  256 (596)
T KOG3529|consen  239 ESDK--------------------------------------------------------------LTPKIGFPWSEIRN  256 (596)
T ss_pred             cccC--------------------------------------------------------------CCCCCCCCccccCC
Confidence            9988                                                              88999999999999


Q ss_pred             cccccceEEEEeCCCCCCceEEEcCCccchHHHHHHhhhcccccccccCCCcHHHHHHHHHHHHHHHHHHHhhHhHHHHH
Q psy3983         161 ISFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKNAKQQQRDKLQLEI  240 (318)
Q Consensus       161 lsf~~kkF~Ikp~dkk~~~~~F~~~~~~~~K~iw~lcv~~H~Ff~~rr~~d~~~vqqmkaqa~eek~~~~~er~~l~~e~  240 (318)
                      |||++++|.|+|+|+++++|+|+.++.+.++.|+++|.+||++||+||+|||++||||++||+++|++++++|.++..++
T Consensus       257 isf~~kkf~~k~id~~~~~f~~~~~~~~~~~~~l~~~~~~~~l~~rr~~~~ti~vqq~~~~a~~~k~~~~~e~~~~~~~~  336 (596)
T KOG3529|consen  257 ISFNDKKFHIKPIDKKASDFSFYAPRLRINKRILDLCMGNHELYMRRRKPDTIEVQQMKAQAREEKARKQLERAKLEREK  336 (596)
T ss_pred             CCCCcccccCCCCCcccCcccccccccccchhhhhhhhccchhhhhcccccccchhhccccccchHHHHHHhhhhhhHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhchhhhc
Q psy3983         241 AAREKAEKKHQ-------ESVERLKQLEVEMAKRDQDLMEAQEMIRRLEEQLKQLQAAKEELEARQTELQLELQPIRNQS  313 (318)
Q Consensus       241 ~~~~~~~~~~~-------~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  313 (318)
                      ..|+.++++..       ++..++.+.++.+.+..+++.++.+++..++++.+.++.++..|++....+++..+.+..+.
T Consensus       337 ~~re~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~E~~~~~l~~~a~~le~e~~rL~e~~~~le~e~  416 (596)
T KOG3529|consen  337 KKRETGEKEGSELERLKEELQGRMAQAQEDVERARRELAEASRKARDLEEERKLLKKEASELEAERPRLEELKQKLEEEK  416 (596)
T ss_pred             hhhhhcccccCcccccchhhhhhhhhhhHHHHHhhhcchhhcccccCccchhhhhhhhHhhhhhhhhHHHHHHHHHHHHh
Confidence            99999998854       78889999999999999999999999999999999999999999999999998888877665


Q ss_pred             ccc
Q psy3983         314 NLN  316 (318)
Q Consensus       314 ~~~  316 (318)
                      .+.
T Consensus       417 ~d~  419 (596)
T KOG3529|consen  417 HDS  419 (596)
T ss_pred             hcc
Confidence            543



