Psyllid ID: psy3983
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 318 | ||||||
| 325296743 | 586 | ezrin/radixin/moesin [Aplysia californic | 0.757 | 0.411 | 0.519 | 2e-76 | |
| 328697842 | 572 | PREDICTED: moesin/ezrin/radixin homolog | 0.481 | 0.267 | 0.808 | 7e-73 | |
| 296216127 | 605 | PREDICTED: radixin isoform 1 [Callithrix | 0.726 | 0.381 | 0.518 | 4e-72 | |
| 14348876 | 587 | ezrin/radixin/moesin [Biomphalaria glabr | 0.713 | 0.386 | 0.510 | 3e-71 | |
| 357613203 | 1068 | Moesin [Danaus plexippus] | 0.522 | 0.155 | 0.816 | 4e-71 | |
| 289740905 | 575 | radixin [Glossina morsitans morsitans] | 0.477 | 0.264 | 0.798 | 8e-71 | |
| 194769276 | 646 | GF19124 [Drosophila ananassae] gi|190618 | 0.537 | 0.264 | 0.784 | 1e-70 | |
| 195163205 | 647 | GL13033 [Drosophila persimilis] gi|19846 | 0.537 | 0.264 | 0.784 | 2e-70 | |
| 195042307 | 645 | GH12073 [Drosophila grimshawi] gi|193901 | 0.537 | 0.265 | 0.784 | 2e-70 | |
| 195400983 | 645 | GJ15179 [Drosophila virilis] gi|19414174 | 0.537 | 0.265 | 0.784 | 2e-70 |
| >gi|325296743|ref|NP_001191607.1| ezrin/radixin/moesin [Aplysia californica] gi|71733130|gb|AAZ40190.1| ezrin/radixin/moesin [Aplysia californica] | Back alignment and taxonomy information |
|---|
Score = 292 bits (747), Expect = 2e-76, Method: Compositional matrix adjust.
Identities = 159/306 (51%), Positives = 200/306 (65%), Gaps = 65/306 (21%)
Query: 5 PLRVMDQHKMSPSEWESSITTWWKEHKGMLREDAMMEYLKIAQDLEMYGVNYFEIKNKKG 64
P RV DQHK+S +WE I +W+ EHKGMLREDAM+E+LKIAQDLEMYGVNYFEIKNKKG
Sbjct: 155 PQRVYDQHKLSKDQWEDRIKSWYGEHKGMLREDAMIEFLKIAQDLEMYGVNYFEIKNKKG 214
Query: 65 TELWLGVDALGLNIYEKEDNLTNVMSQDVKKENPLQFKFRAKFYPEDVVEEIIQDITLRL 124
T+L LGVDALGLN+YEK+D LT
Sbjct: 215 TDLLLGVDALGLNVYEKDDKLT-------------------------------------- 236
Query: 125 FYLQVSRSAGSRVRFPPGPNCLLTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFA 184
R+ FP WSEIRNISFND+KFIIKPIDKKAPDFVF+A
Sbjct: 237 ----------PRIGFP--------------WSEIRNISFNDKKFIIKPIDKKAPDFVFYA 272
Query: 185 PRVRVNKRILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKNAKQQQRDKLQLEIAARE 244
PR+R+NKRILALCMGNHELYMRRRKPDTI+VQQMKAQARE+K AKQQ+R +L RE
Sbjct: 273 PRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQAREDKLAKQQERAQLARMRQERE 332
Query: 245 KAEKKHQESVERLKQLEVEMAKRDQDLMEAQEMIRRLEEQLKQLQAAKEELEA---RQTE 301
++++ ++ E+++ +E E +R ++L E Q MIR +E++ +L +EEL++ R E
Sbjct: 333 ESDRLRKDLEEKVRIMEEEQKQRMKELEELQGMIRDRDEKVAELTRLREELDSERKRAEE 392
Query: 302 LQLELQ 307
LQ +++
Sbjct: 393 LQRDIE 398
|
Source: Aplysia californica Species: Aplysia californica Genus: Aplysia Family: Aplysiidae Order: Class: Gastropoda Phylum: Mollusca Superkingdom: Eukaryota |
| >gi|328697842|ref|XP_001942978.2| PREDICTED: moesin/ezrin/radixin homolog 1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|296216127|ref|XP_002754417.1| PREDICTED: radixin isoform 1 [Callithrix jacchus] gi|390469603|ref|XP_003734146.1| PREDICTED: radixin isoform 2 [Callithrix jacchus] | Back alignment and taxonomy information |
|---|
| >gi|14348876|gb|AAK61353.1| ezrin/radixin/moesin [Biomphalaria glabrata] | Back alignment and taxonomy information |
|---|
| >gi|357613203|gb|EHJ68371.1| Moesin [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|289740905|gb|ADD19200.1| radixin [Glossina morsitans morsitans] | Back alignment and taxonomy information |
|---|
| >gi|194769276|ref|XP_001966732.1| GF19124 [Drosophila ananassae] gi|190618253|gb|EDV33777.1| GF19124 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|195163205|ref|XP_002022442.1| GL13033 [Drosophila persimilis] gi|198469306|ref|XP_001354985.2| GA10507 [Drosophila pseudoobscura pseudoobscura] gi|194104434|gb|EDW26477.1| GL13033 [Drosophila persimilis] gi|198146808|gb|EAL32041.2| GA10507 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|195042307|ref|XP_001991407.1| GH12073 [Drosophila grimshawi] gi|193901165|gb|EDW00032.1| GH12073 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|195400983|ref|XP_002059095.1| GJ15179 [Drosophila virilis] gi|194141747|gb|EDW58164.1| GJ15179 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 318 | ||||||
| UNIPROTKB|Q170J7 | 583 | Moe "Moesin/ezrin/radixin homo | 0.531 | 0.289 | 0.781 | 1e-107 | |
| UNIPROTKB|B0WYY2 | 572 | Moe "Moesin/ezrin/radixin homo | 0.531 | 0.295 | 0.769 | 4.5e-107 | |
| UNIPROTKB|Q29GR8 | 593 | Moe "Moesin/ezrin/radixin homo | 0.540 | 0.290 | 0.784 | 1.2e-106 | |
| FB|FBgn0011661 | 578 | Moe "Moesin" [Drosophila melan | 0.540 | 0.297 | 0.773 | 4e-106 | |
| UNIPROTKB|Q7PS12 | 581 | Moe "Moesin/ezrin/radixin homo | 0.531 | 0.290 | 0.757 | 1.3e-105 | |
| UNIPROTKB|P26038 | 577 | MSN "Moesin" [Homo sapiens (ta | 0.528 | 0.291 | 0.602 | 6.5e-83 | |
| UNIPROTKB|A7YIJ8 | 604 | RDX "Radixin isoform b" [Homo | 0.477 | 0.251 | 0.629 | 8.3e-83 | |
| UNIPROTKB|P35241 | 583 | RDX "Radixin" [Homo sapiens (t | 0.477 | 0.260 | 0.629 | 8.3e-83 | |
| UNIPROTKB|F1MJJ8 | 583 | RDX "Radixin" [Bos taurus (tax | 0.484 | 0.264 | 0.621 | 8.3e-83 | |
| UNIPROTKB|Q32LP2 | 583 | RDX "Radixin" [Bos taurus (tax | 0.484 | 0.264 | 0.621 | 8.3e-83 |
| UNIPROTKB|Q170J7 Moe "Moesin/ezrin/radixin homolog 1" [Aedes aegypti (taxid:7159)] | Back alignment and assigned GO terms |
|---|
Score = 685 (246.2 bits), Expect = 1.0e-107, Sum P(2) = 1.0e-107
Identities = 132/169 (78%), Positives = 151/169 (89%)
Query: 147 LTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHELYMR 206
LTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVR+NKRILALCMGNHELYMR
Sbjct: 240 LTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRINKRILALCMGNHELYMR 299
Query: 207 RRKPDTIDVQQMKAQAREEKNAKQQQRDKLQLEIAAREKAEKKHQESVERLKQLEVEMAK 266
RRKPDTIDVQQMKAQAREEKNAKQQ+R+KLQL +AARE+AEKK QE +RL+ ++ EM +
Sbjct: 300 RRKPDTIDVQQMKAQAREEKNAKQQEREKLQLALAARERAEKKQQEYEDRLRTMQEEMER 359
Query: 267 RDQDLMEAQEMIRRLEEQLKQLQAAKEELEARQTELQLELQPIRNQSNL 315
+L+EAQEMIRRLE+QLKQLQ AK+ELEARQ ELQ+ ++ + N+
Sbjct: 360 SQANLIEAQEMIRRLEDQLKQLQFAKDELEARQNELQVMIKRLEESKNM 408
|
|
| UNIPROTKB|B0WYY2 Moe "Moesin/ezrin/radixin homolog 1" [Culex quinquefasciatus (taxid:7176)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q29GR8 Moe "Moesin/ezrin/radixin homolog 1" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0011661 Moe "Moesin" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7PS12 Moe "Moesin/ezrin/radixin homolog 1" [Anopheles gambiae (taxid:7165)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P26038 MSN "Moesin" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A7YIJ8 RDX "Radixin isoform b" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P35241 RDX "Radixin" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MJJ8 RDX "Radixin" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q32LP2 RDX "Radixin" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 318 | |||
