Psyllid ID: psy4102

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------105

MAPVLPALGSLLTGSGWMTLGILPVVMAALTVLRYNNMDPESRPTNTKTDKVTAAMLGILPVVMAALTVLRYNNMDPESRPTNTKTLLRAYDFIVIGAGSAGAVVANRLSENPDWKILLIEAGGDENEISDIPSLAGYLQLSELDWKYKTEPPMGDSAYCLAMVGDRCNWPRGKVLGGSSVLNAMIYVRGNKNDYDQWERLGNPGWGYKDVLPYFKKSEDNRNEYLLRTPYHSKGGYLTVQESPWHSPLAAAFVKAGEELGYENRDINGERQTGFMIAQGTIRRGSRCSTSKAFLRPIRLRKNLHIAMETQALRLLFDKSGPVPKAVGIEILRDGRKHIIRAKKEIISSAGAINSPQLLMVSGIGPEEHLQGLNIPIIKNLSVGHNLQDHVGLGGLTFIVDGPVTFKKERYQTLSVALQYILNERGPLTSLGGVEGLAFVNTKYAPSETHQGSNGIRIVFENLDKVLVIRRFSCPSCHILVLSSGIGPEEHLQGLNIPIIKNLSVGHNLQDHVGLGGLTFIVDGPVTFKKERYQTLSVALQYILNERGPLTSLGGVEGLAFVNTKYAPSGGDWPDVQFHFAPSSVNSDGGEQIRKILGLRDRIFNTLYKPLINAETWTILPLLLRPLSTGNGIRIVFENLDKVLVIRRFSCPSCHILVLSSGIGPEEHLQGLNIPIIKNLSVGHNLQDHVGLGGLTFIVDGPVTFKKERYQVLLCLSERTDDSTYSTYTNTLFPRYIRLQSKNPLHYPLIEPNYFQHRRDIETLIEGIRIAFNVSASAAFKKYIRLQSKNPLHYPLIEPNYFQHRRDIETLIEGIRIAFNVSASAAFQKYNSRPLLTPMPGCAMFELFSDEYWECSLRHFTFTIYHPTSTCKMGPPTDPEAVVDPRLRVYGVDGLRVIDASIMPIIVSGNPNAPTIMIGEKGADMTSRYTIRPALMGPATDLEAVVDPRLRVYGVDGLRVIDASIMPIIVSGNPNAPTIMIGEKGADMKQSYLDQEEEGDPGSEQINLKEEDAENRTQWRNGVKKPSKLPAMSIKISADSGHLKFDTQM

cccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEcccHHHHHHHHccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccHHHHHHHHHcccccccHHHHHHcccccccccccHHHHHHccccccccccccccccccccEEEEccccccHHHHHHHHHHHHccccccccccccccccccccEEcccccccccccccccccccccccEEEcccEEEEEEEcccccccEEEEEEEEEccEEEEEEEccEEEEEccccccHHHHHHcccccHHHHHHcccccccccccccccccccccccEEEEEcccccccHHHHHHHHHHHHHHHHcccccccccccEEEEEEEccccccccccccccEEEEEEccccccccccccccccccEEcccccccHHHHHHcccccEEccccccccccccccccEEEEEcccccccHHHHHHHHHHHHHHHccccccccccccccccEEEccccccccccccccccccccccccccccEEEEEcccHHHHHHHccccccccccEEEEEEcccccEEEccEEEEEEEcccEEEEcccccccHHHHHHHcccccHHHHHccccccEEccccccccccccccccEEEEEcccccHHHHHHHHHHHHHHcccccccccccccEEEEEccccccccccccccccEEccccccccccccccEEEEEEcccccccEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccEEcccccEEEEccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccEEEEccccEEEEcccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccc

cccccHHHHHHHHccHHHHcccHHHHHHHHHHEEHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHcccEEEEEEcccHHHHHHHHHcccccccEEEEEEcccccccEEEcHHHHHHcccccccEEEEEccccccccEHHHccccEcccccccEEccccHHHEEEEEEccHHHHHHHHHcccccccHHHHHHHHHHHcccccccccccccccccccEEEcccccccHHHHHHHHHHHHccccccccccccccccccccEEEccccEccHHHHHHHHHHcccccEEEEEEEEEEEEEcccccEEEEEEEEEEEccEEEEEEEEEEEEEccHHHHHHHHHHHccEEcHHHHHHccccccEcccccEEEEcHHHccEEEEEEcccEEccccHHHHHHHHHHHHHHcccccccccccEEEEEEEcccccccccEEEEEccEEEcccccEEEEEEEEEccccccccccccEEccccccccccEEEcccccccccccEEEEEEEEEEcccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHcccccccccHHHcccccHHHHHHHHHHHHcccccEEEEEEEcccccEEEEEEEEcccEEEEEccccccccccHEEEEcccccHHHHHHccccEEEcccccHHHHHHHEEEEEEEEccccEEcccccHHHHHHHHHHHHHcccccccccHHcHHHEEEcccccccccEEEEEEcccccccccccccccEEEEEEcccccEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHccccccccccccccccccccHHHHHHHHHHHccccccccccccccccHHHcccEccccEEcccEcEEEccccccccccccccccHHHHHHHHHHHHHHcccccccccccccHHcccEccccEEcccEcEEEcccccccccccccccccEEEEEccHHHHHHHccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccEcccc

mapvlpalgslltgsgwmtlgILPVVMAALTVLRynnmdpesrptntktdkVTAAMLGILPVVMAALTVLrynnmdpesrptntkTLLRAYDFIVIGAGSAGAVVANrlsenpdwKILLIEaggdeneisdipslagylqlseldwkykteppmgdsAYCLAMVGdrcnwprgkvlggsSVLNAMIYVRGnkndydqwerlgnpgwgykdvlpyfkksednrneyllrtpyhskggyltvqespwhspLAAAFVKAGeelgyenrdingerqtgfmiaqgtirrgsrcstskaflRPIRLRKNLHIAMETQALRLLfdksgpvpkaVGIEILRDGRKHIIRAKKEIIssagainspqllmvsgigpeehlqglnipiiknlsvghnlqdhvglggltfivdgpvtfkkERYQTLSVALQYILNergpltslggveglafvntkyapsethqgsngiRIVFENLDKVLVIRRfscpschilvlssgigpeehlqglnipiiknlsvghnlqdhvglggltfivdgpvtfkkERYQTLSVALQYILNergpltslggveglafvntkyapsggdwpdvqfhfapssvnsdggeQIRKILGLRDRIFNTLykplinaetwtilplllrplstgngiRIVFENLDKVLVIRRfscpschilvlssgigpeehlqglnipiiknlsvghnlqdhvglggltfivdgpvtfkKERYQVLLCLsertddstystytntlfpryirlqsknplhypliepnyfqhRRDIETLIEGIRIAFNVSASAAFKKYIRLqsknplhypliepnyfqhRRDIETLIEGIRIAFNVSASAAFqkynsrplltpmpgcamfeLFSDEYWECSLRHFtftiyhptstckmgpptdpeavvdprlrvygvdglrvidasimpiivsgnpnaptimigekgadmtsrytirpalmgpatdleavvdprlrvygvdglrvidasimpiivsgnpnaptimigekgadmkqsyldqeeegdpgseqinlkeedaenrtqwrngvkkpsklpamsikisadsghlkfdtqm

MAPVLPALGSLLTGSGWMTLGILPVVMAALTVLRYnnmdpesrptntktdkVTAAMLGILPVVMAALTVLRYnnmdpesrptntKTLLRAYDFIVIGAGSAGAVVANRLSENPDWKILLIEAGGDENEISDIPSLAGYLQLSELDWKYKTEPPMGDSAYCLAMVGDRCNWPRGKVLGGSSVLNAMIYVRGNKNDYDQWERLGNPGWGYKDVLPYFKKSEDNRNEYLLRTPYHSKGGYLTVQESPWHSPLAAAFVKAGEELGYenrdingerqtgfmiaqgtirrgsrcstskaFLRPIRLRKNLHIAMETQALrllfdksgpvPKAVGIEILRDGRKHIIRAKKEiissagainspQLLMVSGIGPEEHLQGLNIPIIKNLSVGHNLQDHVGLGGLTFIVDGPVTFKKERYQTLSVALQYILNERGPLTSLGGVEGLAFVNTKYApsethqgsngiRIVFENLDKVLVIRRFSCPSCHILVLSSGIGPEEHLQGLNIPIIKNLSVGHNLQDHVGLGGLTFIVDGPVTFKKERYQTLSVALQYILNERGPLTSLGGVEGLAFVNTKYAPSGGDWPDVQFHFApssvnsdggeQIRKILGLRDRIFNTLYKPLINAETWTILPLLLRPLSTGNGIRIVFENLDKVLVIRRFSCPSCHILVLSSGIGPEEHLQGLNIPIIKNLSVGHNLQDHVGLGGLTFIVDGPVTFKKERYQVLLClsertddstystYTNTLFPRYIRLQSKNPLHYPLIEPNYFQHRRDIETLIEGIRIAFNVSASAAFKKYIRLQSKNPLHYPLIEPNYFQHRRDIETLIEGIRIAFNVSASAAFQKYNSRPLLTPMPGCAMFELFSDEYWECSLRHFTFTIYHPTSTCKMGPPTDPEAVVDPRLRVYGVDGLRVIDAsimpiivsgnpnaPTIMIGEKGADMTSRYTIRPAlmgpatdleavvdPRLRVYGVDGLRVIDASIMPIIVSGNPNAPTIMIGEKGADMKQSYLDQEEEgdpgseqinlkeedaenrtqwrngvkkpsklpamsikisadsghlkfdtqm

MAPVLPALGSLLTGSGWMTLGILPVVMAALTVLRYNNMDPESRPTNTKTDKVTAAMLGILPVVMAALTVLRYNNMDPESRPTNTKTLLRAYDFivigagsagavvaNRLSENPDWKILLIEAGGDENEISDIPSLAGYLQLSELDWKYKTEPPMGDSAYCLAMVGDRCNWPRGKVLGGSSVLNAMIYVRGNKNDYDQWERLGNPGWGYKDVLPYFKKSEDNRNEYLLRTPYHSKGGYLTVQESPWHSPLAAAFVKAGEELGYENRDINGERQTGFMIAQGTIRRGSRCSTSKAFLRPIRLRKNLHIAMETQALRLLFDKSGPVPKAVGIEILRDGRKHIIRAKKEIISSAGAINSPQLLMVSGIGPEEHLQGLNIPIIKNLSVGHNLQDHVGLGGLTFIVDGPVTFKKERYQTLSVALQYILNERGPLTSLGGVEGLAFVNTKYAPSETHQGSNGIRIVFENLDKVLVIRRFSCPSCHILVLSSGIGPEEHLQGLNIPIIKNLSVGHNLQDHVGLGGLTFIVDGPVTFKKERYQTLSVALQYILNERGPLTSLGGVEGLAFVNTKYAPSGGDWPDVQFHFAPSSVNSDGGEQIRKILGLRDRIFNTLYKPLINAETWTILPLLLRPLSTGNGIRIVFENLDKVLVIRRFSCPSCHILVLSSGIGPEEHLQGLNIPIIKNLSVGHNLQDHVGLGGLTFIVDGPVTFKKERYQVLLCLSERtddstystytNTLFPRYIRLQSKNPLHYPLIEPNYFQHRRDIETLIEGIRIAFNVSASAAFKKYIRLQSKNPLHYPLIEPNYFQHRRDIETLIEGIRIAFNVSASAAFQKYNSRPLLTPMPGCAMFELFSDEYWECSLRHFTFTIYHPTSTCKMGPPTDPEAVVDPRLRVYGVDGLRVIDASIMPIIVSGNPNAPTIMIGEKGADMTSRYTIRPALMGPATDLEAVVDPRLRVYGVDGLRVIDASIMPIIVSGNPNAPTIMIGEKGADMKQSYLDQEEEGDPGSEQINLKEEDAENRTQWRNGVKKPSKLPAMSIKISADSGHLKFDTQM