>KOG3530|consensus Back     alignment and domain information
>KOG3527|consensus Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>cd00836 FERM_C FERM_C domain Back     alignment and domain information
>PF09380 FERM_C: FERM C-terminal PH-like domain; InterPro: IPR018980 The FERM domain (F for 4 Back     alignment and domain information
>KOG3531|consensus Back     alignment and domain information
>KOG3529|consensus Back     alignment and domain information
>KOG3530|consensus Back     alignment and domain information
>KOG3527|consensus Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>smart00295 B41 Band 4 Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain Back     alignment and domain information
>PF00373 FERM_M: FERM central domain; InterPro: IPR019748 The FERM domain (F for 4 Back     alignment and domain information
>KOG3531|consensus Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>PF00373 FERM_M: FERM central domain; InterPro: IPR019748 The FERM domain (F for 4 Back     alignment and domain information
>KOG0248|consensus Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG4261|consensus Back     alignment and domain information
>KOG3727|consensus Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query318
2i1j_A 575 Moesin From Spodoptera Frugiperda At 2.1 Angstroms 3e-72
1e5w_A346 Structure Of Isolated Ferm Domain And First Long He 1e-43
2emt_A322 Crystal Structure Analysis Of The Radixin Ferm Doma 2e-40
1j19_A317 Crystal Structure Of The Radxin Ferm Domain Complex 3e-40
2d10_A312 Crystal Structure Of The Radixin Ferm Domain Comple 3e-40
2d2q_A310 Crystal Structure Of The Dimerized Radixin Ferm Dom 3e-40
2zpy_A312 Crystal Structure Of The Mouse Radxin Ferm Domain C 4e-40
1gc6_A297 Crystal Structure Of The Radixin Ferm Domain Comple 1e-33
1gc6_A297 Crystal Structure Of The Radixin Ferm Domain Comple 4e-33
1ni2_A296 Structure Of The Active Ferm Domain Of Ezrin Length 3e-33
1ni2_A296 Structure Of The Active Ferm Domain Of Ezrin Length 3e-32
1sgh_A297 Moesin Ferm Domain Bound To Ebp50 C-Terminal Peptid 3e-33
1ef1_A294 Crystal Structure Of The Moesin Ferm DomainTAIL DOM 1e-31
1isn_A323 Crystal Structure Of Merlin Ferm Domain Length = 32 9e-30
1h4r_A314 Crystal Structure Of The Ferm Domain Of Merlin, The 2e-27
1h4r_A314 Crystal Structure Of The Ferm Domain Of Merlin, The 4e-20
1h4r_B314 Crystal Structure Of The Ferm Domain Of Merlin, The 2e-27
1h4r_B314 Crystal Structure Of The Ferm Domain Of Merlin, The 4e-20
3u8z_A300 Human Merlin Ferm Domain Length = 300 3e-27
3u8z_A300 Human Merlin Ferm Domain Length = 300 6e-20
3bin_A283 Structure Of The Dal-1 And Tslc1 (372-383) Complex 1e-06
2he7_A283 Ferm Domain Of Epb41l3 (Dal-1) Length = 283 1e-06
3au4_A555 Structure Of The Human Myosin-X Myth4-Ferm Cassette 5e-06
3pzd_A511 Structure Of The Myosin X Myth4-FermDCC COMPLEX Len 6e-06
>pdb|2I1J|A Chain A, Moesin From Spodoptera Frugiperda At 2.1 Angstroms Resolution Length = 575 Back     alignment and structure