| cd13194 | 97 | cd13194, FERM_C_ERM, ERM family FERM domain C-lobe | 9e-44 | |
| pfam09380 | 90 | pfam09380, FERM_C, FERM C-terminal PH-like domain | 3e-21 | |
| cd13194 | 97 | cd13194, FERM_C_ERM, ERM family FERM domain C-lobe | 1e-19 | |
| cd00836 | 91 | cd00836, FERM_C-lobe, FERM domain C-lobe | 2e-12 | |
| pfam00373 | 113 | pfam00373, FERM_M, FERM central domain | 1e-11 | |
| smart00295 | 201 | smart00295, B41, Band 4 | 1e-11 | |
| pfam00769 | 244 | pfam00769, ERM, Ezrin/radixin/moesin family | 7e-09 | |
| cd13189 | 123 | cd13189, FERM_C_PTPN4_PTPN3_like, Protein tyrosine | 7e-08 | |
| cd13187 | 124 | cd13187, FERM_C_PTPH13, Protein tyrosine phosphata | 1e-06 | |
| cd13199 | 176 | cd13199, FERM_C2_MyoVII, Myosin VII (MyoVII, Myo7) | 2e-06 | |
| cd13184 | 113 | cd13184, FERM_C_4_1_family, Protein 4 | 7e-06 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 1e-05 | |
| pfam09380 | 90 | pfam09380, FERM_C, FERM C-terminal PH-like domain | 2e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-05 | |
| cd13191 | 115 | cd13191, FERM_C_FRMD4A_FRMD4B, FERM domain-contain | 2e-05 | |
| COG1842 | 225 | COG1842, PspA, Phage shock protein A (IM30), suppr | 2e-05 | |
| cd13185 | 109 | cd13185, FERM_C_FRMD1_FRMD6, FERM domain containin | 2e-05 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 3e-05 | |
| cd13195 | 131 | cd13195, FERM_C_MYLIP_IDOL, The E3 ubiquitin ligas | 3e-05 | |
| cd13202 | 111 | cd13202, FERM_C_MyoX, Myosin X (MyoX, Myo10) FERM | 3e-05 | |
| smart00295 | 201 | smart00295, B41, Band 4 | 4e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 9e-05 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 9e-05 | |
| cd13187 | 124 | cd13187, FERM_C_PTPH13, Protein tyrosine phosphata | 1e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 2e-04 | |
| cd13192 | 105 | cd13192, FERM_C_FRMD3_FRMD5, FERM domain-containin | 2e-04 | |
| TIGR03346 | 852 | TIGR03346, chaperone_ClpB, ATP-dependent chaperone | 2e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-04 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 4e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 4e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 7e-04 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 7e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.001 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.001 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.001 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.001 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 0.001 | |
| TIGR01843 | 423 | TIGR01843, type_I_hlyD, type I secretion membrane | 0.001 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 0.001 | |
| PRK12705 | 508 | PRK12705, PRK12705, hypothetical protein; Provisio | 0.001 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 0.001 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.002 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 0.002 | |
| pfam03961 | 450 | pfam03961, DUF342, Protein of unknown function (DU | 0.002 | |
| pfam12795 | 239 | pfam12795, MscS_porin, Mechanosensitive ion channe | 0.002 | |
| COG3096 | 1480 | COG3096, MukB, Uncharacterized protein involved in | 0.002 | |
| cd13188 | 111 | cd13188, FERM_C_PTPN14_PTPN21, Protein tyrosine ph | 0.002 | |
| PRK11637 | 428 | PRK11637, PRK11637, AmiB activator; Provisional | 0.002 | |
| TIGR03346 | 852 | TIGR03346, chaperone_ClpB, ATP-dependent chaperone | 0.003 | |
| PRK11281 | 1113 | PRK11281, PRK11281, hypothetical protein; Provisio | 0.003 | |
| pfam08703 | 181 | pfam08703, PLC-beta_C, PLC-beta C terminal | 0.003 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.004 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.004 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.004 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.004 | |
| pfam04012 | 220 | pfam04012, PspA_IM30, PspA/IM30 family | 0.004 | |
| pfam00012 | 598 | pfam00012, HSP70, Hsp70 protein | 0.004 |
| >gnl|CDD|241348 cd13194, FERM_C_ERM, ERM family FERM domain C-lobe/F3 | Back alignment and domain information |
|---|
Score = 145 bits (367), Expect = 9e-44
Identities = 56/67 (83%), Positives = 62/67 (92%)
Query: 143 PNCLLTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHE 202
LTPKIGFPWSEIRNISFND+KF+IKPIDKKAPDFVF++PR+R+NKRIL LCMGNHE
Sbjct: 31 LENKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYSPRLRINKRILDLCMGNHE 90
Query: 203 LYMRRRK 209
LYMRRRK
Sbjct: 91 LYMRRRK 97
|
The ERM family includes ezrin, radixin, moesin and merlin. They are composed of a N-terminal FERM (ERM) domain (also called N-ERMAD (N-terminal ERM association domain)), a coiled coil region (CRR), and a C-terminal domain CERMAD (C-terminal ERM association domain) which has an F-actin-binding site (ABD). Two actin-binding sites have been identified in the middle and N-terminal domains. Merlin is structurally similar to the ERM proteins, but instead of an actin-binding domain (ABD), it contains a C-terminal domain (CTD), just like the proteins from the 4.1 family. Activated ezrin, radixin and moesin are thought to be involved in the linking of actin filaments to CD43, CD44, ICAM1-3 cell adhesion molecules, various membrane channels and receptors, such as the Na+/H+ exchanger-3 (NHE3), cystic fibrosis transmembrane conductance regulator (CFTR), and the beta2-adrenergic receptor. The ERM proteins exist in two states, a dormant state in which the FERM domain binds to its own C-terminal tail and thereby precludes binding of some partner proteins, and an activated state, in which the FERM domain binds to one of many membrane binding proteins and the C-terminal tail binds to F-actin. The FERM domain has a cloverleaf tripart structure (FERM_N, FERM_M, FERM_C/N, alpha-, and C-lobe/A-lobe, B-lobe, C-lobe/F1, F2, F3). The C-lobe/F3 within the FERM domain of ERM is part of the PH domain family. The FERM domain is found in the cytoskeletal-associated proteins such as ezrin, moesin, radixin, 4.1R, and merlin. These proteins provide a link between the membrane and cytoskeleton and are involved in signal transduction pathways. The FERM domain is also found in protein tyrosine phosphatases (PTPs) , the tyrosine kinases FAK and JAK, in addition to other proteins involved in signaling. This domain is structurally similar to the PH and PTB domains and consequently is capable of binding to both peptides and phospholipids at different sites. Length = 97 |