*****PALGSLLTGSGWMTLGILPVVMAALTVLRYNN*************KVTAAMLGILPVVMAALTVLRYNNM********TKTLLRAYDFIVIGAGSAGAVVANRLSENPDWKILLIEAGGDENEISDIPSLAGYLQLSELDWKYKTEPPMGDSAYCLAMVGDRCNWPRGKVLGGSSVLNAMIYVRGNKNDYDQWERLGNPGWGYKDVLPYFKKSEDNRNEYLLRTPYHSKGGYLTVQESPWHSPLAAAFVKAGEELGYENRDINGERQTGFMIAQGTIRRGSRCSTSKAFLRPIRLRKNLHIAMETQALRLLFDKSGPVPKAVGIEILRDGRKHIIRAKKEIISSAGAINSPQLLMVSGIGPEEHLQGLNIPIIKNLSVGHNLQDHVGLGGLTFIVDGPVTFKKERYQTLSVALQYILNERGPLTSLGGVEGLAFVNTKYAPSETHQGSNGIRIVFENLDKVLVIRRFSCPSCHILVLSSGIGPEEHLQGLNIPIIKNLSVGHNLQDHVGLGGLTFIVDGPVTFKKERYQTLSVALQYILNERGPLTSLGGVEGLAFVNTKYAPSGGDWPDVQFHFAPSSVNSDGGEQIRKILGLRDRIFNTLYKPLINAETWTILPLLLRPLSTGNGIRIVFENLDKVLVIRRFSCPSCHILVLSSGIGPEEHLQGLNIPIIKNLSVGHNLQDHVGLGGLTFIVDGPVTFKKERYQVLLCLSERTDDSTYSTYTNTLFPRYIRLQSKNPLHYPLIEPNYFQHRRDIETLIEGIRIAFNVSASAAFKKYIRLQSKNPLHYPLIEPNYFQHRRDIETLIEGIRIAFNVSASAAFQKYNSRPLLTPMPGCAMFELFSDEYWECSLRHFTFTIYHPTSTCKMG****PEAVVDPRLRVYGVDGLRVIDASIMPIIVSGNPNAPTIMIGEKGADMTSRYTIRPALMGPATDLEAVVDPRLRVYGVDGLRVIDASIMPIIVSGNPNAPTIM*********************************************************************

**PVLPALGSLLTGSGWMTLGILPVVMAALTVLRYNNMDPESRPTNTKTDKVTAAMLGILPVVMAALTVLRYNNM**********TLLRAYDFIVIGAGSAGAVVANRLSENPDWKILLIEAGGDENEISDIPSLAGYLQLSELDWKYKTEPPMGDSAYCLAMVGDRCNWPRGKVLGGSSVLNAMIYVRGNKNDYDQWERLGNPGWGYKDVLPYFKKSEDNRNEYLLRTPYHSKGGYLTVQESPWHSPLAAAFVKAGEELGYENRDINGERQTGFMIAQGTIRRGSRCSTSKAFLRPIRLRKNLHIAMETQALRLLFDKSGPVPKAVGIEILRDGRKHIIRAKKEIISSAGAINSPQLLMVSGIGPEEHLQGLNIPIIKNLSVGHNLQDHVGLGGLTFIVDGPVTFKKERYQTLSVALQYILNERGPLTSLGGVEGLAFVNTKYAPSETHQGSNGIRIVFENLDKVLVIRRFSCPSCHILVLSSGIGPEEHLQGLNIPIIKNLSVGHNLQDHVGLGGLTFIVDGPVTFKKERYQTLSVALQYILNERGPLTSLGGVEGLAFVNTKYAPSGGDWPDVQFHFAPSSVNSDGGEQIRKILGLRDRIFNTLYKPLINAETWTILPLLLRPLSTGNGIRIVFENLDKVLVIRRFSCPSCHILVLSSGIGPEEHLQGLNIPIIKNLSVGHNLQDHVGLGGLTFIVDGPVTFKKERYQVLLCLSERTDDSTYSTYTNTLFPRYIRLQSKNPLHYPLIEPNYFQHRRDIETLIEGIRIAFNVSASAAFKKYIRLQSKNPLHYPLIEPNYFQHRRDIETLIEGIRIAFNVSASAAFQKYNSRPLLTPMPGCAMFELFSDEYWECSLRHFTFTIYHPTSTCKMGPPTDPEAVVDPRLRVYGVDGLRVIDASIMPIIVSGNPNAPTIMIGEKGADMTSRYTIRPALMGPATDLEAVVDPRLRVYGVDGLRVIDASIMPIIVSGNPNAPTIMIGEKGADMKQSYL*********************************************DSGHLKFD***

MAPVLPALGSLLTGSGWMTLGILPVVMAALTVLRYNNMDPESRPTNTKTDKVTAAMLGILPVVMAALTVLRYNNMDPESRPTNTKTLLRAYDFIVIGAGSAGAVVANRLSENPDWKILLIEAGGDENEISDIPSLAGYLQLSELDWKYKTEPPMGDSAYCLAMVGDRCNWPRGKVLGGSSVLNAMIYVRGNKNDYDQWERLGNPGWGYKDVLPYFKKSEDNRNEYLLRTPYHSKGGYLTVQESPWHSPLAAAFVKAGEELGYENRDINGERQTGFMIAQGTIRRGSRCSTSKAFLRPIRLRKNLHIAMETQALRLLFDKSGPVPKAVGIEILRDGRKHIIRAKKEIISSAGAINSPQLLMVSGIGPEEHLQGLNIPIIKNLSVGHNLQDHVGLGGLTFIVDGPVTFKKERYQTLSVALQYILNERGPLTSLGGVEGLAFVNTKYAPSETHQGSNGIRIVFENLDKVLVIRRFSCPSCHILVLSSGIGPEEHLQGLNIPIIKNLSVGHNLQDHVGLGGLTFIVDGPVTFKKERYQTLSVALQYILNERGPLTSLGGVEGLAFVNTKYAPSGGDWPDVQFHFAPSSVNSDGGEQIRKILGLRDRIFNTLYKPLINAETWTILPLLLRPLSTGNGIRIVFENLDKVLVIRRFSCPSCHILVLSSGIGPEEHLQGLNIPIIKNLSVGHNLQDHVGLGGLTFIVDGPVTFKKERYQVLLCLSERTDDSTYSTYTNTLFPRYIRLQSKNPLHYPLIEPNYFQHRRDIETLIEGIRIAFNVSASAAFKKYIRLQSKNPLHYPLIEPNYFQHRRDIETLIEGIRIAFNVSASAAFQKYNSRPLLTPMPGCAMFELFSDEYWECSLRHFTFTIYHPTSTCKMGPPTDPEAVVDPRLRVYGVDGLRVIDASIMPIIVSGNPNAPTIMIGEKGADMTSRYTIRPALMGPATDLEAVVDPRLRVYGVDGLRVIDASIMPIIVSGNPNAPTIMIGEKGADMK**************EQINLKEEDAENRTQWRNGVKKPSKLPAMSIKISADSGHLKFDTQM

*APVLPALGSLLTGSGWMTLGILPVVMAALTVLRYNNMDPESRPTNTKTDKVTAAMLGILPVVMAALTVLRYNNMDPESRPTNTKTLLRAYDFIVIGAGSAGAVVANRLSENPDWKILLIEAGGDENEISDIPSLAGYLQLSELDWKYKTEPPMGDSAYCLAMVGDRCNWPRGKVLGGSSVLNAMIYVRGNKNDYDQWERLGNPGWGYKDVLPYFKKSEDNRNEYLLRTPYHSKGGYLTVQESPWHSPLAAAFVKAGEELGYENRDINGERQTGFMIAQGTIRRGSRCSTSKAFLRPIRLRKNLHIAMETQALRLLFDKSGPVPKAVGIEILRDGRKHIIRAKKEIISSAGAINSPQLLMVSGIGPEEHLQGLNIPIIKNLSVGHNLQDHVGLGGLTFIVDGPVTFKKERYQTLSVALQYILNERGPLTSLGGVEGLAFVNTKYAPSETHQGSNGIRIVFENLDKVLVIRRFSCPSCHILVLSSGIGPEEHLQGLNIPIIKNLSVGHNLQDHVGLGGLTFIVDGPVTFKKERYQTLSVALQYILNERGPLTSLGGVEGLAFVNTKYAPSGGDWPDVQFHFAPSSVNSDGGEQIRKILGLRDRIFNTLYKPLINAETWTILPLLLRPLSTGNGIRIVFENLDKVLVIRRFSCPSCHILVLSSGIGPEEHLQGLNIPIIKNLSVGHNLQDHVGLGGLTFIVDGPVTFKKERYQVLLCLSERTDDSTYSTYTNTLFPRYIRLQSKNPLHYPLIEPNYFQHRRDIETLIEGIRIAFNVSASAAFKKYIRLQSKNPLHYPLIEPNYFQHRRDIETLIEGIRIAFNVSASAAFQKYNSRPLLTPMPGCAMFELFSDEYWECSLRHFTFTIYHPTSTCKMGPPTDPEAVVDPRLRVYGVDGLRVIDASIMPIIVSGNPNAPTIMIGEKGADMTSRYTIRPALMGPATDLEAVVDPRLRVYGVDGLRVIDASIMPIIVSGNPNAPTIMIGEKGADMKQSYLDQEEEGDPGS***************W*NGVKKPSKLPAMSIKISADSGHLK*****

iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		1049	2.2.26 [Sep-21-2011]
P18173		625	Glucose dehydrogenase [ac	no	N/A	0.367	0.616	0.455	3e-88
P18172		625	Glucose dehydrogenase [ac	no	N/A	0.366	0.614	0.446	3e-87
Q6UPE0		599	Choline dehydrogenase, mi	yes	N/A	0.273	0.479	0.416	1e-57
Q8BJ64		596	Choline dehydrogenase, mi	yes	N/A	0.273	0.481	0.413	2e-57
P64264		528	Uncharacterized GMC-type	yes	N/A	0.311	0.619	0.392	4e-57
P64263		528	Uncharacterized GMC-type	yes	N/A	0.311	0.619	0.392	4e-57
Q8NE62		594	Choline dehydrogenase, mi	yes	N/A	0.273	0.483	0.413	1e-55
A6U6Y8		549	Choline dehydrogenase OS=	no	N/A	0.271	0.519	0.401	3e-54
Q1MJU4		549	Choline dehydrogenase OS=	no	N/A	0.271	0.519	0.407	3e-54
Q985M5		550	Choline dehydrogenase OS=	no	N/A	0.273	0.521	0.408	4e-54

>sp\|P18173\|DHGL_DROME Glucose dehydrogenase [acceptor] OS=Drosophila melanogaster GN=Gld PE=3 SV=3	Back alignment and function desciption

 Score =  327 bits (838), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 189/415 (45%), Positives = 253/415 (60%), Gaps = 30/415 (7%)

Query: 44  PTNTKTDKVTAAMLGILPVVMAALTVLRYNNMDPESRPTNTKTLLRA-----YDFIVIGA 98
           PT   T   +A ML      M  L V   +  D E       +  R+     YDFIVIG 
Sbjct: 18  PTLASTCGGSAFML-----FMGLLEVFIRSQCDLEDPCGRASSRFRSEPDYEYDFIVIGG 72

Query: 99  GSAGAVVANRLSENPDWKILLIEAGGDENEISDIPSLAGYLQLSELDWKYKTEP-PMGDS 157
           GSAG+VVA+RLSE P WK+LLIEAGGDE   + IPS+      S++D++Y TEP PM   
Sbjct: 73  GSAGSVVASRLSEVPQWKVLLIEAGGDEPVGAQIPSMFLNFIGSDIDYRYNTEPEPMA-- 130

Query: 158 AYCLAMVGDRCNWPRGKVLGGSSVLNAMIYVRGNKNDYDQWERLGNPGWGYKDVLPYFKK 217
             CL+ +  RC WPRGKVLGG+SVLN M+YVRGN+ DYD W   GNPGW Y DVLP+FKK
Sbjct: 131 --CLSSMEQRCYWPRGKVLGGTSVLNGMMYVRGNREDYDDWAADGNPGWAYNDVLPFFKK 188

Query: 218 SEDNRNEYLLRTPYHSKGGYLTVQESPWHSPLAAAFVKAGEELGYENRDINGERQTGFMI 277
           SEDN +   + T YH+KGG L V + P++ PL+ A +KAGEELG+   D+NG+  TGFMI
Sbjct: 189 SEDNLDLDEVGTEYHAKGGLLPVGKFPYNPPLSYAILKAGEELGFSVHDLNGQNSTGFMI 248

Query: 278 AQGTIRRGSRCSTSKAFLRPIRLRKNLHIAMETQALRLLFDKSGPVPKAVGIEILRD-GR 336
           AQ T R G R S+++AFLRP R+R NLHI + T A ++L          +G+E+    G 
Sbjct: 249 AQMTARNGIRYSSARAFLRPARMRNNLHILLNTTATKILIHPH--TKNVLGVEVSDQFGS 306

Query: 337 KHIIRAKKEIISSAGAINSPQLLMVSGIGPEEHLQGLNIPIIKNL-SVGHNLQDHVGLGG 395
              I  KKE++ SAGA+NSP +L++SG+GP++ LQ +N+  + NL  VG NL +HV    
Sbjct: 307 TRKILVKKEVVLSAGAVNSPHILLLSGVGPKDELQQVNVRTVHNLPGVGKNLHNHVTYFT 366

Query: 396 LTFIVD---GPVTFKKERYQTLSVALQYILNERGPLTSLGGVEGLAFVNTKYAPS 447
             FI D    P+ +        + A++Y+L   G ++  G  +  A + T+YA S
Sbjct: 367 NFFIDDADTAPLNW--------ATAMEYLLFRDGLMSGTGISDVTAKLATRYADS 413

Essential for cuticular modification during development.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 1EC: .EC: 9EC: 9EC: .EC: 1EC: 0

>sp\|P18172\|DHGL_DROPS Glucose dehydrogenase [acceptor] OS=Drosophila pseudoobscura pseudoobscura GN=Gld PE=3 SV=4	Back alignment and function description