Iteration: 1

Score = 268 bits (685), Expect = 3e-72, Method: Compositional matrix adjust. Identities = 135/169 (79%), Positives = 149/169 (88%) Query: 147 LTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHELYMR 206 LTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHELYMR Sbjct: 234 LTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHELYMR 293 Query: 207 RRKPDTIDVQQMKAQAREEKNAKQQQRDKLQLEIAAREKAEKKHQESVERLKQLEVEMAK 266 RRKPDTIDVQQMKAQAREEK AKQ QR+KLQLEIAARE+AEKK QE +RL+Q++ EM + Sbjct: 294 RRKPDTIDVQQMKAQAREEKLAKQAQREKLQLEIAARERAEKKQQEYQDRLRQMQEEMER 353 Query: 267 RDQDLMEAQEMIRRLEEQLKQLQAAKEELEARQTELQLELQPIRNQSNL 315 +L+EAQ+MI RLEEQL+QLQAAKEELE RQ ELQ +Q + N+ Sbjct: 354 SQANLLEAQDMILRLEEQLRQLQAAKEELEQRQNELQAMMQRLEETKNM 402
>pdb|1E5W|A Chain A, Structure Of Isolated Ferm Domain And First Long Helix Of Moesin Length = 346 Back     alignment and structure
>pdb|2EMT|A Chain A, Crystal Structure Analysis Of The Radixin Ferm Domain Complexed With Adhesion Molecule Psgl-1 Length = 322 Back     alignment and structure
>pdb|1J19|A Chain A, Crystal Structure Of The Radxin Ferm Domain Complexed With The Icam-2 Cytoplasmic Peptide Length = 317 Back     alignment and structure
>pdb|2D10|A Chain A, Crystal Structure Of The Radixin Ferm Domain Complexed With The Nherf-1 C-Terminal Tail Peptide Length = 312 Back     alignment and structure
>pdb|2D2Q|A Chain A, Crystal Structure Of The Dimerized Radixin Ferm Domain Length = 310 Back     alignment and structure
>pdb|2ZPY|A Chain A, Crystal Structure Of The Mouse Radxin Ferm Domain Complexed With The Mouse Cd44 Cytoplasmic Peptide Length = 312 Back     alignment and structure
>pdb|1GC6|A Chain A, Crystal Structure Of The Radixin Ferm Domain Complexed With Inositol-(1,4,5)-Triphosphate Length = 297 Back     alignment and structure
>pdb|1GC6|A Chain A, Crystal Structure Of The Radixin Ferm Domain Complexed With Inositol-(1,4,5)-Triphosphate Length = 297 Back     alignment and structure
>pdb|1NI2|A Chain A, Structure Of The Active Ferm Domain Of Ezrin Length = 296 Back     alignment and structure
>pdb|1NI2|A Chain A, Structure Of The Active Ferm Domain Of Ezrin Length = 296 Back     alignment and structure
>pdb|1SGH|A Chain A, Moesin Ferm Domain Bound To Ebp50 C-Terminal Peptide Length = 297 Back     alignment and structure
>pdb|1EF1|A Chain A, Crystal Structure Of The Moesin Ferm DomainTAIL DOMAIN COMPLEX Length = 294 Back     alignment and structure
>pdb|1ISN|A Chain A, Crystal Structure Of Merlin Ferm Domain Length = 323 Back     alignment and structure
>pdb|1H4R|A Chain A, Crystal Structure Of The Ferm Domain Of Merlin, The Neurofibromatosis 2 Tumor Suppressor Protein Length = 314 Back     alignment and structure
>pdb|1H4R|A Chain A, Crystal Structure Of The Ferm Domain Of Merlin, The Neurofibromatosis 2 Tumor Suppressor Protein Length = 314 Back     alignment and structure
>pdb|1H4R|B Chain B, Crystal Structure Of The Ferm Domain Of Merlin, The Neurofibromatosis 2 Tumor Suppressor Protein Length = 314 Back     alignment and structure
>pdb|1H4R|B Chain B, Crystal Structure Of The Ferm Domain Of Merlin, The Neurofibromatosis 2 Tumor Suppressor Protein Length = 314 Back     alignment and structure
>pdb|3U8Z|A Chain A, Human Merlin Ferm Domain Length = 300 Back     alignment and structure
>pdb|3U8Z|A Chain A, Human Merlin Ferm Domain Length = 300 Back     alignment and structure
>pdb|3BIN|A Chain A, Structure Of The Dal-1 And Tslc1 (372-383) Complex Length = 283 Back     alignment and structure
>pdb|2HE7|A Chain A, Ferm Domain Of Epb41l3 (Dal-1) Length = 283 Back     alignment and structure
>pdb|3AU4|A Chain A, Structure Of The Human Myosin-X Myth4-Ferm Cassette Bound To Its Specific Cargo, Dcc Length = 555 Back     alignment and structure
>pdb|3PZD|A Chain A, Structure Of The Myosin X Myth4-FermDCC COMPLEX Length = 511 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query318
2i1j_A 575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 1e-29
2i1j_A 575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 5e-25
2i1j_A 575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 2e-06
1h4r_A314 Merlin; FERM, neurofibromatosis, NF2, structural p 3e-22
1h4r_A314 Merlin; FERM, neurofibromatosis, NF2, structural p 4e-19
1h4r_A314 Merlin; FERM, neurofibromatosis, NF2, structural p 5e-08
1ef1_A294 Moesin; membrane, FERM domain, tail domain, membra 3e-21
1ef1_A294 Moesin; membrane, FERM domain, tail domain, membra 7e-20
1ef1_A294 Moesin; membrane, FERM domain, tail domain, membra 2e-09
1mix_A206 Talin; focal adhesion, integrin binding, FERM doma 1e-19
3qij_A296 Protein 4.1; cytoskeleton, structural genomics, st 5e-19
3qij_A296 Protein 4.1; cytoskeleton, structural genomics, st 3e-11
3qij_A296 Protein 4.1; cytoskeleton, structural genomics, st 4e-04
4f7g_A222 Talin-1; alpha-helix bundle, integrin activation, 6e-18
4f7g_A222 Talin-1; alpha-helix bundle, integrin activation, 5e-13
3ivf_A371 Talin-1; FERM domain, cell membrane, cell projecti 8e-18
3ivf_A371 Talin-1; FERM domain, cell membrane, cell projecti 3e-05
4dxa_B322 KREV interaction trapped protein 1; GTPase, FERM, 5e-16
4dxa_B322 KREV interaction trapped protein 1; GTPase, FERM, 5e-06
3au4_A555 Myosin-X; protein-protein complex, motor protein c 5e-15
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 5e-10
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-06
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 6e-04
3pvl_A655 Myosin VIIA isoform 1; protein complex, novel fold 2e-09
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 2e-07
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 2e-07
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 1e-06
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 3e-06
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 4e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 7e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 4e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-05
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 6e-05
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 3e-04
2al6_A375 Focal adhesion kinase 1; transferase; 2.35A {Gallu 1e-06
4eku_A392 Protein-tyrosine kinase 2-beta; proline-rich tyros 9e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 3e-05
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 6e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 9e-05
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Length = 575 Back     alignment and structure
 Score =  117 bits (294), Expect = 1e-29
 Identities = 134/170 (78%), Positives = 148/170 (87%)