| >gnl|CDD|220216 pfam09380, FERM_C, FERM C-terminal PH-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|241348 cd13194, FERM_C_ERM, ERM family FERM domain C-lobe/F3 | Back alignment and domain information |
|---|
| >gnl|CDD|241233 cd00836, FERM_C-lobe, FERM domain C-lobe | Back alignment and domain information |
|---|
| >gnl|CDD|215882 pfam00373, FERM_M, FERM central domain | Back alignment and domain information |
|---|
| >gnl|CDD|214604 smart00295, B41, Band 4 | Back alignment and domain information |
|---|
| >gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family | Back alignment and domain information |
|---|
| >gnl|CDD|241343 cd13189, FERM_C_PTPN4_PTPN3_like, Protein tyrosine phosphatase non-receptor proteins 3 and 4 (PTPN4 and PTPN3) FERM domain C-lobe | Back alignment and domain information |
|---|
| >gnl|CDD|241341 cd13187, FERM_C_PTPH13, Protein tyrosine phosphatase non-receptor 13 (PTPH13) FERM domain C-lobe | Back alignment and domain information |
|---|
| >gnl|CDD|241353 cd13199, FERM_C2_MyoVII, Myosin VII (MyoVII, Myo7) FERM domain C-lobe, repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|241338 cd13184, FERM_C_4_1_family, Protein 4 | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|220216 pfam09380, FERM_C, FERM C-terminal PH-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|241345 cd13191, FERM_C_FRMD4A_FRMD4B, FERM domain-containing protein 4A and 4B (FRMD4A and 4B) FERM domain C-lobe | Back alignment and domain information |
|---|
| >gnl|CDD|224755 COG1842, PspA, Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|241339 cd13185, FERM_C_FRMD1_FRMD6, FERM domain containing 1 and 6 proteins FERM domain C-lobe | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|241349 cd13195, FERM_C_MYLIP_IDOL, The E3 ubiquitin ligase myosin regulatory light chain-interacting protein (MYLIP; also called inducible degrader of the LDL receptor, IDOL) FERM domain C-lobe | Back alignment and domain information |
|---|
| >gnl|CDD|241356 cd13202, FERM_C_MyoX, Myosin X (MyoX, Myo10) FERM domain C-lobe | Back alignment and domain information |
|---|
| >gnl|CDD|214604 smart00295, B41, Band 4 | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|241341 cd13187, FERM_C_PTPH13, Protein tyrosine phosphatase non-receptor 13 (PTPH13) FERM domain C-lobe | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241346 cd13192, FERM_C_FRMD3_FRMD5, FERM domain-containing protein 3 and 5 FERM (FRMD3 and 5) domain C-lobe | Back alignment and domain information |
|---|
| >gnl|CDD|234173 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|130902 TIGR01843, type_I_hlyD, type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237178 PRK12705, PRK12705, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217817 pfam03961, DUF342, Protein of unknown function (DUF342) | Back alignment and domain information |
|---|
| >gnl|CDD|221776 pfam12795, MscS_porin, Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >gnl|CDD|225638 COG3096, MukB, Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|241342 cd13188, FERM_C_PTPN14_PTPN21, Protein tyrosine phosphatase non-receptor proteins 14 and 21 (PTPN14 and 21) FERM domain | Back alignment and domain information |
|---|
| >gnl|CDD|236942 PRK11637, PRK11637, AmiB activator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234173 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|204032 pfam08703, PLC-beta_C, PLC-beta C terminal | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|217843 pfam04012, PspA_IM30, PspA/IM30 family | Back alignment and domain information |
|---|
| >gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 318 | |||
| KOG3529|consensus | 596 | 100.0 | ||
| KOG3530|consensus | 616 | 99.98 | ||
| KOG3527|consensus | 975 | 99.92 | ||
| KOG0792|consensus | 1144 | 99.9 | ||
| cd00836 | 92 | FERM_C FERM_C domain. The FERM_C domain is the thi | 99.9 | |
| PF09380 | 90 | FERM_C: FERM C-terminal PH-like domain; InterPro: | 99.85 | |
| KOG3531|consensus | 1036 | 99.72 | ||
| KOG3529|consensus | 596 | 99.53 | ||
| KOG3530|consensus | 616 | 99.04 | ||
| KOG3527|consensus | 975 | 98.73 | ||
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 98.68 | |
| smart00295 | 207 | B41 Band 4.1 homologues. Also known as ezrin/radix | 98.49 | |
| KOG4371|consensus | 1332 | 98.48 | ||
| PF09379 | 80 | FERM_N: FERM N-terminal domain ; InterPro: IPR0189 | 98.38 | |
| PF00373 | 126 | FERM_M: FERM central domain; InterPro: IPR019748 T | 98.26 | |
| KOG3531|consensus | 1036 | 98.11 | ||
| KOG0792|consensus | 1144 | 98.07 | ||
| PF00373 | 126 | FERM_M: FERM central domain; InterPro: IPR019748 T | 96.52 | |
| KOG0248|consensus | 936 | 95.16 | ||
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 95.1 | |
| KOG4261|consensus | 1003 | 94.92 | ||
| KOG3727|consensus | 664 | 94.29 | ||
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 91.47 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 90.67 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 89.78 | |
| KOG1029|consensus | 1118 | 89.53 | ||
| PRK11637 | 428 | AmiB activator; Provisional | 88.48 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 88.31 | |
| PRK11637 | 428 | AmiB activator; Provisional | 88.22 | |
| PTZ00266 | 1021 | NIMA-related protein kinase; Provisional | 87.94 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 87.51 | |
| PTZ00266 | 1021 | NIMA-related protein kinase; Provisional | 87.48 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 86.88 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 85.75 | |
| KOG1029|consensus | 1118 | 84.96 | ||
| PRK09510 | 387 | tolA cell envelope integrity inner membrane protei | 84.72 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 83.38 | |
| KOG0742|consensus | 630 | 83.36 | ||
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 82.75 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 82.4 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 82.05 | |
| PF08826 | 61 | DMPK_coil: DMPK coiled coil domain like; InterPro: | 80.04 |
| >KOG3529|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.2e-47 Score=389.57 Aligned_cols=254 Identities=63% Similarity=0.993 Sum_probs=243.7
Q ss_pred CCCCchhhHhhcCCChHHHHHHHHHHHHHccCCCHHHHHHHHHHHHhccCcccceeEEeecCCCCeEEEeecCCceeeee
Q psy3983 1 MSVSPLRVMDQHKMSPSEWESSITTWWKEHKGMLREDAMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYE 80 (318)
Q Consensus 1 ~~~~p~~~~~q~~~~~~~~e~~I~~~hk~~kG~~~~eAe~efLkvaq~Le~yGv~YFgL~d~kg~~~WLgl~k~Gi~Iy~ 80 (318)
++++|.+|+++|+||..+|+.+|..||..|+|+++++|+++||+++++|++||++||.++|++|++.|||++..|++||.