>sp\|Q6UPE0\|CHDH_RAT Choline dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Chdh PE=1 SV=1	Back alignment and function description

>sp\|Q8BJ64\|CHDH_MOUSE Choline dehydrogenase, mitochondrial OS=Mus musculus GN=Chdh PE=1 SV=1	Back alignment and function description

>sp\|P64264\|Y1310_MYCBO Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1310 PE=3 SV=1	Back alignment and function description

>sp\|P64263\|Y1279_MYCTU Uncharacterized GMC-type oxidoreductase Rv1279/MT1316 OS=Mycobacterium tuberculosis GN=Rv1279 PE=3 SV=1	Back alignment and function description

>sp\|Q8NE62\|CHDH_HUMAN Choline dehydrogenase, mitochondrial OS=Homo sapiens GN=CHDH PE=2 SV=2	Back alignment and function description

>sp\|A6U6Y8\|BETA_SINMW Choline dehydrogenase OS=Sinorhizobium medicae (strain WSM419) GN=betA PE=3 SV=1	Back alignment and function description

>sp\|Q1MJU4\|BETA_RHIL3 Choline dehydrogenase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=betA PE=3 SV=1	Back alignment and function description

>sp\|Q985M5\|BETA_RHILO Choline dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=betA PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1049
383860468		621	PREDICTED: glucose dehydrogenase [accept	0.369	0.624	0.701	1e-165
156551752		615	PREDICTED: glucose dehydrogenase [accept	0.368	0.629	0.687	1e-164
48094605		612	PREDICTED: glucose dehydrogenase [accept	0.364	0.624	0.679	1e-159
189238523		624	PREDICTED: similar to glucose dehydrogen	0.370	0.623	0.645	1e-157
270009082		622	hypothetical protein TcasGA2_TC015717 [T	0.370	0.625	0.645	1e-157
322796408		612	hypothetical protein SINV_07596 [Solenop	0.389	0.668	0.636	1e-157
307172020		626	Glucose dehydrogenase [acceptor] [Campon	0.364	0.610	0.673	1e-156
242018478		621	glucose dehydrogenase precursor, putativ	0.371	0.628	0.673	1e-156
328785230		625	PREDICTED: glucose dehydrogenase [accept	0.365	0.612	0.661	1e-156
242018476		630	glucose dehydrogenase precursor, putativ	0.370	0.617	0.654	1e-155

>gi\|383860468\|ref\|XP_003705711.1\| PREDICTED: glucose dehydrogenase [acceptor]-like [Megachile rotundata]	Back alignment and taxonomy information

 Score =  589 bits (1519), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 277/395 (70%), Positives = 330/395 (83%), Gaps = 7/395 (1%)

Query: 53  TAAMLG--ILPVVMAALTVLRYNNMDPESRPTNTKTLLRAYDFIVIGAGSAGAVVANRLS 110
           T ++LG  ++P++   LTV RYN  DPES P++ + LLR YDFIVIG GSAGAV+A+RLS
Sbjct: 11  TTSVLGFSLIPLLAIGLTVFRYNQADPESHPSDARQLLRMYDFIVIGGGSAGAVIASRLS 70

Query: 111 ENPDWKILLIEAGGDENEISDIPSLAGYLQLSELDWKYKTEPPMGDSAYCLAMVGDRCNW 170
           E  +W +LL+EAGGDENEISD+P LAGY QLSE DWKY+T PP   SAYCLAM+GDRCNW
Sbjct: 71  EVSNWTVLLVEAGGDENEISDVPLLAGYTQLSEFDWKYQTSPPTV-SAYCLAMIGDRCNW 129

Query: 171 PRGKVLGGSSVLNAMIYVRGNKNDYDQWERLGNPGWGYKDVLPYFKKSEDNRNEYLLRTP 230
           PRGKVLGGSSVLNAMIYVRGN+ DYD WE LGN GW Y DV PYF KSEDNRN YL RTP
Sbjct: 130 PRGKVLGGSSVLNAMIYVRGNRRDYDTWESLGNVGWSYNDVFPYFLKSEDNRNPYLARTP 189

Query: 231 YHSKGGYLTVQESPWHSPLAAAFVKAGEELGYENRDINGERQTGFMIAQGTIRRGSRCST 290
           YHS GGYLTVQESPW +PL+ AF++AG+ELGYENRDING  QTGFM+ Q TIRRGSRCST
Sbjct: 190 YHSTGGYLTVQESPWRTPLSIAFLQAGQELGYENRDINGANQTGFMLTQATIRRGSRCST 249

Query: 291 SKAFLRPIRLRKNLHIAMETQALRLLFDKSGPVPKAVGIEILRDGRKHIIRAKKEIISSA 350
           +KAFLRP++ R+NLHIAM +QALR+LF+      +A G+EILRDGR+ +IR ++EI+ SA
Sbjct: 250 AKAFLRPVKNRENLHIAMHSQALRVLFNDD---KRATGVEILRDGRQQVIRVRREIVLSA 306

Query: 351 GAINSPQLLMVSGIGPEEHLQGLNIPIIKNLSVGHNLQDHVGLGGLTFIVDGPVTFKKER 410
           GAINSPQLLM+SGIGP EHL+  NIP+I +L VG NLQDHVGLGG TF+V+ P++ KK+R
Sbjct: 307 GAINSPQLLMLSGIGPREHLEEFNIPVISDLRVGDNLQDHVGLGGFTFVVNEPISLKKDR 366

Query: 411 YQTLSVALQYILNERGPLTSLGGVEGLAFVNTKYA 445
           +QT+SV ++Y+LNERGP+TS  GVEGLAFVNTKYA
Sbjct: 367 FQTMSVMMEYVLNERGPMTS-PGVEGLAFVNTKYA 400

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom:

>gi\|156551752\|ref\|XP_001602133.1\| PREDICTED: glucose dehydrogenase [acceptor]-like [Nasonia vitripennis]	Back alignment and taxonomy information

>gi\|48094605\|ref\|XP_394221.1\| PREDICTED: glucose dehydrogenase [acceptor] [Apis mellifera]	Back alignment and taxonomy information

>gi\|189238523\|ref\|XP_972430.2\| PREDICTED: similar to glucose dehydrogenase [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|270009082\|gb\|EFA05530.1\| hypothetical protein TcasGA2_TC015717 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|322796408\|gb\|EFZ18942.1\| hypothetical protein SINV_07596 [Solenopsis invicta]	Back alignment and taxonomy information

>gi\|307172020\|gb\|EFN63614.1\| Glucose dehydrogenase [acceptor] [Camponotus floridanus]	Back alignment and taxonomy information

>gi\|242018478\|ref\|XP_002429702.1\| glucose dehydrogenase precursor, putative [Pediculus humanus corporis] gi\|212514705\|gb\|EEB16964.1\| glucose dehydrogenase precursor, putative [Pediculus humanus corporis]	Back alignment and taxonomy information

>gi\|328785230\|ref\|XP_003250566.1\| PREDICTED: glucose dehydrogenase [acceptor]-like isoform 1 [Apis mellifera] gi\|328785232\|ref\|XP_003250567.1\| PREDICTED: glucose dehydrogenase [acceptor]-like isoform 2 [Apis mellifera] gi\|328785234\|ref\|XP_003250568.1\| PREDICTED: glucose dehydrogenase [acceptor]-like isoform 3 [Apis mellifera]	Back alignment and taxonomy information

>gi\|242018476\|ref\|XP_002429701.1\| glucose dehydrogenase precursor, putative [Pediculus humanus corporis] gi\|212514704\|gb\|EEB16963.1\| glucose dehydrogenase precursor, putative [Pediculus humanus corporis]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1049
FB\|FBgn0030590		703	CG9518 [Drosophila melanogaste	0.370	0.553	0.591	1.3e-178
FB\|FBgn0030598		626	CG9503 [Drosophila melanogaste	0.371	0.623	0.592	1.3e-176
FB\|FBgn0030591		865	CG9517 [Drosophila melanogaste	0.350	0.425	0.601	1.1e-174
FB\|FBgn0030592		726	CG9514 [Drosophila melanogaste	0.373	0.539	0.503	6.8e-157
FB\|FBgn0039415		616	CG6142 [Drosophila melanogaste	0.340	0.579	0.452	8.6e-117
FB\|FBgn0001112		625	Gld "Glucose dehydrogenase" [D	0.328	0.552	0.468	9e-111
FB\|FBgn0030588		621	CG9521 [Drosophila melanogaste	0.350	0.592	0.430	1.5e-110
FB\|FBgn0030589		622	CG9519 [Drosophila melanogaste	0.348	0.588	0.423	1.9e-110
FB\|FBgn0030596		633	CG12398 [Drosophila melanogast	0.318	0.527	0.431	2.5e-108
FB\|FBgn0030587		616	CG9522 [Drosophila melanogaste	0.339	0.577	0.416	7.5e-105

FB\|FBgn0030590 CG9518 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 1258 (447.9 bits), Expect = 1.3e-178, Sum P(3) = 1.3e-178
 Identities = 233/394 (59%), Positives = 297/394 (75%)

Query:    52 VTAAMLGILPVVMAALTVLRYNNMDPESRPTNTKTLLRAYDFXXXXXXXXXXXXXNRLSE 111
             V    L ++P+++AA+T  RY+ +DPESRP +   L   YDF             NRLSE
Sbjct:    18 VVTTGLWLIPLMLAAITYYRYDAVDPESRPLDQLNLYPEYDFIVVGSGSAGAVVANRLSE 77

Query:   112 NPDWKILLIEAGGDENEISDIPSLAGYLQLSELDWKYKTEPPMGDSAYCLAMVGDRCNWP 171
                WK+LLIEAG DENEISD+PSLA YLQLS+LDW YKTEP    +  CL M  +RCNWP
Sbjct:    78 VRKWKVLLIEAGPDENEISDVPSLAAYLQLSKLDWAYKTEP---STKACLGMQNNRCNWP 134

Query:   172 RGKVLGGSSVLNAMIYVRGNKNDYDQWERLGNPGWGYKDVLPYFKKSEDNRNEYLLRTPY 231
             RG+VLGGSSVLN M+YVRGN++DYD W  LGNPGW Y +VL YFKKSEDNRN YL    Y
Sbjct:   135 RGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDNVLRYFKKSEDNRNPYLANNKY 194

Query:   232 HSKGGYLTVQESPWHSPLAAAFVKAGEELGYENRDINGERQTGFMIAQGTIRRGSRCSTS 291
             H +GG LTVQESPWHSPL AAFV+AG +LGY+NRDING +Q GFMIAQGTIRRGSRCST+
Sbjct:   195 HGRGGLLTVQESPWHSPLVAAFVEAGTQLGYDNRDINGAKQAGFMIAQGTIRRGSRCSTA 254

Query:   292 KAFLRPIRLRKNLHIAMETQALRLLFDKSGPVPKAVGIEILRDGRKHIIRAKKEIISSAG 351
             KAFLRPIR+RKN H++M +   R++ +  G + +A  +E ++ G+ + I A++E+I SAG
Sbjct:   255 KAFLRPIRMRKNFHLSMNSHVTRVIIEP-GTM-RAQAVEFVKHGKVYRIAARREVIISAG 312

Query:   352 AINSPQLLMVSGIGPEEHLQGLNIPIIKNLSVGHNLQDHVGLGGLTFIVDGPVTFKKERY 411
             AIN+PQL+M+SG+GP +HL+   I ++++L VG N+QDHVG+GGLTF+VD PV   ++R+
Sbjct:   313 AINTPQLMMLSGLGPRKHLEKHGIRVLQDLPVGENMQDHVGMGGLTFLVDKPVAIVQDRF 372

Query:   412 QTLSVALQYILNERGPLTSLGGVEGLAFVNTKYA 445
                +V  QY+L ERGP+T+LGGVEGLAFV+T Y+
Sbjct:   373 NPTAVTFQYVLRERGPMTTLGGVEGLAFVHTPYS 406