Query: 144 NCLLTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHEL 203
           +  LTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHEL
Sbjct: 231 DDKLTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHEL 290

Query: 204 YMRRRKPDTIDVQQMKAQAREEKNAKQQQRDKLQLEIAAREKAEKKHQESVERLKQLEVE 263
           YMRRRKPDTIDVQQMKAQAREEK AKQ QR+KLQLEIAARE+AEKK QE  +RL+Q++ E
Sbjct: 291 YMRRRKPDTIDVQQMKAQAREEKLAKQAQREKLQLEIAARERAEKKQQEYQDRLRQMQEE 350

Query: 264 MAKRDQDLMEAQEMIRRLEEQLKQLQAAKEELEARQTELQLELQPIRNQS 313
           M +   +L+EAQ+MI RLEEQL+QLQAAKEELE RQ ELQ  +Q +    
Sbjct: 351 MERSQANLLEAQDMILRLEEQLRQLQAAKEELEQRQNELQAMMQRLEETK 400


>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Length = 575 Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Length = 575 Back     alignment and structure
>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Length = 314 Back     alignment and structure
>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Length = 314 Back     alignment and structure
>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Length = 314 Back     alignment and structure
>1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Length = 294 Back     alignment and structure
>1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Length = 294 Back     alignment and structure
>1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Length = 294 Back     alignment and structure
>1mix_A Talin; focal adhesion, integrin binding, FERM domain, cytoskeleton, structural protein; 1.75A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 PDB: 1miz_B 1mk7_B 1mk9_B 1y19_B 3g9w_A 2hrj_A 2g35_A* 2k00_A 2h7d_A* 2h7e_A* 2kgx_B Length = 206 Back     alignment and structure
>3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Length = 296 Back     alignment and structure
>3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Length = 296 Back     alignment and structure
>3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Length = 296 Back     alignment and structure
>4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus} Length = 222 Back     alignment and structure
>4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus} Length = 222 Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Length = 371 Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Length = 371 Back     alignment and structure
>4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} Length = 322 Back     alignment and structure
>4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} Length = 322 Back     alignment and structure
>3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A Length = 555 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Length = 655 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2al6_A Focal adhesion kinase 1; transferase; 2.35A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 2j0m_A* 2aeh_A Length = 375 Back     alignment and structure
>4eku_A Protein-tyrosine kinase 2-beta; proline-rich tyrosine kinase 2, FERM domain, transferase; 3.25A {Homo sapiens} Length = 392 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Length = 854 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Length = 854 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query318
2i1j_A 575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 100.0
1ef1_A294 Moesin; membrane, FERM domain, tail domain, membra 99.97
1h4r_A314 Merlin; FERM, neurofibromatosis, NF2, structural p 99.97
3qij_A296 Protein 4.1; cytoskeleton, structural genomics, st 99.95
1mix_A206 Talin; focal adhesion, integrin binding, FERM doma 99.82
4f7g_A222 Talin-1; alpha-helix bundle, integrin activation, 99.79
2al6_A375 Focal adhesion kinase 1; transferase; 2.35A {Gallu 99.64
3pvl_A655 Myosin VIIA isoform 1; protein complex, novel fold 99.63
2i1j_A 575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 99.62