T Consensus 159 ~~~lP~~~~~q~~~s~~~~e~ri~~~~~~~~~~~re~a~leylki~qdle~ygvny~~i~~k~gt~~~lgv~~~gl~~y~ 238 (596)
T KOG3529|consen 159 DRLLPQRVLDQHKMTPDMWEDRIKEWYAEHRGMTREEAMLEYLKIAQDLEMYGVNYFEIKNKKGTDLWLGVDALGLNIYD 238 (596)
T ss_pred CcccchhhhhhccccHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHhccccccccceeecCCCCCCccccccccCCccccc
Confidence 46899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCccccccccccccCCCeeEEEEEeecCCCchHHHHHhHHHHHHHHHhhhhhhcCCCCCCCcccccccccCccCccccc
Q psy3983 81 KEDNLTNVMSQDVKKENPLQFKFRAKFYPEDVVEEIIQDITLRLFYLQVSRSAGSRVRFPPGPNCLLTPKIGFPWSEIRN 160 (318)
Q Consensus 81 ~~dk~~~v~~q~i~~~~p~~~~f~vkfyp~d~~~eL~qe~TRylf~LQlK~di~~rl~C~~~~a~lL~p~~~f~W~~I~~ 160 (318)
..|+ +.|+.+|+|++|+|
T Consensus 239 ~~~k--------------------------------------------------------------~~P~~~f~w~eirn 256 (596)
T KOG3529|consen 239 ESDK--------------------------------------------------------------LTPKIGFPWSEIRN 256 (596)
T ss_pred cccC--------------------------------------------------------------CCCCCCCCccccCC
Confidence 9988 88999999999999
Q ss_pred cccccceEEEEeCCCCCCceEEEcCCccchHHHHHHhhhcccccccccCCCcHHHHHHHHHHHHHHHHHHHhhHhHHHHH
Q psy3983 161 ISFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKNAKQQQRDKLQLEI 240 (318)
Q Consensus 161 lsf~~kkF~Ikp~dkk~~~~~F~~~~~~~~K~iw~lcv~~H~Ff~~rr~~d~~~vqqmkaqa~eek~~~~~er~~l~~e~ 240 (318)
|||++++|.|+|+|+++++|+|+.++.+.++.|+++|.+||++||+||+|||++||||++||+++|++++++|.++..++
T Consensus 257 isf~~kkf~~k~id~~~~~f~~~~~~~~~~~~~l~~~~~~~~l~~rr~~~~ti~vqq~~~~a~~~k~~~~~e~~~~~~~~ 336 (596)
T KOG3529|consen 257 ISFNDKKFHIKPIDKKASDFSFYAPRLRINKRILDLCMGNHELYMRRRKPDTIEVQQMKAQAREEKARKQLERAKLEREK 336 (596)
T ss_pred CCCCcccccCCCCCcccCcccccccccccchhhhhhhhccchhhhhcccccccchhhccccccchHHHHHHhhhhhhHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhchhhhc
Q psy3983 241 AAREKAEKKHQ-------ESVERLKQLEVEMAKRDQDLMEAQEMIRRLEEQLKQLQAAKEELEARQTELQLELQPIRNQS 313 (318)
Q Consensus 241 ~~~~~~~~~~~-------~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 313 (318)
..|+.++++.. ++..++.+.++.+.+..+++.++.+++..++++.+.++.++..|++....+++..+.+..+.
T Consensus 337 ~~re~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~E~~~~~l~~~a~~le~e~~rL~e~~~~le~e~ 416 (596)
T KOG3529|consen 337 KKRETGEKEGSELERLKEELQGRMAQAQEDVERARRELAEASRKARDLEEERKLLKKEASELEAERPRLEELKQKLEEEK 416 (596)
T ss_pred hhhhhcccccCcccccchhhhhhhhhhhHHHHHhhhcchhhcccccCccchhhhhhhhHhhhhhhhhHHHHHHHHHHHHh
Confidence 99999998854 78889999999999999999999999999999999999999999999999998888877665
Q ss_pred ccc
Q psy3983 314 NLN 316 (318)
Q Consensus 314 ~~~ 316 (318)
.+.
T Consensus 417 ~d~ 419 (596)
T KOG3529|consen 417 HDS 419 (596)
T ss_pred hcc
Confidence 543
|
|
| >KOG3530|consensus | Back alignment and domain information |
|---|
| >KOG3527|consensus | Back alignment and domain information |
|---|
| >KOG0792|consensus | Back alignment and domain information |
|---|
| >cd00836 FERM_C FERM_C domain | Back alignment and domain information |
|---|
| >PF09380 FERM_C: FERM C-terminal PH-like domain; InterPro: IPR018980 The FERM domain (F for 4 | Back alignment and domain information |
|---|
| >KOG3531|consensus | Back alignment and domain information |
|---|
| >KOG3529|consensus | Back alignment and domain information |
|---|
| >KOG3530|consensus | Back alignment and domain information |
|---|
| >KOG3527|consensus | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >smart00295 B41 Band 4 | Back alignment and domain information |
|---|
| >KOG4371|consensus | Back alignment and domain information |
|---|
| >PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain | Back alignment and domain information |
|---|
| >PF00373 FERM_M: FERM central domain; InterPro: IPR019748 The FERM domain (F for 4 | Back alignment and domain information |
|---|
| >KOG3531|consensus | Back alignment and domain information |
|---|
| >KOG0792|consensus | Back alignment and domain information |
|---|
| >PF00373 FERM_M: FERM central domain; InterPro: IPR019748 The FERM domain (F for 4 | Back alignment and domain information |
|---|
| >KOG0248|consensus | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG4261|consensus | Back alignment and domain information |
|---|
| >KOG3727|consensus | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PTZ00266 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PTZ00266 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0742|consensus | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 318 | ||||
| 2i1j_A | 575 | Moesin From Spodoptera Frugiperda At 2.1 Angstroms | 3e-72 | ||
| 1e5w_A | 346 | Structure Of Isolated Ferm Domain And First Long He | 1e-43 | ||
| 2emt_A | 322 | Crystal Structure Analysis Of The Radixin Ferm Doma | 2e-40 | ||
| 1j19_A | 317 | Crystal Structure Of The Radxin Ferm Domain Complex | 3e-40 | ||
| 2d10_A | 312 | Crystal Structure Of The Radixin Ferm Domain Comple | 3e-40 | ||
| 2d2q_A | 310 | Crystal Structure Of The Dimerized Radixin Ferm Dom | 3e-40 | ||
| 2zpy_A | 312 | Crystal Structure Of The Mouse Radxin Ferm Domain C | 4e-40 | ||
| 1gc6_A | 297 | Crystal Structure Of The Radixin Ferm Domain Comple | 1e-33 | ||
| 1gc6_A | 297 | Crystal Structure Of The Radixin Ferm Domain Comple | 4e-33 | ||
| 1ni2_A | 296 | Structure Of The Active Ferm Domain Of Ezrin Length | 3e-33 | ||
| 1ni2_A | 296 | Structure Of The Active Ferm Domain Of Ezrin Length | 3e-32 | ||
| 1sgh_A | 297 | Moesin Ferm Domain Bound To Ebp50 C-Terminal Peptid | 3e-33 | ||
| 1ef1_A | 294 | Crystal Structure Of The Moesin Ferm DomainTAIL DOM | 1e-31 | ||
| 1isn_A | 323 | Crystal Structure Of Merlin Ferm Domain Length = 32 | 9e-30 | ||
| 1h4r_A | 314 | Crystal Structure Of The Ferm Domain Of Merlin, The | 2e-27 | ||
| 1h4r_A | 314 | Crystal Structure Of The Ferm Domain Of Merlin, The | 4e-20 | ||
| 1h4r_B | 314 | Crystal Structure Of The Ferm Domain Of Merlin, The | 2e-27 | ||
| 1h4r_B | 314 | Crystal Structure Of The Ferm Domain Of Merlin, The | 4e-20 | ||
| 3u8z_A | 300 | Human Merlin Ferm Domain Length = 300 | 3e-27 | ||
| 3u8z_A | 300 | Human Merlin Ferm Domain Length = 300 | 6e-20 | ||
| 3bin_A | 283 | Structure Of The Dal-1 And Tslc1 (372-383) Complex | 1e-06 | ||
| 2he7_A | 283 | Ferm Domain Of Epb41l3 (Dal-1) Length = 283 | 1e-06 | ||