GO:0008812 "choline dehydrogenase activity" evidence=ISS

GO:0006066 "alcohol metabolic process" evidence=IEA

GO:0055114 "oxidation-reduction process" evidence=IEA

GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA

GO:0046331 "lateral inhibition" evidence=IMP

FB\|FBgn0030598 CG9503 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0030591 CG9517 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0030592 CG9514 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0039415 CG6142 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0001112 Gld "Glucose dehydrogenase" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0030588 CG9521 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0030589 CG9519 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0030596 CG12398 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0030587 CG9522 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	1.1.99	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		1049
PRK02106		560	PRK02106, PRK02106, choline dehydrogenase; Validat	1e-97
COG2303		542	COG2303, BetA, Choline dehydrogenase and related f	2e-81
TIGR01810		532	TIGR01810, betA, choline dehydrogenase	6e-75
TIGR03970		487	TIGR03970, Rv0697, dehydrogenase, Rv0697 family	3e-54
pfam00732		218	pfam00732, GMC_oxred_N, GMC oxidoreductase	1e-49
pfam05199		139	pfam05199, GMC_oxred_C, GMC oxidoreductase	1e-45
PRK02106		560	PRK02106, PRK02106, choline dehydrogenase; Validat	5e-39
COG2303		542	COG2303, BetA, Choline dehydrogenase and related f	5e-36
TIGR01810		532	TIGR01810, betA, choline dehydrogenase	7e-32
TIGR03970		487	TIGR03970, Rv0697, dehydrogenase, Rv0697 family	7e-23
PRK02106		560	PRK02106, PRK02106, choline dehydrogenase; Validat	4e-20
pfam05199		139	pfam05199, GMC_oxred_C, GMC oxidoreductase	2e-19
PLN02785		587	PLN02785, PLN02785, Protein HOTHEAD	2e-19
TIGR01810		532	TIGR01810, betA, choline dehydrogenase	3e-16
COG2303		542	COG2303, BetA, Choline dehydrogenase and related f	9e-15
PRK02106		560	PRK02106, PRK02106, choline dehydrogenase; Validat	6e-13
TIGR03970		487	TIGR03970, Rv0697, dehydrogenase, Rv0697 family	2e-10
TIGR01810		532	TIGR01810, betA, choline dehydrogenase	4e-09
COG2303		542	COG2303, BetA, Choline dehydrogenase and related f	1e-08
PLN02785		587	PLN02785, PLN02785, Protein HOTHEAD	1e-08
PRK02106		560	PRK02106, PRK02106, choline dehydrogenase; Validat	4e-05
PRK02106		560	PRK02106, PRK02106, choline dehydrogenase; Validat	6e-05
PTZ00058		561	PTZ00058, PTZ00058, glutathione reductase; Provisi	0.002
PLN02785		587	PLN02785, PLN02785, Protein HOTHEAD	0.003
COG1249		454	COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas	0.003
PRK06292		460	PRK06292, PRK06292, dihydrolipoamide dehydrogenase	0.003

>gnl\|CDD\|235000 PRK02106, PRK02106, choline dehydrogenase; Validated	Back alignment and domain information

 Score =  319 bits (820), Expect = 1e-97
 Identities = 145/309 (46%), Positives = 183/309 (59%), Gaps = 24/309 (7%)

Query: 91  YDFIVIGAGSAGAVVANRLSENPDWKILLIEAGGDENEIS---DIPS-LAGYLQLSELDW 146
           YD+I+IGAGSAG V+ANRLSE+PD  +LL+EAGG +        +P+ LA  LQ    +W
Sbjct: 6   YDYIIIGAGSAGCVLANRLSEDPDVSVLLLEAGGPDYRWDFFIQMPAALAFPLQGKRYNW 65

Query: 147 KYKTEP-PMGDSAYCLAMVGDRCNWPRGKVLGGSSVLNAMIYVRGNKNDYDQW-ERLGNP 204
            Y+TEP P         M   R   PRGKVLGGSS +N M+Y+RGN  DYD W E  G  
Sbjct: 66  AYETEPEPH--------MNNRRMECPRGKVLGGSSSINGMVYIRGNAMDYDNWAELPGLE 117

Query: 205 GWGYKDVLPYFKKSEDNRNEYLLRTPYHSKGGYLTVQES-PWHSPLAAAFVKAGEELGYE 263
           GW Y D LPYFKK+E           Y    G L+V    P  +PL  AFV+AG + GY 
Sbjct: 118 GWSYADCLPYFKKAETRDGGE---DDYRGGDGPLSVTRGKPGTNPLFQAFVEAGVQAGYP 174

Query: 264 -NRDINGERQTGFMIAQGTIRRGSRCSTSKAFLRPIRLRKNLHIAMETQALRLLFDKSGP 322
              D+NG +Q GF     T+  G R S ++A+L P   R NL I       R+LF+    
Sbjct: 175 RTDDLNGYQQEGFGPMDRTVTNGRRWSAARAYLDPALKRPNLTIVTHALTDRILFEG--- 231

Query: 323 VPKAVGIEILRDGRKHIIRAKKEIISSAGAINSPQLLMVSGIGPEEHLQGLNIPIIKNL- 381
             +AVG+E  R G +   RA++E+I SAGAINSPQLL +SGIGP EHL+ L IP++ +L 
Sbjct: 232 -KRAVGVEYERGGGRETARARREVILSAGAINSPQLLQLSGIGPAEHLKELGIPVVHDLP 290

Query: 382 SVGHNLQDH 390
            VG NLQDH
Sbjct: 291 GVGENLQDH 299

Length = 560

>gnl\|CDD\|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|233581 TIGR01810, betA, choline dehydrogenase	Back alignment and domain information

>gnl\|CDD\|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family	Back alignment and domain information

>gnl\|CDD\|216089 pfam00732, GMC_oxred_N, GMC oxidoreductase	Back alignment and domain information

>gnl\|CDD\|218493 pfam05199, GMC_oxred_C, GMC oxidoreductase	Back alignment and domain information

>gnl\|CDD\|235000 PRK02106, PRK02106, choline dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|233581 TIGR01810, betA, choline dehydrogenase	Back alignment and domain information

>gnl\|CDD\|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family	Back alignment and domain information

>gnl\|CDD\|235000 PRK02106, PRK02106, choline dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|218493 pfam05199, GMC_oxred_C, GMC oxidoreductase	Back alignment and domain information

>gnl\|CDD\|215420 PLN02785, PLN02785, Protein HOTHEAD	Back alignment and domain information

>gnl\|CDD\|233581 TIGR01810, betA, choline dehydrogenase	Back alignment and domain information

>gnl\|CDD\|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|235000 PRK02106, PRK02106, choline dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family	Back alignment and domain information

>gnl\|CDD\|233581 TIGR01810, betA, choline dehydrogenase	Back alignment and domain information

>gnl\|CDD\|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|215420 PLN02785, PLN02785, Protein HOTHEAD	Back alignment and domain information

>gnl\|CDD\|235000 PRK02106, PRK02106, choline dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|235000 PRK02106, PRK02106, choline dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|185420 PTZ00058, PTZ00058, glutathione reductase; Provisional	Back alignment and domain information

>gnl\|CDD\|215420 PLN02785, PLN02785, Protein HOTHEAD	Back alignment and domain information