3ivf_A371 Talin-1; FERM domain, cell membrane, cell projecti 99.6
4dxa_B322 KREV interaction trapped protein 1; GTPase, FERM, 99.59
3au4_A555 Myosin-X; protein-protein complex, motor protein c 99.54
1ef1_A294 Moesin; membrane, FERM domain, tail domain, membra 99.52
1h4r_A314 Merlin; FERM, neurofibromatosis, NF2, structural p 99.47
3qij_A296 Protein 4.1; cytoskeleton, structural genomics, st 99.46
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 99.16
3ivf_A371 Talin-1; FERM domain, cell membrane, cell projecti 99.14
4eku_A392 Protein-tyrosine kinase 2-beta; proline-rich tyros 99.07
2al6_A375 Focal adhesion kinase 1; transferase; 2.35A {Gallu 98.99
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 98.58
4dxa_B322 KREV interaction trapped protein 1; GTPase, FERM, 98.51
3au4_A555 Myosin-X; protein-protein complex, motor protein c 98.45
3pvl_A655 Myosin VIIA isoform 1; protein complex, novel fold 98.45
4eku_A392 Protein-tyrosine kinase 2-beta; proline-rich tyros 98.35
1mix_A206 Talin; focal adhesion, integrin binding, FERM doma 98.23
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 95.96
4f7g_A222 Talin-1; alpha-helix bundle, integrin activation, 95.92
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 94.75
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 92.01
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 90.25
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 89.44
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 88.07
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 86.0
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 85.89
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 81.97
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 80.58
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 80.55
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
Probab=100.00  E-value=1.3e-55  Score=448.43  Aligned_cols=253  Identities=80%  Similarity=1.214  Sum_probs=207.3

Q ss_pred             CCCchhhHhhcCCChHHHHHHHHHHHHHccCCCHHHHHHHHHHHHhccCcccceeEEeecCCCCeEEEeecCCceeeeec
Q psy3983           2 SVSPLRVMDQHKMSPSEWESSITTWWKEHKGMLREDAMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEK   81 (318)
Q Consensus         2 ~~~p~~~~~q~~~~~~~~e~~I~~~hk~~kG~~~~eAe~efLkvaq~Le~yGv~YFgL~d~kg~~~WLgl~k~Gi~Iy~~   81 (318)
                      .|+|.+|+++++++++.|+..|..+|++++|+++.+|++.||++|++|++||++||.++|++|+++||||++.||.||..
T Consensus       151 ~~lP~~vl~~~~~s~e~~~~~I~~~hk~l~G~s~~eA~~~yL~~a~~lp~YG~~~F~vkd~~g~~l~LGV~~~GI~v~~~  230 (575)
T 2i1j_A          151 RLLPQRVTDQHKMSREEWEQSITNWWQEHRGMLREDAMMEYLKIAQDLEMYGVNYFEIRNKKNTELWLGVDALGLNIYEK  230 (575)
T ss_dssp             CCSCHHHHHTBCCCHHHHHHHHHHHHGGGTTCCHHHHHHHHHHHHTTSTTTTCEEEEEECTTCCEEEEEECSSEEEEEET
T ss_pred             ccCCHHHHhhcCCCHHHHHHHHHHHHHHccCCCHHHHHHHHHHHHHhccccCCEEEEEEecCCCEEEEEEcCCeeEEEeC
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             CCccccccccccccCCCeeEEEEEeecCCCchHHHHHhHHHHHHHHHhhhhhhcCCCCCCCcccccccccCccCcccccc
Q psy3983          82 EDNLTNVMSQDVKKENPLQFKFRAKFYPEDVVEEIIQDITLRLFYLQVSRSAGSRVRFPPGPNCLLTPKIGFPWSEIRNI  161 (318)
Q Consensus        82 ~dk~~~v~~q~i~~~~p~~~~f~vkfyp~d~~~eL~qe~TRylf~LQlK~di~~rl~C~~~~a~lL~p~~~f~W~~I~~l  161 (318)
                      +++                                                              +.|...|+|++|.++
T Consensus       231 ~~k--------------------------------------------------------------~~~l~~f~w~~I~~i  248 (575)
T 2i1j_A          231 DDK--------------------------------------------------------------LTPKIGFPWSEIRNI  248 (575)
T ss_dssp             TCS--------------------------------------------------------------SSCSEEEEGGGEEEE
T ss_pred             CCC--------------------------------------------------------------cccceEecHHHhhcc
Confidence            776                                                              445678999999999