| 3au4_A | 555 | Structure Of The Human Myosin-X Myth4-Ferm Cassette | 5e-06 | ||
| 3pzd_A | 511 | Structure Of The Myosin X Myth4-FermDCC COMPLEX Len | 6e-06 |
| >pdb|2I1J|A Chain A, Moesin From Spodoptera Frugiperda At 2.1 Angstroms Resolution Length = 575 | Back alignment and structure |
|
| >pdb|1E5W|A Chain A, Structure Of Isolated Ferm Domain And First Long Helix Of Moesin Length = 346 | Back alignment and structure |
| >pdb|2EMT|A Chain A, Crystal Structure Analysis Of The Radixin Ferm Domain Complexed With Adhesion Molecule Psgl-1 Length = 322 | Back alignment and structure |
| >pdb|1J19|A Chain A, Crystal Structure Of The Radxin Ferm Domain Complexed With The Icam-2 Cytoplasmic Peptide Length = 317 | Back alignment and structure |
| >pdb|2D10|A Chain A, Crystal Structure Of The Radixin Ferm Domain Complexed With The Nherf-1 C-Terminal Tail Peptide Length = 312 | Back alignment and structure |
| >pdb|2D2Q|A Chain A, Crystal Structure Of The Dimerized Radixin Ferm Domain Length = 310 | Back alignment and structure |
| >pdb|2ZPY|A Chain A, Crystal Structure Of The Mouse Radxin Ferm Domain Complexed With The Mouse Cd44 Cytoplasmic Peptide Length = 312 | Back alignment and structure |
| >pdb|1GC6|A Chain A, Crystal Structure Of The Radixin Ferm Domain Complexed With Inositol-(1,4,5)-Triphosphate Length = 297 | Back alignment and structure |
| >pdb|1GC6|A Chain A, Crystal Structure Of The Radixin Ferm Domain Complexed With Inositol-(1,4,5)-Triphosphate Length = 297 | Back alignment and structure |
| >pdb|1NI2|A Chain A, Structure Of The Active Ferm Domain Of Ezrin Length = 296 | Back alignment and structure |
| >pdb|1NI2|A Chain A, Structure Of The Active Ferm Domain Of Ezrin Length = 296 | Back alignment and structure |
| >pdb|1SGH|A Chain A, Moesin Ferm Domain Bound To Ebp50 C-Terminal Peptide Length = 297 | Back alignment and structure |
| >pdb|1EF1|A Chain A, Crystal Structure Of The Moesin Ferm DomainTAIL DOMAIN COMPLEX Length = 294 | Back alignment and structure |
| >pdb|1ISN|A Chain A, Crystal Structure Of Merlin Ferm Domain Length = 323 | Back alignment and structure |
| >pdb|1H4R|A Chain A, Crystal Structure Of The Ferm Domain Of Merlin, The Neurofibromatosis 2 Tumor Suppressor Protein Length = 314 | Back alignment and structure |
| >pdb|1H4R|A Chain A, Crystal Structure Of The Ferm Domain Of Merlin, The Neurofibromatosis 2 Tumor Suppressor Protein Length = 314 | Back alignment and structure |
| >pdb|1H4R|B Chain B, Crystal Structure Of The Ferm Domain Of Merlin, The Neurofibromatosis 2 Tumor Suppressor Protein Length = 314 | Back alignment and structure |
| >pdb|1H4R|B Chain B, Crystal Structure Of The Ferm Domain Of Merlin, The Neurofibromatosis 2 Tumor Suppressor Protein Length = 314 | Back alignment and structure |
| >pdb|3U8Z|A Chain A, Human Merlin Ferm Domain Length = 300 | Back alignment and structure |
| >pdb|3U8Z|A Chain A, Human Merlin Ferm Domain Length = 300 | Back alignment and structure |
| >pdb|3BIN|A Chain A, Structure Of The Dal-1 And Tslc1 (372-383) Complex Length = 283 | Back alignment and structure |
| >pdb|2HE7|A Chain A, Ferm Domain Of Epb41l3 (Dal-1) Length = 283 | Back alignment and structure |
| >pdb|3AU4|A Chain A, Structure Of The Human Myosin-X Myth4-Ferm Cassette Bound To Its Specific Cargo, Dcc Length = 555 | Back alignment and structure |
| >pdb|3PZD|A Chain A, Structure Of The Myosin X Myth4-FermDCC COMPLEX Length = 511 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 318 | |||
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 1e-29 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 5e-25 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 2e-06 | |
| 1h4r_A | 314 | Merlin; FERM, neurofibromatosis, NF2, structural p | 3e-22 | |
| 1h4r_A | 314 | Merlin; FERM, neurofibromatosis, NF2, structural p | 4e-19 | |
| 1h4r_A | 314 | Merlin; FERM, neurofibromatosis, NF2, structural p | 5e-08 | |
| 1ef1_A | 294 | Moesin; membrane, FERM domain, tail domain, membra | 3e-21 | |
| 1ef1_A | 294 | Moesin; membrane, FERM domain, tail domain, membra | 7e-20 | |
| 1ef1_A | 294 | Moesin; membrane, FERM domain, tail domain, membra | 2e-09 | |
| 1mix_A | 206 | Talin; focal adhesion, integrin binding, FERM doma | 1e-19 | |
| 3qij_A | 296 | Protein 4.1; cytoskeleton, structural genomics, st | 5e-19 | |
| 3qij_A | 296 | Protein 4.1; cytoskeleton, structural genomics, st | 3e-11 | |
| 3qij_A | 296 | Protein 4.1; cytoskeleton, structural genomics, st | 4e-04 | |
| 4f7g_A | 222 | Talin-1; alpha-helix bundle, integrin activation, | 6e-18 | |
| 4f7g_A | 222 | Talin-1; alpha-helix bundle, integrin activation, | 5e-13 | |
| 3ivf_A | 371 | Talin-1; FERM domain, cell membrane, cell projecti | 8e-18 | |
| 3ivf_A | 371 | Talin-1; FERM domain, cell membrane, cell projecti | 3e-05 | |
| 4dxa_B | 322 | KREV interaction trapped protein 1; GTPase, FERM, | 5e-16 | |
| 4dxa_B | 322 | KREV interaction trapped protein 1; GTPase, FERM, | 5e-06 | |
| 3au4_A | 555 | Myosin-X; protein-protein complex, motor protein c | 5e-15 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 5e-10 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-06 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 6e-04 | |
| 3pvl_A | 655 | Myosin VIIA isoform 1; protein complex, novel fold | 2e-09 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 7e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-04 | |
| 2al6_A | 375 | Focal adhesion kinase 1; transferase; 2.35A {Gallu | 1e-06 | |
| 4eku_A | 392 | Protein-tyrosine kinase 2-beta; proline-rich tyros | 9e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 3e-05 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 6e-04 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 9e-05 |
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Length = 575 | Back alignment and structure |
|---|
Score = 117 bits (294), Expect = 1e-29
Identities = 134/170 (78%), Positives = 148/170 (87%)
Query: 144 NCLLTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHEL 203
+ LTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHEL
Sbjct: 231 DDKLTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHEL 290
Query: 204 YMRRRKPDTIDVQQMKAQAREEKNAKQQQRDKLQLEIAAREKAEKKHQESVERLKQLEVE 263
YMRRRKPDTIDVQQMKAQAREEK AKQ QR+KLQLEIAARE+AEKK QE +RL+Q++ E