>gnl\|CDD\|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		1049
KOG1238\|consensus		623		100.0
TIGR01810		532	betA choline dehydrogenase. This enzyme is a membe	100.0
PRK02106		560	choline dehydrogenase; Validated	100.0
COG2303		542	BetA Choline dehydrogenase and related flavoprotei	100.0
PLN02785		587	Protein HOTHEAD	100.0
PF00732		296	GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001	100.0
TIGR02462		544	pyranose_ox pyranose oxidase. Pyranose oxidase (al	100.0
KOG1238\|consensus		623		99.93
PF05199		144	GMC_oxred_C: GMC oxidoreductase; InterPro: IPR0078	99.9
PF00732		296	GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001	99.63
PLN02785		587	Protein HOTHEAD	99.63
TIGR01810		532	betA choline dehydrogenase. This enzyme is a membe	99.62
PRK02106		560	choline dehydrogenase; Validated	99.61
PRK12835		584	3-ketosteroid-delta-1-dehydrogenase; Reviewed	99.51
PRK12845		564	3-ketosteroid-delta-1-dehydrogenase; Reviewed	99.49
PRK07121		492	hypothetical protein; Validated	99.47
PRK06481		506	fumarate reductase flavoprotein subunit; Validated	99.47
PRK12844		557	3-ketosteroid-delta-1-dehydrogenase; Reviewed	99.44
PRK12837		513	3-ketosteroid-delta-1-dehydrogenase; Provisional	99.43
PF00890		417	FAD_binding_2: FAD binding domain of the Pfam fami	99.41
COG2303		542	BetA Choline dehydrogenase and related flavoprotei	99.39
PRK08274		466	tricarballylate dehydrogenase; Validated	99.37
PRK06452		566	sdhA succinate dehydrogenase flavoprotein subunit;	99.34
PLN00128		635	Succinate dehydrogenase [ubiquinone] flavoprotein	99.33
PRK06175		433	L-aspartate oxidase; Provisional	99.33
PRK08958		588	sdhA succinate dehydrogenase flavoprotein subunit;	99.32
PRK07804		541	L-aspartate oxidase; Provisional	99.32
PRK12843		578	putative FAD-binding dehydrogenase; Reviewed	99.31
PRK09078		598	sdhA succinate dehydrogenase flavoprotein subunit;	99.3
PTZ00139		617	Succinate dehydrogenase [ubiquinone] flavoprotein	99.29
PRK07843		557	3-ketosteroid-delta-1-dehydrogenase; Reviewed	99.29
PLN02815		594	L-aspartate oxidase	99.29
PRK07573		640	sdhA succinate dehydrogenase flavoprotein subunit;	99.28
PRK07395		553	L-aspartate oxidase; Provisional	99.28
PRK12834		549	putative FAD-binding dehydrogenase; Reviewed	99.28
TIGR01813		439	flavo_cyto_c flavocytochrome c. This model describ	99.27
PRK06263		543	sdhA succinate dehydrogenase flavoprotein subunit;	99.25
PRK05945		575	sdhA succinate dehydrogenase flavoprotein subunit;	99.25
PTZ00306		1167	NADH-dependent fumarate reductase; Provisional	99.25
PRK12839		572	hypothetical protein; Provisional	99.24
PRK08626		657	fumarate reductase flavoprotein subunit; Provision	99.23
PRK12842		574	putative succinate dehydrogenase; Reviewed	99.23
PRK07057		591	sdhA succinate dehydrogenase flavoprotein subunit;	99.23
PRK08641		589	sdhA succinate dehydrogenase flavoprotein subunit;	99.21
PRK06134		581	putative FAD-binding dehydrogenase; Reviewed	99.21
TIGR01176		580	fum_red_Fp fumarate reductase, flavoprotein subuni	99.21
PRK09231		582	fumarate reductase flavoprotein subunit; Validated	99.2
PRK08205		583	sdhA succinate dehydrogenase flavoprotein subunit;	99.17
TIGR00551		488	nadB L-aspartate oxidase. L-aspartate oxidase is t	99.17
PRK08275		554	putative oxidoreductase; Provisional	99.17
PRK09077		536	L-aspartate oxidase; Provisional	99.17
PRK07803		626	sdhA succinate dehydrogenase flavoprotein subunit;	99.16
TIGR01812		566	sdhA_frdA_Gneg succinate dehydrogenase or fumarate	99.16
PRK06069		577	sdhA succinate dehydrogenase flavoprotein subunit;	99.15
PRK07512		513	L-aspartate oxidase; Provisional	99.14
PRK11101		546	glpA sn-glycerol-3-phosphate dehydrogenase subunit	99.14
PRK08071		510	L-aspartate oxidase; Provisional	99.14
TIGR01811		603	sdhA_Bsu succinate dehydrogenase or fumarate reduc	99.13
PRK06854		608	adenylylsulfate reductase subunit alpha; Validated	99.13
PF01266		358	DAO: FAD dependent oxidoreductase; InterPro: IPR00	99.1
PRK13800		897	putative oxidoreductase/HEAT repeat-containing pro	99.03
TIGR02061		614	aprA adenosine phosphosulphate reductase, alpha su	99.01
PF03486		409	HI0933_like: HI0933-like protein; InterPro: IPR004	98.99
COG2081		408	Predicted flavoproteins [General function predicti	98.98
PRK08401		466	L-aspartate oxidase; Provisional	98.95
COG1053		562	SdhA Succinate dehydrogenase/fumarate reductase, f	98.92
COG0579		429	Predicted dehydrogenase [General function predicti	98.91
TIGR01373		407	soxB sarcosine oxidase, beta subunit family, heter	98.9
PRK04176		257	ribulose-1,5-biphosphate synthetase; Provisional	98.9
TIGR03329		460	Phn_aa_oxid putative aminophosphonate oxidoreducta	98.9
TIGR02485		432	CobZ_N-term precorrin 3B synthase CobZ. CobZ is es	98.89
PRK12409		410	D-amino acid dehydrogenase small subunit; Provisio	98.89
PLN02661		357	Putative thiazole synthesis	98.88
TIGR00292		254	thiazole biosynthesis enzyme. This enzyme is invol	98.85
PTZ00383		497	malate:quinone oxidoreductase; Provisional	98.83
PRK00711		416	D-amino acid dehydrogenase small subunit; Validate	98.82
PRK11728		393	hydroxyglutarate oxidase; Provisional	98.81
TIGR01377		380	soxA_mon sarcosine oxidase, monomeric form. Sarcos	98.8
PLN02464		627	glycerol-3-phosphate dehydrogenase	98.8
TIGR01320		483	mal_quin_oxido malate:quinone-oxidoreductase. This	98.79
PF01946		230	Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K.	98.77
COG0029		518	NadB Aspartate oxidase [Coenzyme metabolism]	98.76
PRK05257		494	malate:quinone oxidoreductase; Validated	98.76
PRK13339		497	malate:quinone oxidoreductase; Reviewed	98.72
COG1635		262	THI4 Ribulose 1,5-bisphosphate synthetase, convert	98.69
PF12831		428	FAD_oxidored: FAD dependent oxidoreductase; PDB: 3	98.69
PRK13369		502	glycerol-3-phosphate dehydrogenase; Provisional	98.68
TIGR03364		365	HpnW_proposed FAD dependent oxidoreductase TIGR033	98.68
COG3573		552	Predicted oxidoreductase [General function predict	98.66
PRK12266		508	glpD glycerol-3-phosphate dehydrogenase; Reviewed	98.66
COG0578		532	GlpA Glycerol-3-phosphate dehydrogenase [Energy pr	98.65
PRK13977		576	myosin-cross-reactive antigen; Provisional	98.64
PRK11259		376	solA N-methyltryptophan oxidase; Provisional	98.64
KOG2404\|consensus		477		98.63
PRK10157		428	putative oxidoreductase FixC; Provisional	98.61
PTZ00363		443	rab-GDP dissociation inhibitor; Provisional	98.57
PRK05192		618	tRNA uridine 5-carboxymethylaminomethyl modificati	98.54
PRK10015		429	oxidoreductase; Provisional	98.51
KOG2415\|consensus		621		98.49
COG0644		396	FixC Dehydrogenases (flavoproteins) [Energy produc	98.45
PF06039		488	Mqo: Malate:quinone oxidoreductase (Mqo); InterPro	98.44
PF01134		392	GIDA: Glucose inhibited division protein A; InterP	98.41
KOG2820\|consensus		399		98.41
COG0665		387	DadA Glycine/D-amino acid oxidases (deaminating) [	98.4
PRK05675		570	sdhA succinate dehydrogenase flavoprotein subunit;	98.4
PRK01747		662	mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans	98.37
KOG0042\|consensus		680		98.34
TIGR00275		400	flavoprotein, HI0933 family. The model when search	98.34
COG1233		487	Phytoene dehydrogenase and related proteins [Secon	98.29
PF13738		203	Pyr_redox_3: Pyridine nucleotide-disulphide oxidor	98.27
KOG1298\|consensus		509		98.26
PRK07364		415	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	98.23
TIGR02730		493	carot_isom carotene isomerase. Members of this fam	98.22
PLN02172		461	flavin-containing monooxygenase FMO GS-OX	98.21
PRK07208		479	hypothetical protein; Provisional	98.2
PRK06185		407	hypothetical protein; Provisional	98.2
TIGR01816		565	sdhA_forward succinate dehydrogenase, flavoprotein	98.19
TIGR02734		502	crtI_fam phytoene desaturase. Phytoene is converte	98.13
TIGR02733		492	desat_CrtD C-3',4' desaturase CrtD. Members of thi	98.08
PRK06467		471	dihydrolipoamide dehydrogenase; Reviewed	98.08
COG3380		331	Predicted NAD/FAD-dependent oxidoreductase [Genera	98.07
PLN02985		514	squalene monooxygenase	98.06
KOG2844\|consensus		856		98.06
PRK05329		422	anaerobic glycerol-3-phosphate dehydrogenase subun	98.04
PF01494		356	FAD_binding_3: FAD binding domain; InterPro: IPR00	98.04
PRK08243		392	4-hydroxybenzoate 3-monooxygenase; Validated	98.03
COG2509		486	Uncharacterized FAD-dependent dehydrogenases [Gene	98.02
TIGR02032		295	GG-red-SF geranylgeranyl reductase family. This mo	98.01
TIGR00136		617	gidA glucose-inhibited division protein A. GidA, t	98.01
TIGR01424		446	gluta_reduc_2 glutathione-disulfide reductase, pla	98.0
PRK05976		472	dihydrolipoamide dehydrogenase; Validated	98.0
PRK07045		388	putative monooxygenase; Reviewed	98.0
PRK08244		493	hypothetical protein; Provisional	97.99
PRK06416		462	dihydrolipoamide dehydrogenase; Reviewed	97.97
PRK05249		461	soluble pyridine nucleotide transhydrogenase; Prov	97.96
COG1249		454	Lpd Pyruvate/2-oxoglutarate dehydrogenase complex,	97.95
TIGR02023		388	BchP-ChlP geranylgeranyl reductase. This model rep	97.95
PRK06184		502	hypothetical protein; Provisional	97.95
PRK07233		434	hypothetical protein; Provisional	97.94
COG0445		621	GidA Flavin-dependent tRNA uridine 5-carboxymethyl	97.93
KOG4254\|consensus		561		97.91
TIGR02731		453	phytoene_desat phytoene desaturase. Plants and cya	97.9
TIGR03378		419	glycerol3P_GlpB glycerol-3-phosphate dehydrogenase	97.9
PRK06126		545	hypothetical protein; Provisional	97.87
PRK06847		375	hypothetical protein; Provisional	97.87
PRK11445		351	putative oxidoreductase; Provisional	97.83
PRK06183		538	mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va	97.83
TIGR02360		390	pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase.	97.8
PLN02507		499	glutathione reductase	97.8
COG0654		387	UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and	97.8
PRK07333		403	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	97.79
TIGR03377		516	glycerol3P_GlpA glycerol-3-phosphate dehydrogenase	97.76
PRK07190		487	hypothetical protein; Provisional	97.75
PRK06617		374	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	97.72
PRK06834		488	hypothetical protein; Provisional	97.72
TIGR01988		385	Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub	97.71
PRK07538		413	hypothetical protein; Provisional	97.66
TIGR02462		544	pyranose_ox pyranose oxidase. Pyranose oxidase (al	97.63
PF13450		68	NAD_binding_8: NAD(P)-binding Rossmann-like domain	97.62
KOG2665\|consensus		453		97.62
PRK08132		547	FAD-dependent oxidoreductase; Provisional	97.62
COG2072		443	TrkA Predicted flavoprotein involved in K+ transpo	97.61
TIGR02732		474	zeta_caro_desat carotene 7,8-desaturase. Carotene	97.59
PF05199		144	GMC_oxred_C: GMC oxidoreductase; InterPro: IPR0078	97.54
PF04820		454	Trp_halogenase: Tryptophan halogenase; InterPro: I	97.5
PLN02487		569	zeta-carotene desaturase	97.49
PLN00093		450	geranylgeranyl diphosphate reductase; Provisional	97.49
PLN02612		567	phytoene desaturase	97.49
PF00743		531	FMO-like: Flavin-binding monooxygenase-like; Inter	97.42
KOG2852\|consensus		380		97.41
TIGR02352		337	thiamin_ThiO glycine oxidase ThiO. This family con	97.41
COG0562		374	Glf UDP-galactopyranose mutase [Cell envelope biog	97.39
KOG2853\|consensus		509		97.38
PRK06116		450	glutathione reductase; Validated	97.36
PRK15317		517	alkyl hydroperoxide reductase subunit F; Provision	97.33
PRK07845		466	flavoprotein disulfide reductase; Reviewed	97.29
TIGR01421		450	gluta_reduc_1 glutathione-disulfide reductase, ani	97.27
PRK08010		441	pyridine nucleotide-disulfide oxidoreductase; Prov	97.27
KOG2311\|consensus		679		97.27
PRK08020		391	ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin	97.26
PRK06370		463	mercuric reductase; Validated	97.26
PRK08773		392	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	97.24
PRK06115		466	dihydrolipoamide dehydrogenase; Reviewed	97.24
PTZ00058		561	glutathione reductase; Provisional	97.23
TIGR02028		398	ChlP geranylgeranyl reductase. This model represen	97.22
PTZ00367		567	squalene epoxidase; Provisional	97.2
PRK07608		388	ubiquinone biosynthesis hydroxylase family protein	97.2
TIGR00031		377	UDP-GALP_mutase UDP-galactopyranose mutase. The ge	97.2
PRK07494		388	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	97.17
PRK08013		400	oxidoreductase; Provisional	97.17
PRK09126		392	hypothetical protein; Provisional	97.16
PRK07251		438	pyridine nucleotide-disulfide oxidoreductase; Prov	97.16
PLN02463		447	lycopene beta cyclase	97.14
PRK05714		405	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	97.13
PF13434		341	K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi	97.12
KOG1399\|consensus		448		97.1
PLN02546		558	glutathione reductase	97.09
PRK07818		466	dihydrolipoamide dehydrogenase; Reviewed	97.08
KOG0029\|consensus		501		97.06
TIGR03143		555	AhpF_homolog putative alkyl hydroperoxide reductas	97.05
PRK08849		384	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	97.05
PRK09897		534	hypothetical protein; Provisional	97.04
TIGR01350		461	lipoamide_DH dihydrolipoamide dehydrogenase. The m	97.04
PLN02697		529	lycopene epsilon cyclase	97.03
PRK06327		475	dihydrolipoamide dehydrogenase; Validated	97.0
PF05834		374	Lycopene_cycl: Lycopene cyclase protein; InterPro:	97.0
TIGR01423		486	trypano_reduc trypanothione-disulfide reductase. T	97.0
TIGR01790		388	carotene-cycl lycopene cyclase family protein. Thi	96.99
TIGR02053		463	MerA mercuric reductase. This model represents the	96.98
PRK14694		468	putative mercuric reductase; Provisional	96.98
TIGR01292		300	TRX_reduct thioredoxin-disulfide reductase. This m	96.97
TIGR01989		437	COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T	96.97
COG0492		305	TrxB Thioredoxin reductase [Posttranslational modi	96.96
PRK06292		460	dihydrolipoamide dehydrogenase; Validated	96.95
PRK08850		405	2-octaprenyl-6-methoxyphenol hydroxylase; Validate	96.92
PTZ00052		499	thioredoxin reductase; Provisional	96.92
PRK13748		561	putative mercuric reductase; Provisional	96.9
TIGR01984		382	UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T	96.9
PRK06996		398	hypothetical protein; Provisional	96.86
TIGR01789		370	lycopene_cycl lycopene cyclase. This model represe	96.84
PLN02268		435	probable polyamine oxidase	96.82
PTZ00153		659	lipoamide dehydrogenase; Provisional	96.77
PLN02576		496	protoporphyrinogen oxidase	96.76
PF06100		500	Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross	96.74
PRK11883		451	protoporphyrinogen oxidase; Reviewed	96.73
PRK05732		395	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	96.67
PRK08163		396	salicylate hydroxylase; Provisional	96.67
COG1231		450	Monoamine oxidase [Amino acid transport and metabo	96.65
TIGR00562		462	proto_IX_ox protoporphyrinogen oxidase. This prote	96.65
PRK07236		386	hypothetical protein; Provisional	96.64
PRK07588		391	hypothetical protein; Provisional	96.62
PRK14727		479	putative mercuric reductase; Provisional	96.62
PRK06753		373	hypothetical protein; Provisional	96.59
PF07992		201	Pyr_redox_2: Pyridine nucleotide-disulphide oxidor	96.54
PRK08294		634	phenol 2-monooxygenase; Provisional	96.53
PLN02676		487	polyamine oxidase	96.51
PRK10262		321	thioredoxin reductase; Provisional	96.51
TIGR01438		484	TGR thioredoxin and glutathione reductase selenopr	96.47
PRK05335		436	tRNA (uracil-5-)-methyltransferase Gid; Reviewed	96.39
PLN02568		539	polyamine oxidase	96.37
COG3349		485	Uncharacterized conserved protein [Function unknow	96.37
PRK13512		438	coenzyme A disulfide reductase; Provisional	96.36
COG3075		421	GlpB Anaerobic glycerol-3-phosphate dehydrogenase	96.3
PRK05868		372	hypothetical protein; Validated	96.24
COG1252		405	Ndh NADH dehydrogenase, FAD-containing subunit [En	96.24
TIGR01372		985	soxA sarcosine oxidase, alpha subunit family, hete	96.23
PRK07846		451	mycothione reductase; Reviewed	96.18
PRK12416		463	protoporphyrinogen oxidase; Provisional	96.18
COG2907		447	Predicted NAD/FAD-binding protein [General functio	96.17
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	96.13
KOG1335\|consensus		506		96.11
TIGR03452		452	mycothione_red mycothione reductase. Mycothiol, a	96.1
PF13454		156	NAD_binding_9: FAD-NAD(P)-binding	96.08
KOG4716\|consensus		503		96.07
PLN02927		668	antheraxanthin epoxidase/zeaxanthin epoxidase	96.06
COG3634		520	AhpF Alkyl hydroperoxide reductase, large subunit	96.05
TIGR03315		1012	Se_ygfK putative selenate reductase, YgfK subunit.	96.01
TIGR00137		433	gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo	95.91
TIGR03197		381	MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri	95.89
KOG2614\|consensus		420		95.87
COG1148		622	HdrA Heterodisulfide reductase, subunit A and rela	95.83
KOG0405\|consensus		478		95.82
PRK06475		400	salicylate hydroxylase; Provisional	95.8
KOG0685\|consensus		498		95.78
PF00996		438	GDI: GDP dissociation inhibitor; InterPro: IPR0182	95.77
PRK12831		464	putative oxidoreductase; Provisional	95.76
PRK06912		458	acoL dihydrolipoamide dehydrogenase; Validated	95.73
COG1232		444	HemY Protoporphyrinogen oxidase [Coenzyme metaboli	95.71
KOG2960\|consensus		328		95.61
TIGR03219		414	salicylate_mono salicylate 1-monooxygenase. Member	95.53
PLN02529		738	lysine-specific histone demethylase 1	95.48
PF00070		80	Pyr_redox: Pyridine nucleotide-disulphide oxidored	95.46
PLN02328		808	lysine-specific histone demethylase 1 homolog	95.4
PRK12810		471	gltD glutamate synthase subunit beta; Reviewed	95.37
TIGR01316		449	gltA glutamate synthase (NADPH), homotetrameric. T	95.36
KOG2403\|consensus		642		95.13
TIGR02053		463	MerA mercuric reductase. This model represents the	95.11
TIGR01350		461	lipoamide_DH dihydrolipoamide dehydrogenase. The m	95.05
PRK09853		1019	putative selenate reductase subunit YgfK; Provisio	95.05
PRK12779		944	putative bifunctional glutamate synthase subunit b	95.05
PRK07818		466	dihydrolipoamide dehydrogenase; Reviewed	94.99
PRK12769		654	putative oxidoreductase Fe-S binding subunit; Revi	94.96
PRK11749		457	dihydropyrimidine dehydrogenase subunit A; Provisi	94.95
PRK12775		1006	putative trifunctional 2-polyprenylphenol hydroxyl	94.93
PRK12778		752	putative bifunctional 2-polyprenylphenol hydroxyla	94.84
KOG3855\|consensus		481		94.83
PLN02852		491	ferredoxin-NADP+ reductase	94.82
PRK08255		765	salicylyl-CoA 5-hydroxylase; Reviewed	94.69
PRK05976		472	dihydrolipoamide dehydrogenase; Validated	94.46
PLN03000		881	amine oxidase	94.4
PRK06416		462	dihydrolipoamide dehydrogenase; Reviewed	94.34
PRK06370		463	mercuric reductase; Validated	94.3
PRK12814		652	putative NADPH-dependent glutamate synthase small	94.24
PRK15317		517	alkyl hydroperoxide reductase subunit F; Provision	94.16
PRK06567		1028	putative bifunctional glutamate synthase subunit b	94.15
PLN02976		1713	amine oxidase	94.12
PRK12770		352	putative glutamate synthase subunit beta; Provisio	94.04
PRK09564		444	coenzyme A disulfide reductase; Reviewed	93.94
TIGR01318		467	gltD_gamma_fam glutamate synthase small subunit fa	93.9
PRK06912		458	acoL dihydrolipoamide dehydrogenase; Validated	93.85
PRK04965		377	NADH:flavorubredoxin oxidoreductase; Provisional	93.83
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	93.77
TIGR01316		449	gltA glutamate synthase (NADPH), homotetrameric. T	93.69
PTZ00188		506	adrenodoxin reductase; Provisional	93.66
TIGR01317		485	GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal	93.58
PRK06115		466	dihydrolipoamide dehydrogenase; Reviewed	93.51
PRK14989		847	nitrite reductase subunit NirD; Provisional	93.4
PRK12809		639	putative oxidoreductase Fe-S binding subunit; Revi	93.35
KOG1276\|consensus		491		93.11
PRK12771		564	putative glutamate synthase (NADPH) small subunit;	92.91
TIGR02374		785	nitri_red_nirB nitrite reductase [NAD(P)H], large	92.7
TIGR03385		427	CoA_CoA_reduc CoA-disulfide reductase. Members of	92.55
KOG1439\|consensus		440		92.49
PRK06327		475	dihydrolipoamide dehydrogenase; Validated	92.35
TIGR01292		300	TRX_reduct thioredoxin-disulfide reductase. This m	92.28
PRK12831		464	putative oxidoreductase; Provisional	92.23
PRK13984		604	putative oxidoreductase; Provisional	92.18
TIGR03862		376	flavo_PP4765 uncharacterized flavoprotein, PP_4765	92.18
PTZ00058		561	glutathione reductase; Provisional	91.99
PRK09754		396	phenylpropionate dioxygenase ferredoxin reductase	91.7
PRK09564		444	coenzyme A disulfide reductase; Reviewed	91.63
PRK10262		321	thioredoxin reductase; Provisional	91.6
COG5044		434	MRS6 RAB proteins geranylgeranyltransferase compon	90.75
KOG2755\|consensus		334		90.67
PTZ00318		424	NADH dehydrogenase-like protein; Provisional	90.49
KOG4405\|consensus		547		90.13
TIGR01438		484	TGR thioredoxin and glutathione reductase selenopr	90.05
TIGR01423		486	trypano_reduc trypanothione-disulfide reductase. T	90.0
TIGR03169		364	Nterm_to_SelD pyridine nucleotide-disulfide oxidor	89.65
PRK04965		377	NADH:flavorubredoxin oxidoreductase; Provisional	88.98
COG1206		439	Gid NAD(FAD)-utilizing enzyme possibly involved in	88.97
KOG1800\|consensus		468		88.79
COG0493		457	GltD NADPH-dependent glutamate synthase beta chain	88.08
PRK11749		457	dihydropyrimidine dehydrogenase subunit A; Provisi	87.89
KOG3851\|consensus		446		87.81
TIGR01372		985	soxA sarcosine oxidase, alpha subunit family, hete	86.86
PF02558		151	ApbA: Ketopantoate reductase PanE/ApbA; InterPro:	85.84
COG0446		415	HcaD Uncharacterized NAD(FAD)-dependent dehydrogen	85.07
COG0569		225	TrkA K+ transport systems, NAD-binding component [	84.08
PF01210		157	NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate	83.31
PRK09754		396	phenylpropionate dioxygenase ferredoxin reductase	81.92
PF13434		341	K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi	81.32