Q ss_pred             ccccceEEEEeCCCCCCceEEEcCCccchHHHHHHhhhcccccccccCCCcHHHHHHHHHHHHHHHHHHHhhHhHHHHHH
Q psy3983         162 SFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKNAKQQQRDKLQLEIA  241 (318)
Q Consensus       162 sf~~kkF~Ikp~dkk~~~~~F~~~~~~~~K~iw~lcv~~H~Ff~~rr~~d~~~vqqmkaqa~eek~~~~~er~~l~~e~~  241 (318)
                      +|++++|+|++.+++.++|+|++++++.||+||++|+++|.||+++|+||+++||||||||||||++|++||++|.+|++
T Consensus       249 sf~~k~F~I~~~~~~~~~l~F~t~~~~~ak~i~~lc~~~H~ff~~~r~~d~~e~qqm~~~a~e~~~~~~~e~~~l~~~~~  328 (575)
T 2i1j_A          249 SFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKLAKQAQREKLQLEIA  328 (575)
T ss_dssp             EEETTEEEEEESCTTSCCEEEECSCHHHHHHHHHHHHHHHHHHHHHTSCCCHHHHHHHHHHHHHHHHHHHHHTTCCSCCC
T ss_pred             cCCCCeEEEEEccCCcceeEEEeCCchhHHHHHHHHHHHHHHHHHccCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999987778899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhchhhhcccc
Q psy3983         242 AREKAEKKHQESVERLKQLEVEMAKRDQDLMEAQEMIRRLEEQLKQLQAAKEELEARQTELQLELQPIRNQSNLN  316 (318)
Q Consensus       242 ~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  316 (318)
                      +|+.||+++.||++||.++++++++++++|.+++++|.+|++++++++++++.|++++.++++++++|+.+++|+
T Consensus       329 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~l~e~~~~~~~e~~~l~~~~~~~e~~~~~l~~~~~~~  403 (575)
T 2i1j_A          329 ARERAEKKQQEYQDRLRQMQEEMERSQANLLEAQDMILRLEEQLRQLQAAKEELEQRQNELQAMMQRLEETKNME  403 (575)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC---------------------------------------
T ss_pred             HHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhH
Confidence            999999999999999999999999999999999999999999999999999999999999999999999998875