Sbjct: 291 YMRRRKPDTIDVQQMKAQAREEKLAKQAQREKLQLEIAARERAEKKQQEYQDRLRQMQEE 350
Query: 264 MAKRDQDLMEAQEMIRRLEEQLKQLQAAKEELEARQTELQLELQPIRNQS 313
M + +L+EAQ+MI RLEEQL+QLQAAKEELE RQ ELQ +Q +
Sbjct: 351 MERSQANLLEAQDMILRLEEQLRQLQAAKEELEQRQNELQAMMQRLEETK 400
|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Length = 575 | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Length = 575 | Back alignment and structure |
|---|
| >1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Length = 314 | Back alignment and structure |
|---|
| >1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Length = 314 | Back alignment and structure |
|---|
| >1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Length = 314 | Back alignment and structure |
|---|
| >1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Length = 294 | Back alignment and structure |
|---|
| >1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Length = 294 | Back alignment and structure |
|---|
| >1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Length = 294 | Back alignment and structure |
|---|
| >1mix_A Talin; focal adhesion, integrin binding, FERM domain, cytoskeleton, structural protein; 1.75A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 PDB: 1miz_B 1mk7_B 1mk9_B 1y19_B 3g9w_A 2hrj_A 2g35_A* 2k00_A 2h7d_A* 2h7e_A* 2kgx_B Length = 206 | Back alignment and structure |
|---|
| >3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Length = 296 | Back alignment and structure |
|---|
| >3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Length = 296 | Back alignment and structure |
|---|
| >3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Length = 296 | Back alignment and structure |
|---|
| >4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus} Length = 222 | Back alignment and structure |
|---|
| >4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus} Length = 222 | Back alignment and structure |
|---|
| >3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Length = 371 | Back alignment and structure |
|---|
| >3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Length = 371 | Back alignment and structure |
|---|
| >4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} Length = 322 | Back alignment and structure |
|---|
| >4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} Length = 322 | Back alignment and structure |
|---|
| >3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A Length = 555 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Length = 655 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2al6_A Focal adhesion kinase 1; transferase; 2.35A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 2j0m_A* 2aeh_A Length = 375 | Back alignment and structure |
|---|
| >4eku_A Protein-tyrosine kinase 2-beta; proline-rich tyrosine kinase 2, FERM domain, transferase; 3.25A {Homo sapiens} Length = 392 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Length = 854 | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Length = 854 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 318 | |||
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 100.0 | |
| 1ef1_A | 294 | Moesin; membrane, FERM domain, tail domain, membra | 99.97 | |
| 1h4r_A | 314 | Merlin; FERM, neurofibromatosis, NF2, structural p | 99.97 | |
| 3qij_A | 296 | Protein 4.1; cytoskeleton, structural genomics, st | 99.95 | |
| 1mix_A | 206 | Talin; focal adhesion, integrin binding, FERM doma | 99.82 | |
| 4f7g_A | 222 | Talin-1; alpha-helix bundle, integrin activation, | 99.79 | |
| 2al6_A | 375 | Focal adhesion kinase 1; transferase; 2.35A {Gallu | 99.64 | |
| 3pvl_A | 655 | Myosin VIIA isoform 1; protein complex, novel fold | 99.63 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 99.62 | |
| 3ivf_A | 371 | Talin-1; FERM domain, cell membrane, cell projecti | 99.6 | |
| 4dxa_B | 322 | KREV interaction trapped protein 1; GTPase, FERM, | 99.59 | |
| 3au4_A | 555 | Myosin-X; protein-protein complex, motor protein c | 99.54 | |
| 1ef1_A | 294 | Moesin; membrane, FERM domain, tail domain, membra | 99.52 | |
| 1h4r_A | 314 | Merlin; FERM, neurofibromatosis, NF2, structural p | 99.47 | |
| 3qij_A | 296 | Protein 4.1; cytoskeleton, structural genomics, st | 99.46 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 99.16 | |
| 3ivf_A | 371 | Talin-1; FERM domain, cell membrane, cell projecti | 99.14 | |
| 4eku_A | 392 | Protein-tyrosine kinase 2-beta; proline-rich tyros | 99.07 | |
| 2al6_A | 375 | Focal adhesion kinase 1; transferase; 2.35A {Gallu | 98.99 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 98.58 | |
| 4dxa_B | 322 | KREV interaction trapped protein 1; GTPase, FERM, | 98.51 | |
| 3au4_A | 555 | Myosin-X; protein-protein complex, motor protein c | 98.45 | |
| 3pvl_A | 655 | Myosin VIIA isoform 1; protein complex, novel fold | 98.45 | |
| 4eku_A | 392 | Protein-tyrosine kinase 2-beta; proline-rich tyros | 98.35 | |
| 1mix_A | 206 | Talin; focal adhesion, integrin binding, FERM doma | 98.23 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 95.96 | |
| 4f7g_A | 222 | Talin-1; alpha-helix bundle, integrin activation, | 95.92 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 94.75 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 92.01 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 90.25 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 89.44 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 88.07 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 86.0 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 85.89 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 81.97 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 80.58 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 80.55 |
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.3e-55 Score=448.43 Aligned_cols=253 Identities=80% Similarity=1.214 Sum_probs=207.3
Q ss_pred CCCchhhHhhcCCChHHHHHHHHHHHHHccCCCHHHHHHHHHHHHhccCcccceeEEeecCCCCeEEEeecCCceeeeec
Q psy3983 2 SVSPLRVMDQHKMSPSEWESSITTWWKEHKGMLREDAMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEK 81 (318)
Q Consensus 2 ~~~p~~~~~q~~~~~~~~e~~I~~~hk~~kG~~~~eAe~efLkvaq~Le~yGv~YFgL~d~kg~~~WLgl~k~Gi~Iy~~ 81 (318)
.|+|.+|+++++++++.|+..|..+|++++|+++.+|++.||++|++|++||++||.++|++|+++||||++.||.||..