>KOG1238\|consensus	Back alignment and domain information

Probab=100.00  E-value=2.3e-102  Score=893.56  Aligned_cols=566  Identities=52%  Similarity=0.878  Sum_probs=495.2

Q ss_pred             cCCCccEEEECCChhHHHHHHHHhcCCCCeEEEEccCCCCCCCCcccchhhccccCcCCCCCccCCCCCCcchhhccCCC
Q psy4102          87 LLRAYDFIVIGAGSAGAVVANRLSENPDWKILLIEAGGDENEISDIPSLAGYLQLSELDWKYKTEPPMGDSAYCLAMVGD  166 (1049)
Q Consensus        87 ~~~~~DvIVVG~G~aG~~aA~rLae~~G~kVLVLEaG~~~~~~~~~p~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~  166 (1049)
                      ...+|||||||||+|||++|.||+|+|.+||||||||+.+....++|.....++.+.++|.|.++|+   ..+|.++.++
T Consensus        54 ~~~~yDyIVVGgGtAGcvlAarLSEn~~~~VLLLEaGg~~~~~~~~p~~~~~~q~s~~dw~y~t~Ps---~~ac~~m~~~  130 (623)
T KOG1238|consen   54 LDSSYDYIVVGGGTAGCVLAARLSENPNWSVLLLEAGGDPPLYSDPPLLAANLQLSLYDWSYHTEPS---QHACLAMSED  130 (623)
T ss_pred             cccCCCEEEECCCchhHHHHHhhccCCCceEEEEecCCCCcccccchHHHHHhccccccccCcCccC---hhhhhhhcCC
Confidence            5678999999999999999999999999999999999988777888877888889999999999999   8899999999


Q ss_pred             ccccCCcceecCcHHHHhhhhhcCChhhhHHHHhcCCCCCCccChHHHHHHHhhcccCcccCCCCCCCCCcccccCCCCC
Q psy4102         167 RCNWPRGKVLGGSSVLNAMIYVRGNKNDYDQWERLGNPGWGYKDVLPYFKKSEDNRNEYLLRTPYHSKGGYLTVQESPWH  246 (1049)
Q Consensus       167 ~~~~~~G~~lGGsS~in~~~~~r~~~~d~d~w~~~G~~~Ws~~~l~py~~k~E~~~~~~~~~~~~~g~~G~l~v~~~~~~  246 (1049)
                      .|.|+|||++||+|.+|+|+|.|+++.|||.|++.|+++|+|+++++||+|+|....+.....++|+..|++.+....+.
T Consensus       131 ~c~wpRGrVLGGsS~iN~m~Y~RG~r~Dyd~W~~~gnpgW~y~~vl~yf~k~E~~~~~~~~~~~y~~~~g~~~ve~~~~~  210 (623)
T KOG1238|consen  131 RCYWPRGRVLGGSSVLNAMFYVRGNRRDYDRWAAEGNPGWSYDEVLPYFKKSEDKVVPDPELTPYHGAGGPLLVEAGVYP  210 (623)
T ss_pred             ceecCccceecccccccceEEecCCccchHHHHHhcCCCCCHHHHHHHHHHHhhccCCCcccCcccccCCcceecccccc
Confidence            99999999999999999999999999999999999999999999999999999998877777789999999999999999


Q ss_pred             cHHHHHHHHHHHhcCCCCCCCCCCCcccccccccccCCCCccchhHHchHHhhh-cCCcEEecCceEEEEEeccCCCCCe
Q psy4102         247 SPLAAAFVKAGEELGYENRDINGERQTGFMIAQGTIRRGSRCSTSKAFLRPIRL-RKNLHIAMETQALRLLFDKSGPVPK  325 (1049)
Q Consensus       247 ~~~~~~~~~a~~~~G~~~~d~~~~~~~G~~~~~~~~~~g~r~s~~~~~L~~~~~-~~nl~I~~~t~V~~Il~d~~~~~~r  325 (1049)
                      .+....+.++..++|....|+|+..+.|+...+.+.++|.|+++..+|+.++.. |+|+++..++.|++|++|..  +.+
T Consensus       211 ~~~~~~~~~ag~e~G~~~~D~nG~~~tg~~~l~~t~~~g~R~s~~~a~l~~~~~~R~NL~~~~~~~vtrvl~D~~--~~~  288 (623)
T KOG1238|consen  211 NNLFTAFHRAGTEIGGSIFDRNGERHTGASLLQYTIRNGIRVSLAKAYLKPIRLTRPNLHISRNAAVTRVLIDPA--GKR  288 (623)
T ss_pred             CchhhHhHHhHHhcCCCccCCCCccccchhhhhccccCCEEEEehhhhhhhhhccCccccccccceEEEEEEcCC--Cce
Confidence            999999999999999888999999999999999999999999999999999877 89999999999999999952  459


Q ss_pred             EEEEEEEeC-CeEEEEEcCeEEEEcCCCcchHHHHHhCCCCCccccccCCCCccccCc-cccccccccCCCcEEEEEcCc
Q psy4102         326 AVGIEILRD-GRKHIIRAKKEIISSAGAINSPQLLMVSGIGPEEHLQGLNIPIIKNLS-VGHNLQDHVGLGGLTFIVDGP  403 (1049)
Q Consensus       326 v~GV~~~~~-g~~~~v~A~k~VILAAGa~~Tp~LLl~SGIGp~~~L~~~gI~v~~dlp-VG~nl~DH~~~~~~~~~~~~~  403 (1049)
                      +.||++.++ |+.++++|+||||||||||+||||||+|||||++||+++||||++|+| ||+|||||+..+.+.+..+ +
T Consensus       289 a~gv~~~~~~~~~~~v~a~kEVILSAGAi~SPQLLMLSGIGP~~~L~~~gIpvv~dLP~VG~nLqDH~~~~~~~~~~~-~  367 (623)
T KOG1238|consen  289 AKGVEFVRDGGKEHTVKARKEVILSAGAINSPQLLMLSGIGPADHLKKLGIPVVLDLPGVGQNLQDHPMNPGFVFSTN-P  367 (623)
T ss_pred             EEEEEEEecCceeeeecccceEEEeccccCCHHHHHHcCCCcHHHHHhcCCCeeccCcccccccccccccceeeecCC-C
Confidence            999999988 799999999999999999999999999999999999999999999999 9999999999853333222 2


Q ss_pred             ccccccchhhhHHHHHHhhccCCCcccCCcccccccccccCCCCcccCCCCCccceeccchhhhhhhccCCCcceEEEEe
Q psy4102         404 VTFKKERYQTLSVALQYILNERGPLTSLGGVEGLAFVNTKYAPSETHQGSNGIRIVFENLDKVLVIRRFSCPSCHILVLS  483 (1049)
Q Consensus       404 ~~~~~~~~~~~~~~~~~~~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  483 (1049)
                      .+..                                                                            
T Consensus       368 ~~~~----------------------------------------------------------------------------  371 (623)
T KOG1238|consen  368 VELS----------------------------------------------------------------------------  371 (623)
T ss_pred             cccc----------------------------------------------------------------------------
Confidence            1100                                                                            


Q ss_pred             cCCCCccccccCccccccccccCcccccccccCcceeeecCCccchhhhhhhHHHHHHHHHhCCCCCccCCcceEEEEEE
Q psy4102         484 SGIGPEEHLQGLNIPIIKNLSVGHNLQDHVGLGGLTFIVDGPVTFKKERYQTLSVALQYILNERGPLTSLGGVEGLAFVN  563 (1049)
Q Consensus       484 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~  563 (1049)
                                                                    ..+........+|+..++||+.+.+ ++.++|.+
T Consensus       372 ----------------------------------------------~~~~~~~~~~~~yl~~~~G~~~~~~-~e~~~f~~  404 (623)
T KOG1238|consen  372 ----------------------------------------------LIRLVGITTVGQYLEGGSGPLASPG-VETLGFIN  404 (623)
T ss_pred             ----------------------------------------------ccccccchHHHHHHHcCCCCcccCc-ceeeEEec
Confidence                                                          0111234456799999999999776 89999999