>1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Back     alignment and structure
>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Back     alignment and structure
>3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Back     alignment and structure
>1mix_A Talin; focal adhesion, integrin binding, FERM domain, cytoskeleton, structural protein; 1.75A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 PDB: 1miz_B 1mk7_B 1mk9_B 1y19_B 3g9w_A 2hrj_A 2g35_A* 2k00_A 2h7d_A* 2h7e_A* 2kgx_B Back     alignment and structure
>4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus} Back     alignment and structure
>2al6_A Focal adhesion kinase 1; transferase; 2.35A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 2j0m_A* 2aeh_A Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} PDB: 3u7d_A Back     alignment and structure
>3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A Back     alignment and structure
>1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Back     alignment and structure
>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Back     alignment and structure
>3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>4eku_A Protein-tyrosine kinase 2-beta; proline-rich tyrosine kinase 2, FERM domain, transferase; 3.25A {Homo sapiens} Back     alignment and structure
>2al6_A Focal adhesion kinase 1; transferase; 2.35A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 2j0m_A* 2aeh_A Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} PDB: 3u7d_A Back     alignment and structure
>3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>4eku_A Protein-tyrosine kinase 2-beta; proline-rich tyrosine kinase 2, FERM domain, transferase; 3.25A {Homo sapiens} Back     alignment and structure
>1mix_A Talin; focal adhesion, integrin binding, FERM domain, cytoskeleton, structural protein; 1.75A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 PDB: 1miz_B 1mk7_B 1mk9_B 1y19_B 3g9w_A 2hrj_A 2g35_A* 2k00_A 2h7d_A* 2h7e_A* 2kgx_B Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus} Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 318
d1ef1a299 b.55.1.5 (A:199-297) Moesin {Human (Homo sapiens) 2e-23
d1h4ra299 b.55.1.5 (A:215-313) Merlin {Human (Homo sapiens) 9e-22
d1gg3a292 b.55.1.5 (A:188-279) Erythroid membrane protein 4. 1e-12
d1gg3a292 b.55.1.5 (A:188-279) Erythroid membrane protein 4. 7e-09
d1h4ra1111 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) 3e-11
d1ef1a1111 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [ 6e-11
d1gg3a1106 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1 2e-10
d1mixa1114 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus 4e-09
d2al6a1123 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chic 1e-07
d1ef1a384 d.15.1.4 (A:4-87) Moesin {Human (Homo sapiens) [Ta 1e-06
d1h4ra384 d.15.1.4 (A:20-103) Merlin {Human (Homo sapiens) [ 2e-05
>d1ef1a2 b.55.1.5 (A:199-297) Moesin {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure

class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Third domain of FERM
domain: Moesin
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 89.9 bits (223), Expect = 2e-23
 Identities = 60/67 (89%), Positives = 65/67 (97%)

Query: 144 NCLLTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHEL 203
           N  LTPKIGFPWSEIRNISFND+KF+IKPIDKKAPDFVF+APR+R+NKRILALCMGNHEL
Sbjct: 33  NDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHEL 92

Query: 204 YMRRRKP 210
           YMRRRKP
Sbjct: 93  YMRRRKP 99


>d1h4ra2 b.55.1.5 (A:215-313) Merlin {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1gg3a2 b.55.1.5 (A:188-279) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1gg3a2 b.55.1.5 (A:188-279) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 114 Back     information, alignment and structure
>d2al6a1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 123 Back     information, alignment and structure
>d1ef1a3 d.15.1.4 (A:4-87) Moesin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1h4ra3 d.15.1.4 (A:20-103) Merlin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query318
d1ef1a299 Moesin {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1h4ra299 Merlin {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1gg3a292 Erythroid membrane protein 4.1R {Human (Homo sapie 99.87
d1ef1a384 Moesin {Human (Homo sapiens) [TaxId: 9606]} 99.05
d1h4ra384 Merlin {Human (Homo sapiens) [TaxId: 9606]} 98.94
d1gg3a381 Erythroid membrane protein 4.1R {Human (Homo sapie 98.69
d1ef1a1111 Moesin {Human (Homo sapiens) [TaxId: 9606]} 98.37
d1gg3a1106 Erythroid membrane protein 4.1R {Human (Homo sapie 98.37
d1ef1a1111 Moesin {Human (Homo sapiens) [TaxId: 9606]} 98.34
d1mixa1114 Talin {Chicken (Gallus gallus) [TaxId: 9031]} 98.33
d1h4ra1111 Merlin {Human (Homo sapiens) [TaxId: 9606]} 98.3
d2al6a1123 Focal adhesion kinase 1 {Chicken (Gallus gallus) [ 98.28
d1h4ra1111 Merlin {Human (Homo sapiens) [TaxId: 9606]} 98.23
d1gg3a1106 Erythroid membrane protein 4.1R {Human (Homo sapie 97.67
d1mixa1114 Talin {Chicken (Gallus gallus) [TaxId: 9031]} 97.41
d1mixa292 Talin {Chicken (Gallus gallus) [TaxId: 9031]} 96.22
d2al6a1123 Focal adhesion kinase 1 {Chicken (Gallus gallus) [ 94.94
>d1ef1a2 b.55.1.5 (A:199-297) Moesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Third domain of FERM
domain: Moesin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95  E-value=3.8e-29  Score=199.54  Aligned_cols=99  Identities=90%  Similarity=1.550  Sum_probs=92.7