T Consensus 151 ~~lP~~vl~~~~~s~e~~~~~I~~~hk~l~G~s~~eA~~~yL~~a~~lp~YG~~~F~vkd~~g~~l~LGV~~~GI~v~~~ 230 (575)
T 2i1j_A 151 RLLPQRVTDQHKMSREEWEQSITNWWQEHRGMLREDAMMEYLKIAQDLEMYGVNYFEIRNKKNTELWLGVDALGLNIYEK 230 (575)
T ss_dssp CCSCHHHHHTBCCCHHHHHHHHHHHHGGGTTCCHHHHHHHHHHHHTTSTTTTCEEEEEECTTCCEEEEEECSSEEEEEET
T ss_pred ccCCHHHHhhcCCCHHHHHHHHHHHHHHccCCCHHHHHHHHHHHHHhccccCCEEEEEEecCCCEEEEEEcCCeeEEEeC
Confidence 58999999999999999999999999999999999999999999999999999999999999999999999999999998
Q ss_pred CCccccccccccccCCCeeEEEEEeecCCCchHHHHHhHHHHHHHHHhhhhhhcCCCCCCCcccccccccCccCcccccc
Q psy3983 82 EDNLTNVMSQDVKKENPLQFKFRAKFYPEDVVEEIIQDITLRLFYLQVSRSAGSRVRFPPGPNCLLTPKIGFPWSEIRNI 161 (318)
Q Consensus 82 ~dk~~~v~~q~i~~~~p~~~~f~vkfyp~d~~~eL~qe~TRylf~LQlK~di~~rl~C~~~~a~lL~p~~~f~W~~I~~l 161 (318)
+++ +.|...|+|++|.++
T Consensus 231 ~~k--------------------------------------------------------------~~~l~~f~w~~I~~i 248 (575)
T 2i1j_A 231 DDK--------------------------------------------------------------LTPKIGFPWSEIRNI 248 (575)
T ss_dssp TCS--------------------------------------------------------------SSCSEEEEGGGEEEE
T ss_pred CCC--------------------------------------------------------------cccceEecHHHhhcc
Confidence 776 445678999999999
Q ss_pred ccccceEEEEeCCCCCCceEEEcCCccchHHHHHHhhhcccccccccCCCcHHHHHHHHHHHHHHHHHHHhhHhHHHHHH
Q psy3983 162 SFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKNAKQQQRDKLQLEIA 241 (318)
Q Consensus 162 sf~~kkF~Ikp~dkk~~~~~F~~~~~~~~K~iw~lcv~~H~Ff~~rr~~d~~~vqqmkaqa~eek~~~~~er~~l~~e~~ 241 (318)
+|++++|+|++.+++.++|+|++++++.||+||++|+++|.||+++|+||+++||||||||||||++|++||++|.+|++
T Consensus 249 sf~~k~F~I~~~~~~~~~l~F~t~~~~~ak~i~~lc~~~H~ff~~~r~~d~~e~qqm~~~a~e~~~~~~~e~~~l~~~~~ 328 (575)
T 2i1j_A 249 SFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKLAKQAQREKLQLEIA 328 (575)
T ss_dssp EEETTEEEEEESCTTSCCEEEECSCHHHHHHHHHHHHHHHHHHHHHTSCCCHHHHHHHHHHHHHHHHHHHHHTTCCSCCC
T ss_pred cCCCCeEEEEEccCCcceeEEEeCCchhHHHHHHHHHHHHHHHHHccCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 99999999999987778899999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhchhhhcccc
Q psy3983 242 AREKAEKKHQESVERLKQLEVEMAKRDQDLMEAQEMIRRLEEQLKQLQAAKEELEARQTELQLELQPIRNQSNLN 316 (318)
Q Consensus 242 ~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 316 (318)
+|+.||+++.||++||.++++++++++++|.+++++|.+|++++++++++++.|++++.++++++++|+.+++|+
T Consensus 329 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~l~e~~~~~~~e~~~l~~~~~~~e~~~~~l~~~~~~~ 403 (575)
T 2i1j_A 329 ARERAEKKQQEYQDRLRQMQEEMERSQANLLEAQDMILRLEEQLRQLQAAKEELEQRQNELQAMMQRLEETKNME 403 (575)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC---------------------------------------
T ss_pred HHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhH
Confidence 999999999999999999999999999999999999999999999999999999999999999999999998875
|
| >1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A | Back alignment and structure |
|---|
| >1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A | Back alignment and structure |
|---|
| >3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A | Back alignment and structure |
|---|
| >1mix_A Talin; focal adhesion, integrin binding, FERM domain, cytoskeleton, structural protein; 1.75A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 PDB: 1miz_B 1mk7_B 1mk9_B 1y19_B 3g9w_A 2hrj_A 2g35_A* 2k00_A 2h7d_A* 2h7e_A* 2kgx_B | Back alignment and structure |
|---|
| >4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2al6_A Focal adhesion kinase 1; transferase; 2.35A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 2j0m_A* 2aeh_A | Back alignment and structure |
|---|
| >3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A | Back alignment and structure |
|---|
| >4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} PDB: 3u7d_A | Back alignment and structure |
|---|
| >3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A | Back alignment and structure |
|---|
| >1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A | Back alignment and structure |
|---|
| >1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A | Back alignment and structure |
|---|
| >3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* | Back alignment and structure |
|---|
| >3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A | Back alignment and structure |
|---|
| >4eku_A Protein-tyrosine kinase 2-beta; proline-rich tyrosine kinase 2, FERM domain, transferase; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2al6_A Focal adhesion kinase 1; transferase; 2.35A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 2j0m_A* 2aeh_A | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* | Back alignment and structure |
|---|
| >4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} PDB: 3u7d_A | Back alignment and structure |
|---|
| >3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A | Back alignment and structure |
|---|
| >3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >4eku_A Protein-tyrosine kinase 2-beta; proline-rich tyrosine kinase 2, FERM domain, transferase; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1mix_A Talin; focal adhesion, integrin binding, FERM domain, cytoskeleton, structural protein; 1.75A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 PDB: 1miz_B 1mk7_B 1mk9_B 1y19_B 3g9w_A 2hrj_A 2g35_A* 2k00_A 2h7d_A* 2h7e_A* 2kgx_B | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 318 | ||||
| d1ef1a2 | 99 | b.55.1.5 (A:199-297) Moesin {Human (Homo sapiens) | 2e-23 | |
| d1h4ra2 | 99 | b.55.1.5 (A:215-313) Merlin {Human (Homo sapiens) | 9e-22 | |
| d1gg3a2 | 92 | b.55.1.5 (A:188-279) Erythroid membrane protein 4. | 1e-12 | |
| d1gg3a2 | 92 | b.55.1.5 (A:188-279) Erythroid membrane protein 4. | 7e-09 | |
| d1h4ra1 | 111 | a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) | 3e-11 | |
| d1ef1a1 | 111 | a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [ | 6e-11 | |
| d1gg3a1 | 106 | a.11.2.1 (A:82-187) Erythroid membrane protein 4.1 | 2e-10 | |
| d1mixa1 | 114 | a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus | 4e-09 | |
| d2al6a1 | 123 | a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chic | 1e-07 | |
| d1ef1a3 | 84 | d.15.1.4 (A:4-87) Moesin {Human (Homo sapiens) [Ta | 1e-06 | |
| d1h4ra3 | 84 | d.15.1.4 (A:20-103) Merlin {Human (Homo sapiens) [ | 2e-05 |
| >d1ef1a2 b.55.1.5 (A:199-297) Moesin {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
class: All beta proteins fold: PH domain-like barrel superfamily: PH domain-like family: Third domain of FERM domain: Moesin species: Human (Homo sapiens) [TaxId: 9606]
Score = 89.9 bits (223), Expect = 2e-23
Identities = 60/67 (89%), Positives = 65/67 (97%)
Query: 144 NCLLTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHEL 203
N LTPKIGFPWSEIRNISFND+KF+IKPIDKKAPDFVF+APR+R+NKRILALCMGNHEL
Sbjct: 33 NDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHEL 92
Query: 204 YMRRRKP 210
YMRRRKP
Sbjct: 93 YMRRRKP 99
|
| >d1h4ra2 b.55.1.5 (A:215-313) Merlin {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1gg3a2 b.55.1.5 (A:188-279) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1gg3a2 b.55.1.5 (A:188-279) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 114 | Back information, alignment and structure |
|---|
| >d2al6a1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 123 | Back information, alignment and structure |
|---|
| >d1ef1a3 d.15.1.4 (A:4-87) Moesin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1h4ra3 d.15.1.4 (A:20-103) Merlin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 318 | |||
| d1ef1a2 | 99 | Moesin {Human (Homo sapiens) [TaxId: 9606]} | 99.95 | |
| d1h4ra2 | 99 | Merlin {Human (Homo sapiens) [TaxId: 9606]} | 99.95 | |
| d1gg3a2 | 92 | Erythroid membrane protein 4.1R {Human (Homo sapie | 99.87 | |
| d1ef1a3 | 84 | Moesin {Human (Homo sapiens) [TaxId: 9606]} | 99.05 | |
| d1h4ra3 | 84 | Merlin {Human (Homo sapiens) [TaxId: 9606]} | 98.94 | |
| d1gg3a3 | 81 | Erythroid membrane protein 4.1R {Human (Homo sapie | 98.69 | |
| d1ef1a1 | 111 | Moesin {Human (Homo sapiens) [TaxId: 9606]} | 98.37 | |
| d1gg3a1 | 106 | Erythroid membrane protein 4.1R {Human (Homo sapie | 98.37 | |
| d1ef1a1 | 111 | Moesin {Human (Homo sapiens) [TaxId: 9606]} | 98.34 | |
| d1mixa1 | 114 | Talin {Chicken (Gallus gallus) [TaxId: 9031]} | 98.33 | |
| d1h4ra1 | 111 | Merlin {Human (Homo sapiens) [TaxId: 9606]} | 98.3 | |
| d2al6a1 | 123 | Focal adhesion kinase 1 {Chicken (Gallus gallus) [ | 98.28 | |
| d1h4ra1 | 111 | Merlin {Human (Homo sapiens) [TaxId: 9606]} | 98.23 | |
| d1gg3a1 | 106 | Erythroid membrane protein 4.1R {Human (Homo sapie | 97.67 | |
| d1mixa1 | 114 | Talin {Chicken (Gallus gallus) [TaxId: 9031]} | 97.41 | |
| d1mixa2 | 92 | Talin {Chicken (Gallus gallus) [TaxId: 9031]} | 96.22 | |
| d2al6a1 | 123 | Focal adhesion kinase 1 {Chicken (Gallus gallus) [ | 94.94 |
| >d1ef1a2 b.55.1.5 (A:199-297) Moesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: PH domain-like barrel superfamily: PH domain-like family: Third domain of FERM domain: Moesin species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95 E-value=3.8e-29 Score=199.54 Aligned_cols=99 Identities=90% Similarity=1.550 Sum_probs=92.7
Q ss_pred CcccceeEEeecCCCCeEEEeecCCceeeeecCCccccccccccccCCCeeEEEEEeecCCCchHHHHHhHHHHHHHHHh
Q psy3983 50 EMYGVNYFEIKNKKGTELWLGVDALGLNIYEKEDNLTNVMSQDVKKENPLQFKFRAKFYPEDVVEEIIQDITLRLFYLQV 129 (318)
Q Consensus 50 e~yGv~YFgL~d~kg~~~WLgl~k~Gi~Iy~~~dk~~~v~~q~i~~~~p~~~~f~vkfyp~d~~~eL~qe~TRylf~LQl 129 (318)
|+||++||.++|.+|.++|||+++.||.||+.+++
T Consensus 1 e~YGv~~~~vkd~~~~~~~LGi~~~GI~iy~~~~~--------------------------------------------- 35 (99)
T d1ef1a2 1 EMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDR--------------------------------------------- 35 (99)
T ss_dssp TTTTCEEEEEECTTCCEEEEEEETTEEEEEETTCS---------------------------------------------
T ss_pred CCCCcEeEEEeCCCCCcEEEEEecCCeEEEeCCCe---------------------------------------------
Confidence 69999999999999999999999999999997766
Q ss_pred hhhhhcCCCCCCCcccccccccCccCccccccccccceEEEEeCCCCCCceEEEcCCccchHHHHHHhhhcccccccccC
Q psy3983 130 SRSAGSRVRFPPGPNCLLTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRVNKRILALCMGNHELYMRRRK 209 (318)
Q Consensus 130 K~di~~rl~C~~~~a~lL~p~~~f~W~~I~~lsf~~kkF~Ikp~dkk~~~~~F~~~~~~~~K~iw~lcv~~H~Ff~~rr~ 209 (318)
..|...|+|++|.+|||++++|+|++.++...+++|+++|+++||+||++|+++|.|||++|+
T Consensus 36 -----------------~~~~~~f~W~~I~klsf~~k~f~I~~~~~~~~~~~f~~~s~~~~k~lw~~c~e~H~Ff~~~r~ 98 (99)
T d1ef1a2 36 -----------------LTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRK 98 (99)
T ss_dssp -----------------SSCSEEEEGGGEEEEEEETTEEEEEESSSSSCCEEEECSSHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred -----------------eccceEEechhEEEEEecCcEEEEEEeccCCCeEEEEcCChHHHHHHHHHHHHHHHHHHhccC
Confidence 444568999999999999999999999988889999999999999999999999999999988
Q ss_pred C
Q psy3983 210 P 210 (318)
Q Consensus 210 ~ 210 (318)
|
T Consensus 99 p 99 (99)
T d1ef1a2 99 P 99 (99)
T ss_dssp C
T ss_pred C
Confidence 7
|
| >d1h4ra2 b.55.1.5 (A:215-313) Merlin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gg3a2 b.55.1.5 (A:188-279) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ef1a3 d.15.1.4 (A:4-87) Moesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h4ra3 d.15.1.4 (A:20-103) Merlin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gg3a3 d.15.1.4 (A:1-81) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2al6a1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1mixa2 b.55.1.5 (A:309-400) Talin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2al6a1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|