Q ss_pred             cCCCCCCCCCCCEEEEeecccccCCCchhhhhhcCccHHHHhhhcccCCCCCceEEEEEeecCCCeeeEEEEEEcCeeEE
Q psy4102         564 TKYAPSGGDWPDVQFHFAPSSVNSDGGEQIRKILGLRDRIFNTLYKPLINAETWTILPLLLRPLSTGNGIRIVFENLDKV  643 (1049)
Q Consensus       564 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~y~~p~~~r~nl~v~~il~~~~sratGV~~~~~~~~ke  643 (1049)
                      +.+++.+.++||+++++.+..+.++....++...+   +.+++.+.+..++..+.|+..++                   
T Consensus       405 t~~~~~~~~~PD~~~~~~~~~~~~~~~~~~~~~~~---~~y~~~~~~~~~~~~~~i~~~~l-------------------  462 (623)
T KOG1238|consen  405 TVSSNLSLDWPDIELHFVAGSLSSDGLTALRKALG---EIYQALFGELTNSDSFVIFPKLL-------------------  462 (623)
T ss_pred             cccccCcCCCCCeeEEeccccccccchhhhhhhcc---hHHHHhhhhhhcCceeEEeehhc-------------------
Confidence            99999899999999999988887765554443333   33333333222211122211111                   


Q ss_pred             EEEeeccccchHHHHHhcCCCCHHHHhhCCCCccccCCcccccccccccceeEEEEcCccccchhhHHHHhhccccCCCC
Q psy4102         644 LVIRRFSCPSCHILVLSSGIGPEEHLQGLNIPIIKNLSVGHNLQDHVGLGGLTFIVDGPVTFKKERYQVLLCLSERTDDS  723 (1049)
Q Consensus       644 VilsaGai~SPqILlL~SGIGP~~~L~~~GIpvv~DLPVG~NLqDH~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~~~~  723 (1049)
                                                                                                      
T Consensus       463 --------------------------------------------------------------------------------  462 (623)
T KOG1238|consen  463 --------------------------------------------------------------------------------  462 (623)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             ccccccccchhhhhhccCCCCCCCCCcccccccccccHHHHHhhhhhhhccccccceEEEEEecCCCCCCCCccccCCCC
Q psy4102         724 TYSTYTNTLFPRYIRLQSKNPLHYPLIEPNYFQHRRDIETLIEGIRIAFNVSASAAFKKYIRLQSKNPLHYPLIEPNYFQ  803 (1049)
Q Consensus       724 ~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~v~l~S~~p~~~P~i~~~~l~  803 (1049)
                                                                           -+.++|++.|+|+||.++|.|++||++
T Consensus       463 -----------------------------------------------------~P~SrG~l~L~s~nP~~~P~I~~NY~~  489 (623)
T KOG1238|consen  463 -----------------------------------------------------RPKSRGRLKLRSTNPRDNPLITPNYFT  489 (623)
T ss_pred             -----------------------------------------------------CCCccceEEecCCCCCcCceeccCcCC
Confidence                                                                 245678999999999999999999999


Q ss_pred             ChhhHHHHHHHHHHHHHhhcChhhhhccCCCCCCCCCCCcccccccHHHHHhhhcccceeEeeccCCCCCCCCCCCCCcc
Q psy4102         804 HRRDIETLIEGIRIAFNVSASAAFQKYNSRPLLTPMPGCAMFELFSDEYWECSLRHFTFTIYHPTSTCKMGPPTDPEAVV  883 (1049)
Q Consensus       804 ~~~D~~~l~~g~~~~~~i~~~~~~~~~~~~~~~~~~pg~~~~~~~s~~~~~~~~~~~s~~~~H~~st~~m~p~~d~~~vv  883 (1049)
                      ++.|++.+++|++.+.++.++.+|+.+.......+.++|......++++|+|++|..+.+.+|+.               
T Consensus       490 ~p~Dv~~~vegi~~~~~l~~s~af~~~~~r~~~~~~~~c~~~~~~sd~yw~c~~R~~~~TiyH~~---------------  554 (623)
T KOG1238|consen  490 HPEDVATLVEGIRTIIRLSNSKAFQRFGARLWKKPVPGCDLLAFLSDAYWECFCRHTVVTIYHYS---------------  554 (623)
T ss_pred             CHHHHHHHHHHHHHHHHHHcCHHHHHhcchhccccCCCcccccCCCHHHHHHHHHhccceeeccC---------------
Confidence            99999999999999999999999999988877778999998889999999999999999888885               


Q ss_pred             ccccccccccceEeeccccCCccccCCCCCCccccccccccchhcccccCccCCCCCCcccccCCCceeeccCCceEeec
Q psy4102         884 DPRLRVYGVDGLRVIDASIMPIIVSGNPNAPTIMIGEKGADMTSRYTIRPALMGPATDLEAVVDPRLRVYGVDGLRVIDA  963 (1049)
Q Consensus       884 D~~~~v~gv~~lRvvdas~~p~~~~~~~~~~~~~i~e~~~d~i~~~~~~tcrMGp~~d~~~VVD~~LRV~Gv~nLRVvDA  963 (1049)
                                                                      +||+|||..|+++|||++||||||+|||||||
T Consensus       555 ------------------------------------------------GtckMGp~~D~~aVVD~~lrV~Gv~~LRVVDa  586 (623)
T KOG1238|consen  555 ------------------------------------------------GTCKMGPSSDPTAVVDPQLRVHGVRGLRVVDA  586 (623)
T ss_pred             ------------------------------------------------CceEeCCccCCCcccCCcceeccccCceEeec
Confidence                                                            45677777899999999999999999999999


Q ss_pred             cccCCCCCCCchhHHHHHHHHHHHHhHhhhcccccC
Q psy4102         964 SIMPIIVSGNPNAPTIMIGEKGADMKQSYLDQEEEG  999 (1049)
Q Consensus       964 SImP~~~sgNt~atv~mIaEraAd~I~~~~~~~~~~  999 (1049)
                      ||||.+|++|||||+||||||+||+|+++|....+.
T Consensus       587 SimP~~psgN~nA~v~MIgek~ad~Ik~~~~~~~~~  622 (623)
T KOG1238|consen  587 SIMPESPSGNPNAPVMMIGEKAADMIKEEWLANKDG  622 (623)
T ss_pred             cccCCCCCCCccHHHHHHHHHHHHHHHHHhhhcCCC
Confidence            999999999999999999999999999998876654

>TIGR01810 betA choline dehydrogenase	Back alignment and domain information

>PRK02106 choline dehydrogenase; Validated	Back alignment and domain information

>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02785 Protein HOTHEAD	Back alignment and domain information

>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ]	Back alignment and domain information

>TIGR02462 pyranose_ox pyranose oxidase	Back alignment and domain information

>KOG1238\|consensus	Back alignment and domain information

>PF05199 GMC_oxred_C: GMC oxidoreductase; InterPro: IPR007867 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ]	Back alignment and domain information

>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ]	Back alignment and domain information

>PLN02785 Protein HOTHEAD	Back alignment and domain information

>TIGR01810 betA choline dehydrogenase	Back alignment and domain information

>PRK02106 choline dehydrogenase; Validated	Back alignment and domain information

>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK07121 hypothetical protein; Validated	Back alignment and domain information

>PRK06481 fumarate reductase flavoprotein subunit; Validated	Back alignment and domain information

>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional	Back alignment and domain information

>PF00890 FAD_binding_2: FAD binding domain of the Pfam family	Back alignment and domain information

>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism]	Back alignment and domain information

>PRK08274 tricarballylate dehydrogenase; Validated	Back alignment and domain information

>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit	Back alignment and domain information

>PRK06175 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK07804 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK12843 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional	Back alignment and domain information

>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PLN02815 L-aspartate oxidase	Back alignment and domain information

>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK07395 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK12834 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>TIGR01813 flavo_cyto_c flavocytochrome c	Back alignment and domain information

>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PTZ00306 NADH-dependent fumarate reductase; Provisional	Back alignment and domain information

>PRK12839 hypothetical protein; Provisional	Back alignment and domain information

>PRK08626 fumarate reductase flavoprotein subunit; Provisional	Back alignment and domain information

>PRK12842 putative succinate dehydrogenase; Reviewed	Back alignment and domain information

>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK06134 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit	Back alignment and domain information

>PRK09231 fumarate reductase flavoprotein subunit; Validated	Back alignment and domain information

>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>TIGR00551 nadB L-aspartate oxidase	Back alignment and domain information

>PRK08275 putative oxidoreductase; Provisional	Back alignment and domain information

>PRK09077 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup	Back alignment and domain information

>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK07512 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional	Back alignment and domain information

>PRK08071 L-aspartate oxidase; Provisional	Back alignment and domain information

>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup	Back alignment and domain information

>PRK06854 adenylylsulfate reductase subunit alpha; Validated	Back alignment and domain information

>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1	Back alignment and domain information

>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional	Back alignment and domain information

>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit	Back alignment and domain information

>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases	Back alignment and domain information

>COG2081 Predicted flavoproteins [General function prediction only]	Back alignment and domain information

>PRK08401 L-aspartate oxidase; Provisional	Back alignment and domain information

>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion]	Back alignment and domain information

>COG0579 Predicted dehydrogenase [General function prediction only]	Back alignment and domain information

>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form	Back alignment and domain information

>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional	Back alignment and domain information

>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase	Back alignment and domain information

>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ	Back alignment and domain information

>PRK12409 D-amino acid dehydrogenase small subunit; Provisional	Back alignment and domain information

>PLN02661 Putative thiazole synthesis	Back alignment and domain information

>TIGR00292 thiazole biosynthesis enzyme	Back alignment and domain information

>PTZ00383 malate:quinone oxidoreductase; Provisional	Back alignment and domain information

>PRK00711 D-amino acid dehydrogenase small subunit; Validated	Back alignment and domain information

>PRK11728 hydroxyglutarate oxidase; Provisional	Back alignment and domain information

>TIGR01377 soxA_mon sarcosine oxidase, monomeric form	Back alignment and domain information

>PLN02464 glycerol-3-phosphate dehydrogenase	Back alignment and domain information

>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase	Back alignment and domain information

>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K	Back alignment and domain information

>COG0029 NadB Aspartate oxidase [Coenzyme metabolism]	Back alignment and domain information

>PRK05257 malate:quinone oxidoreductase; Validated	Back alignment and domain information

>PRK13339 malate:quinone oxidoreductase; Reviewed	Back alignment and domain information

>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A	Back alignment and domain information

>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364	Back alignment and domain information

>COG3573 Predicted oxidoreductase [General function prediction only]	Back alignment and domain information

>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed	Back alignment and domain information

>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>PRK13977 myosin-cross-reactive antigen; Provisional	Back alignment and domain information

>PRK11259 solA N-methyltryptophan oxidase; Provisional	Back alignment and domain information

>KOG2404\|consensus	Back alignment and domain information

>PRK10157 putative oxidoreductase FixC; Provisional	Back alignment and domain information

>PTZ00363 rab-GDP dissociation inhibitor; Provisional	Back alignment and domain information

>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated	Back alignment and domain information

>PRK10015 oxidoreductase; Provisional	Back alignment and domain information

>KOG2415\|consensus	Back alignment and domain information

>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion]	Back alignment and domain information

>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle	Back alignment and domain information

>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria	Back alignment and domain information

>KOG2820\|consensus	Back alignment and domain information

>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism]	Back alignment and domain information

>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed	Back alignment and domain information

>KOG0042\|consensus	Back alignment and domain information

>TIGR00275 flavoprotein, HI0933 family	Back alignment and domain information

>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A	Back alignment and domain information

>KOG1298\|consensus	Back alignment and domain information

>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>TIGR02730 carot_isom carotene isomerase	Back alignment and domain information

>PLN02172 flavin-containing monooxygenase FMO GS-OX	Back alignment and domain information

>PRK07208 hypothetical protein; Provisional	Back alignment and domain information

>PRK06185 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E	Back alignment and domain information

>TIGR02734 crtI_fam phytoene desaturase	Back alignment and domain information

>TIGR02733 desat_CrtD C-3',4' desaturase CrtD	Back alignment and domain information

>PRK06467 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only]	Back alignment and domain information

>PLN02985 squalene monooxygenase	Back alignment and domain information

>KOG2844\|consensus	Back alignment and domain information

>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated	Back alignment and domain information

>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways	Back alignment and domain information

>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated	Back alignment and domain information

>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

>TIGR02032 GG-red-SF geranylgeranyl reductase family	Back alignment and domain information

>TIGR00136 gidA glucose-inhibited division protein A	Back alignment and domain information

>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant	Back alignment and domain information

>PRK05976 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK07045 putative monooxygenase; Reviewed	Back alignment and domain information

>PRK08244 hypothetical protein; Provisional	Back alignment and domain information

>PRK06416 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional	Back alignment and domain information

>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion]	Back alignment and domain information

>TIGR02023 BchP-ChlP geranylgeranyl reductase	Back alignment and domain information

>PRK06184 hypothetical protein; Provisional	Back alignment and domain information

>PRK07233 hypothetical protein; Provisional	Back alignment and domain information

>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG4254\|consensus	Back alignment and domain information

>TIGR02731 phytoene_desat phytoene desaturase	Back alignment and domain information

>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit	Back alignment and domain information

>PRK06126 hypothetical protein; Provisional	Back alignment and domain information

>PRK06847 hypothetical protein; Provisional	Back alignment and domain information

>PRK11445 putative oxidoreductase; Provisional	Back alignment and domain information

>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated	Back alignment and domain information

>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase	Back alignment and domain information

>PLN02507 glutathione reductase	Back alignment and domain information

>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion]	Back alignment and domain information

>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit	Back alignment and domain information

>PRK07190 hypothetical protein; Provisional	Back alignment and domain information

>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PRK06834 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family	Back alignment and domain information

>PRK07538 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02462 pyranose_ox pyranose oxidase	Back alignment and domain information

>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G	Back alignment and domain information

>KOG2665\|consensus	Back alignment and domain information

>PRK08132 FAD-dependent oxidoreductase; Provisional	Back alignment and domain information

>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR02732 zeta_caro_desat carotene 7,8-desaturase	Back alignment and domain information

>PF05199 GMC_oxred_C: GMC oxidoreductase; InterPro: IPR007867 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ]	Back alignment and domain information

>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan	Back alignment and domain information

>PLN02487 zeta-carotene desaturase	Back alignment and domain information

>PLN00093 geranylgeranyl diphosphate reductase; Provisional	Back alignment and domain information

>PLN02612 phytoene desaturase	Back alignment and domain information

>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes []	Back alignment and domain information

>KOG2852\|consensus	Back alignment and domain information

>TIGR02352 thiamin_ThiO glycine oxidase ThiO	Back alignment and domain information

>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>KOG2853\|consensus	Back alignment and domain information

>PRK06116 glutathione reductase; Validated	Back alignment and domain information

>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional	Back alignment and domain information

>PRK07845 flavoprotein disulfide reductase; Reviewed	Back alignment and domain information

>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial	Back alignment and domain information

>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>KOG2311\|consensus	Back alignment and domain information

>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed	Back alignment and domain information

>PRK06370 mercuric reductase; Validated	Back alignment and domain information

>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated	Back alignment and domain information

>PRK06115 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PTZ00058 glutathione reductase; Provisional	Back alignment and domain information

>TIGR02028 ChlP geranylgeranyl reductase	Back alignment and domain information

>PTZ00367 squalene epoxidase; Provisional	Back alignment and domain information

>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional	Back alignment and domain information

>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase	Back alignment and domain information

>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>PRK08013 oxidoreductase; Provisional	Back alignment and domain information

>PRK09126 hypothetical protein; Provisional	Back alignment and domain information

>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>PLN02463 lycopene beta cyclase	Back alignment and domain information

>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B	Back alignment and domain information

>KOG1399\|consensus	Back alignment and domain information

>PLN02546 glutathione reductase	Back alignment and domain information

>PRK07818 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>KOG0029\|consensus	Back alignment and domain information

>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit	Back alignment and domain information

>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>PRK09897 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase	Back alignment and domain information

>PLN02697 lycopene epsilon cyclase	Back alignment and domain information

>PRK06327 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins	Back alignment and domain information

>TIGR01423 trypano_reduc trypanothione-disulfide reductase	Back alignment and domain information

>TIGR01790 carotene-cycl lycopene cyclase family protein	Back alignment and domain information

>TIGR02053 MerA mercuric reductase	Back alignment and domain information

>PRK14694 putative mercuric reductase; Provisional	Back alignment and domain information

>TIGR01292 TRX_reduct thioredoxin-disulfide reductase	Back alignment and domain information

>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6	Back alignment and domain information

>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK06292 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated	Back alignment and domain information

>PTZ00052 thioredoxin reductase; Provisional	Back alignment and domain information

>PRK13748 putative mercuric reductase; Provisional	Back alignment and domain information

>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase	Back alignment and domain information

>PRK06996 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01789 lycopene_cycl lycopene cyclase	Back alignment and domain information

>PLN02268 probable polyamine oxidase	Back alignment and domain information

>PTZ00153 lipoamide dehydrogenase; Provisional	Back alignment and domain information

>PLN02576 protoporphyrinogen oxidase	Back alignment and domain information

>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis []	Back alignment and domain information

>PRK11883 protoporphyrinogen oxidase; Reviewed	Back alignment and domain information

>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PRK08163 salicylate hydroxylase; Provisional	Back alignment and domain information

>COG1231 Monoamine oxidase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR00562 proto_IX_ox protoporphyrinogen oxidase	Back alignment and domain information

>PRK07236 hypothetical protein; Provisional	Back alignment and domain information

>PRK07588 hypothetical protein; Provisional	Back alignment and domain information

>PRK14727 putative mercuric reductase; Provisional	Back alignment and domain information

>PRK06753 hypothetical protein; Provisional	Back alignment and domain information

>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]

Back alignment and domain information

>PRK08294 phenol 2-monooxygenase; Provisional	Back alignment and domain information

>PLN02676 polyamine oxidase	Back alignment and domain information

>PRK10262 thioredoxin reductase; Provisional	Back alignment and domain information

>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein	Back alignment and domain information

>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed	Back alignment and domain information

>PLN02568 polyamine oxidase	Back alignment and domain information

>COG3349 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK13512 coenzyme A disulfide reductase; Provisional	Back alignment and domain information

>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK05868 hypothetical protein; Validated	Back alignment and domain information

>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion]	Back alignment and domain information

>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form	Back alignment and domain information

>PRK07846 mycothione reductase; Reviewed	Back alignment and domain information

>PRK12416 protoporphyrinogen oxidase; Provisional	Back alignment and domain information

>COG2907 Predicted NAD/FAD-binding protein [General function prediction only]	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>KOG1335\|consensus	Back alignment and domain information

>TIGR03452 mycothione_red mycothione reductase	Back alignment and domain information

>PF13454 NAD_binding_9: FAD-NAD(P)-binding	Back alignment and domain information

>KOG4716\|consensus	Back alignment and domain information

>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase	Back alignment and domain information

>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit	Back alignment and domain information

>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase	Back alignment and domain information

>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain	Back alignment and domain information

>KOG2614\|consensus	Back alignment and domain information

>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion]	Back alignment and domain information

>KOG0405\|consensus	Back alignment and domain information

>PRK06475 salicylate hydroxylase; Provisional	Back alignment and domain information

>KOG0685\|consensus	Back alignment and domain information

>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function	Back alignment and domain information

>PRK12831 putative oxidoreductase; Provisional	Back alignment and domain information

>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism]	Back alignment and domain information

>KOG2960\|consensus	Back alignment and domain information

>TIGR03219 salicylate_mono salicylate 1-monooxygenase	Back alignment and domain information

>PLN02529 lysine-specific histone demethylase 1	Back alignment and domain information

>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]

Back alignment and domain information

>PLN02328 lysine-specific histone demethylase 1 homolog	Back alignment and domain information

>PRK12810 gltD glutamate synthase subunit beta; Reviewed	Back alignment and domain information

>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric	Back alignment and domain information

>KOG2403\|consensus	Back alignment and domain information

>TIGR02053 MerA mercuric reductase	Back alignment and domain information

>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase	Back alignment and domain information

>PRK09853 putative selenate reductase subunit YgfK; Provisional	Back alignment and domain information

>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional	Back alignment and domain information

>PRK07818 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional	Back alignment and domain information

>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional	Back alignment and domain information

>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional	Back alignment and domain information

>KOG3855\|consensus	Back alignment and domain information

>PLN02852 ferredoxin-NADP+ reductase	Back alignment and domain information

>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed	Back alignment and domain information

>PRK05976 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PLN03000 amine oxidase	Back alignment and domain information

>PRK06416 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK06370 mercuric reductase; Validated	Back alignment and domain information

>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional	Back alignment and domain information

>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional	Back alignment and domain information

>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated	Back alignment and domain information

>PLN02976 amine oxidase	Back alignment and domain information

>PRK12770 putative glutamate synthase subunit beta; Provisional	Back alignment and domain information

>PRK09564 coenzyme A disulfide reductase; Reviewed	Back alignment and domain information

>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial	Back alignment and domain information

>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric	Back alignment and domain information

>PTZ00188 adrenodoxin reductase; Provisional	Back alignment and domain information

>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit	Back alignment and domain information

>PRK06115 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK14989 nitrite reductase subunit NirD; Provisional	Back alignment and domain information

>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>KOG1276\|consensus	Back alignment and domain information

>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional	Back alignment and domain information

>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit	Back alignment and domain information

>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase	Back alignment and domain information

>KOG1439\|consensus	Back alignment and domain information

>PRK06327 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>TIGR01292 TRX_reduct thioredoxin-disulfide reductase	Back alignment and domain information

>PRK12831 putative oxidoreductase; Provisional	Back alignment and domain information

>PRK13984 putative oxidoreductase; Provisional	Back alignment and domain information

>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family	Back alignment and domain information

>PTZ00058 glutathione reductase; Provisional	Back alignment and domain information

>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional	Back alignment and domain information

>PRK09564 coenzyme A disulfide reductase; Reviewed	Back alignment and domain information

>PRK10262 thioredoxin reductase; Provisional	Back alignment and domain information

>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2755\|consensus	Back alignment and domain information

>PTZ00318 NADH dehydrogenase-like protein; Provisional	Back alignment and domain information

>KOG4405\|consensus	Back alignment and domain information

>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein	Back alignment and domain information

>TIGR01423 trypano_reduc trypanothione-disulfide reductase	Back alignment and domain information

>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein	Back alignment and domain information

>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional	Back alignment and domain information

>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1800\|consensus	Back alignment and domain information

>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only]	Back alignment and domain information

>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional	Back alignment and domain information

>KOG3851\|consensus	Back alignment and domain information

>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form	Back alignment and domain information

>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1	Back alignment and domain information

>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate	Back alignment and domain information

>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional	Back alignment and domain information

>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		1049
3fim_B		566	Crystal Structure Of Aryl-Alcohol-Oxidase From Pleu		8e-33
3fim_B		566	Crystal Structure Of Aryl-Alcohol-Oxidase From Pleu		4e-21
3t37_A		526	Crystal Structure Of Pyridoxine 4-Oxidase From Meso		1e-31
3t37_A		526	Crystal Structure Of Pyridoxine 4-Oxidase From Meso		1e-11
3nne_A		546	Crystal Structure Of Choline Oxidase S101a Mutant L		6e-31
3nne_A		546	Crystal Structure Of Choline Oxidase S101a Mutant L		2e-24
3nne_A		546	Crystal Structure Of Choline Oxidase S101a Mutant L		2e-08
3ljp_A		546	Crystal Structure Of Choline Oxidase V464a Mutant L		1e-30
3ljp_A		546	Crystal Structure Of Choline Oxidase V464a Mutant L		5e-24
3ljp_A		546	Crystal Structure Of Choline Oxidase V464a Mutant L		7e-09
2jbv_A		546	Crystal Structure Of Choline Oxidase Reveals Insigh		1e-30
2jbv_A		546	Crystal Structure Of Choline Oxidase Reveals Insigh		2e-24
2jbv_A		546	Crystal Structure Of Choline Oxidase Reveals Insigh		2e-08
3q9t_A		577	Crystal Structure Analysis Of Formate Oxidase Lengt		3e-29
3q9t_A		577	Crystal Structure Analysis Of Formate Oxidase Lengt		8e-14
3q9t_A		577	Crystal Structure Analysis Of Formate Oxidase Lengt		6e-05
1cf3_A		583	Glucose Oxidase From Apergillus Niger Length = 583		1e-21
1cf3_A		583	Glucose Oxidase From Apergillus Niger Length = 583		9e-10
1gpe_A		587	Glucose Oxidase From Penicillium Amagasakiense Leng		2e-21
1gpe_A		587	Glucose Oxidase From Penicillium Amagasakiense Leng		1e-06
3red_A		521	3.0 A Structure Of The Prunus Mume Hydroxynitrile L		6e-16
3red_A		521	3.0 A Structure Of The Prunus Mume Hydroxynitrile L		3e-05
3gdn_A		521	Almond Hydroxynitrile Lyase In Complex With Benzald		2e-15
3gdn_A		521	Almond Hydroxynitrile Lyase In Complex With Benzald		3e-06
1ju2_A		536	Crystal Structure Of The Hydroxynitrile Lyase From		2e-15
1ju2_A		536	Crystal Structure Of The Hydroxynitrile Lyase From		4e-06

>pdb|3FIM|B Chain B, Crystal Structure Of Aryl-Alcohol-Oxidase From Pleurotus Eryingii Length = 566