Q ss_pred             CcccceeEEeecCCCCeEEEeecCCceeeeecCCccccccccccccCCCeeEEEEEeecCCCchHHHHHhHHHHHHHHHh
Q psy3983          50 EMYGVNYFEIKNKKGTELWLGVDALGLNIYEKEDNLTNVMSQDVKKENPLQFKFRAKFYPEDVVEEIIQDITLRLFYLQV  129 (318)
Q Consensus        50 e~yGv~YFgL~d~kg~~~WLgl~k~Gi~Iy~~~dk~~~v~~q~i~~~~p~~~~f~vkfyp~d~~~eL~qe~TRylf~LQl  129 (318)
                      |+||++||.++|.+|.++|||+++.||.||+.+++                                             
T Consensus         1 e~YGv~~~~vkd~~~~~~~LGi~~~GI~iy~~~~~---------------------------------------------   35 (99)
T d1ef1a2           1 EMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDR---------------------------------------------   35 (99)
T ss_dssp             TTTTCEEEEEECTTCCEEEEEEETTEEEEEETTCS---------------------------------------------
T ss_pred             CCCCcEeEEEeCCCCCcEEEEEecCCeEEEeCCCe---------------------------------------------
Confidence            69999999999999999999999999999997766                                             


Q ss_pred             hhhhhcCCCCCCCcccccccccCccCccccccccccceEEEEeCCCCCCceEEEcCCccchHHHHHHhhhcccccccccC
Q psy3983         130 SRSAGSRVRFPPGPNCLLTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHELYMRRRK  209 (318)
Q Consensus       130 K~di~~rl~C~~~~a~lL~p~~~f~W~~I~~lsf~~kkF~Ikp~dkk~~~~~F~~~~~~~~K~iw~lcv~~H~Ff~~rr~  209 (318)
                                       ..|...|+|++|.+|||++++|+|++.++...+++|+++|+++||+||++|+++|.|||++|+
T Consensus        36 -----------------~~~~~~f~W~~I~klsf~~k~f~I~~~~~~~~~~~f~~~s~~~~k~lw~~c~e~H~Ff~~~r~   98 (99)
T d1ef1a2          36 -----------------LTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRK   98 (99)
T ss_dssp             -----------------SSCSEEEEGGGEEEEEEETTEEEEEESSSSSCCEEEECSSHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred             -----------------eccceEEechhEEEEEecCcEEEEEEeccCCCeEEEEcCChHHHHHHHHHHHHHHHHHHhccC
Confidence                             444568999999999999999999999988889999999999999999999999999999988


Q ss_pred             C
Q psy3983         210 P  210 (318)
Q Consensus       210 ~  210 (318)
                      |
T Consensus        99 p   99 (99)
T d1ef1a2          99 P   99 (99)
T ss_dssp             C
T ss_pred             C
Confidence            7



>d1h4ra2 b.55.1.5 (A:215-313) Merlin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gg3a2 b.55.1.5 (A:188-279) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ef1a3 d.15.1.4 (A:4-87) Moesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h4ra3 d.15.1.4 (A:20-103) Merlin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gg3a3 d.15.1.4 (A:1-81) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2al6a1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1mixa2 b.55.1.5 (A:309-400) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2al6a1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure