Psyllid ID: psy4122


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MTIAINSQEYVRFTLIYLFSVNTDALTQDWLSHLRWILQKDNMSQDVFLIGKPGSLRRSLAMSYLELTQREVEYICLSRDTTEADIKQRREIVNGTAIYYDQSAVRAAIEGRVLILEGIEKAERNVLPVLNNLLENREMHLEDGRFLVSASTYDKLLQVETL
cccccccccccccccccccccccccccHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHHccccEEEEcccccccccccccEEEEccEEEEEEcHHHHHHHHccEEEEEccccccccHHHHHHHHHHccEEEEccccEEEcccccccccccccc
ccEEEEcccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHcccEEEEEEEccccHHHHHcccccccccEEEEccHHHHHHHcccEEEEccccccccccHHHHHHHHHcccEEcccccEEccHHHHHHHHHHccc
mtiainsqEYVRFTLIYLFSVNTDALTQDWLSHLRWILQkdnmsqdvfligkpgslRRSLAMSYLELTQREVEYICLSRDTTEADIKQRREIVNGTAIYYDQSAVRAAIEGRVLILEGIEKAERNVLPVLNNLLENREMHLEDGRFLVSASTYDKLLQVETL
mtiainsqeyVRFTLIYLFSVNTDALTQDWLSHLRWILQKDNMSQDVFLIGKPGSLRRSLAMSYLELTQREVEYIclsrdtteadikqrrEIVNGtaiyydqsavrAAIEGRVLILEGIEKAERNVLPVLNNLLENREMHLEDGrflvsastydkllqvetl
MTIAINSQEYVRFTLIYLFSVNTDALTQDWLSHLRWILQKDNMSQDVFLIGKPGSLRRSLAMSYLELTQREVEYICLSRDTTEADIKQRREIVNGTAIYYDQSAVRAAIEGRVLILEGIEKAernvlpvlnnllenreMHLEDGRFLVSASTYDKLLQVETL
****INSQEYVRFTLIYLFSVNTDALTQDWLSHLRWILQKDNMSQDVFLIGKPGSLRRSLAMSYLELTQREVEYICLSRDTTEADIKQRREIVNGTAIYYDQSAVRAAIEGRVLILEGIEKAERNVLPVLNNLLENREMHLEDGRFLVSASTYDKL******
*************TLIYLFSVNTDALTQDWLSHLRWILQKDNMSQDVFLIGKPGSLRRSLAMSYLELTQREVEYICLSRDTTEADIKQRREIVNGTAIYYDQSAVRAAIEGRVLILEGIEKAERNVLPVLNNLLENREMHLEDGRFLVSASTYDKLLQVE**
MTIAINSQEYVRFTLIYLFSVNTDALTQDWLSHLRWILQKDNMSQDVFLIGKPGSLRRSLAMSYLELTQREVEYICLSRDTTEADIKQRREIVNGTAIYYDQSAVRAAIEGRVLILEGIEKAERNVLPVLNNLLENREMHLEDGRFLVSASTYDKLLQVETL
MTIAINSQEYVRFTLIYLFSVNTDALTQDWLSHLRWILQKDNMSQDVFLIGKPGSLRRSLAMSYLELTQREVEYICLSRDTTEADIKQRREIVNGTAIYYDQSAVRAAIEGRVLILEGIEKAERNVLPVLNNLLENREMHLEDGRFLVSASTYDKLLQ****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTIAINSQEYVRFTLIYLFSVNTDALTQDWLSHLRWILQKDNMSQDVFLIGKPGSLRRSLAMSYLELTQREVEYICLSRDTTEADIKQRREIVNGTAIYYDQSAVRAAIEGRVLILEGIEKAERNVLPVLNNLLENREMHLEDGRFLVSASTYDKLLQVETL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query162 2.2.26 [Sep-21-2011]
A3KMH1 1905 von Willebrand factor A d no N/A 0.839 0.071 0.755 4e-56
B0R0T1 1896 von Willebrand factor A d yes N/A 0.845 0.072 0.746 1e-55
Q8CC88 1905 von Willebrand factor A d no N/A 0.851 0.072 0.741 2e-55
>sp|A3KMH1|VWA8_HUMAN von Willebrand factor A domain-containing protein 8 OS=Homo sapiens GN=VWA8 PE=1 SV=2 Back     alignment and function desciption
 Score =  216 bits (550), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 105/139 (75%), Positives = 116/139 (83%)

Query: 23  TDALTQDWLSHLRWILQKDNMSQDVFLIGKPGSLRRSLAMSYLELTQREVEYICLSRDTT 82
           +D+L Q  + HLRWI+QKD + QDVFLIG PG LRRS+AM YLELT+REVEYI LSRDTT
Sbjct: 82  SDSLAQSVVQHLRWIMQKDLLGQDVFLIGPPGPLRRSIAMQYLELTKREVEYIALSRDTT 141

Query: 83  EADIKQRREIVNGTAIYYDQSAVRAAIEGRVLILEGIEKAERNVLPVLNNLLENREMHLE 142
           E D+KQRREI  GTA Y DQ AVRAA EGR LILEG+EKAERNVLPVLNNLLENREM LE
Sbjct: 142 ETDLKQRREIRAGTAFYIDQCAVRAATEGRTLILEGLEKAERNVLPVLNNLLENREMQLE 201

Query: 143 DGRFLVSASTYDKLLQVET 161
           DGRFL+SA  YDKLL+  T
Sbjct: 202 DGRFLMSAERYDKLLRDHT 220





Homo sapiens (taxid: 9606)
>sp|B0R0T1|VWA8_DANRE von Willebrand factor A domain-containing protein 8 OS=Danio rerio GN=si:dkey-18l1.1 PE=4 SV=1 Back     alignment and function description
>sp|Q8CC88|VWA8_MOUSE von Willebrand factor A domain-containing protein 8 OS=Mus musculus GN=Vwa8 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
363729456 1904 PREDICTED: uncharacterized protein KIAA0 0.851 0.072 0.755 2e-55
326914135 1872 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.851 0.073 0.755 2e-55
296203808 1909 PREDICTED: uncharacterized protein KIAA0 0.839 0.071 0.762 4e-55
426236691 1935 PREDICTED: von Willebrand factor A domai 0.839 0.070 0.762 4e-55
332241809 1905 PREDICTED: LOW QUALITY PROTEIN: von Will 0.839 0.071 0.762 6e-55
449484533 1883 PREDICTED: LOW QUALITY PROTEIN: von Will 0.851 0.073 0.748 6e-55
338715471 2159 PREDICTED: uncharacterized protein KIAA0 0.839 0.062 0.755 6e-55
297274349 1906 PREDICTED: uncharacterized protein KIAA0 0.839 0.071 0.762 6e-55
355754660 1905 hypothetical protein EGM_08435 [Macaca f 0.839 0.071 0.762 6e-55
355700958 1851 hypothetical protein EGK_09273, partial 0.839 0.073 0.762 6e-55
>gi|363729456|ref|XP_425624.3| PREDICTED: uncharacterized protein KIAA0564-like [Gallus gallus] Back     alignment and taxonomy information
 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 105/139 (75%), Positives = 118/139 (84%)

Query: 23  TDALTQDWLSHLRWILQKDNMSQDVFLIGKPGSLRRSLAMSYLELTQREVEYICLSRDTT 82
           TD+L Q  + HLRWI+QKD + QDVFLIG PG LRRS+AM YLELT+REVEYI LSRDTT
Sbjct: 76  TDSLAQSVVQHLRWIMQKDLLGQDVFLIGPPGPLRRSIAMQYLELTKREVEYIALSRDTT 135

Query: 83  EADIKQRREIVNGTAIYYDQSAVRAAIEGRVLILEGIEKAERNVLPVLNNLLENREMHLE 142
           E D+KQRREI +G+A Y DQ AVRAA EGR+L+LEG+EKAERNVLPVLNNLLENREM LE
Sbjct: 136 ETDLKQRREIRDGSAFYLDQCAVRAATEGRILVLEGLEKAERNVLPVLNNLLENREMQLE 195

Query: 143 DGRFLVSASTYDKLLQVET 161
           DGRFL+SA  YDKLLQ  T
Sbjct: 196 DGRFLMSAERYDKLLQDHT 214




Source: Gallus gallus

Species: Gallus gallus

Genus: Gallus

Family: Phasianidae

Order: Galliformes

Class: Aves

Phylum: Chordata

Superkingdom: Eukaryota

>gi|326914135|ref|XP_003203383.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein KIAA0564-like [Meleagris gallopavo] Back     alignment and taxonomy information
>gi|296203808|ref|XP_002749063.1| PREDICTED: uncharacterized protein KIAA0564 [Callithrix jacchus] Back     alignment and taxonomy information
>gi|426236691|ref|XP_004012301.1| PREDICTED: von Willebrand factor A domain-containing protein 8 [Ovis aries] Back     alignment and taxonomy information
>gi|332241809|ref|XP_003270072.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor A domain-containing protein 8 [Nomascus leucogenys] Back     alignment and taxonomy information
>gi|449484533|ref|XP_004175140.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor A domain-containing protein 8 [Taeniopygia guttata] Back     alignment and taxonomy information
>gi|338715471|ref|XP_001493080.3| PREDICTED: uncharacterized protein KIAA0564-like [Equus caballus] Back     alignment and taxonomy information
>gi|297274349|ref|XP_001091849.2| PREDICTED: uncharacterized protein KIAA0564 isoform 2 [Macaca mulatta] Back     alignment and taxonomy information
>gi|355754660|gb|EHH58561.1| hypothetical protein EGM_08435 [Macaca fascicularis] Back     alignment and taxonomy information
>gi|355700958|gb|EHH28979.1| hypothetical protein EGK_09273, partial [Macaca mulatta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
UNIPROTKB|F1NXF1 1357 F1NXF1 "Uncharacterized protei 0.919 0.109 0.610 3.1e-40
UNIPROTKB|I3LJL2 406 LOC100511470 "Uncharacterized 0.858 0.342 0.624 3.7e-39
UNIPROTKB|F1MIM5 958 Bt.110663 "Uncharacterized pro 0.858 0.145 0.633 6.1e-39
UNIPROTKB|A3KMH1 1905 VWA8 "von Willebrand factor A 0.858 0.072 0.640 1.3e-38
UNIPROTKB|F1MIT3 1828 Bt.110663 "Uncharacterized pro 0.858 0.076 0.633 2e-38
ZFIN|ZDB-GENE-070912-407 1903 vwa8 "von Willebrand factor A 0.851 0.072 0.630 2.7e-38
UNIPROTKB|F1PD22 1904 VWA8 "Uncharacterized protein" 0.858 0.073 0.618 5.6e-38
MGI|MGI:1919008 1905 Vwa8 "von Willebrand factor A 0.858 0.072 0.625 7.2e-38
RGD|1308772 1905 Vwa8 "von Willebrand factor A 0.833 0.070 0.629 8.3e-37
FB|FBgn0040234 1386 c12.2 "c12.2" [Drosophila mela 0.901 0.105 0.549 2.9e-36
UNIPROTKB|F1NXF1 F1NXF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 441 (160.3 bits), Expect = 3.1e-40, P = 3.1e-40
 Identities = 94/154 (61%), Positives = 109/154 (70%)

Query:     8 QEYVRFTLIYLFSVNTDALTQDWLSHLRWILQKDNMSQDVFLIGKPGSLRRSLAMSYLEL 67
             Q Y +F+    F V TD+L Q  + HLRWI+QKD + QDVFLIG PG LRRS+AM YLEL
Sbjct:    23 QNYRKFS----FKV-TDSLAQSVVQHLRWIMQKDLLGQDVFLIGPPGPLRRSIAMQYLEL 77

Query:    68 TQREVEYICLSRDTTEADIKQRREIVNGTAIYYDQSAVRAAIEGRVLILEGIEKAXXXXX 127
             T+REVEYI LSRDTTE D+KQRREI +G+A Y DQ AVRAA EGR+L+LEG+EKA     
Sbjct:    78 TKREVEYIALSRDTTETDLKQRREIRDGSAFYLDQCAVRAATEGRILVLEGLEKAERNVL 137

Query:   128 XXXXXXXXXXXMHLEDGRFLVSASTYDKLLQVET 161
                        M LEDGRFL+SA  YDKLLQ  T
Sbjct:   138 PVLNNLLENREMQLEDGRFLMSAERYDKLLQDHT 171


GO:0016887 "ATPase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=IEA
UNIPROTKB|I3LJL2 LOC100511470 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MIM5 Bt.110663 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|A3KMH1 VWA8 "von Willebrand factor A domain-containing protein 8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MIT3 Bt.110663 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070912-407 vwa8 "von Willebrand factor A domain containing 8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1PD22 VWA8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1919008 Vwa8 "von Willebrand factor A domain containing 8" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1308772 Vwa8 "von Willebrand factor A domain containing 8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0040234 c12.2 "c12.2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B0R0T1VWA8_DANRENo assigned EC number0.74630.84560.0722yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 1e-33
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
 Score =  114 bits (288), Expect = 1e-33
 Identities = 45/110 (40%), Positives = 63/110 (57%), Gaps = 1/110 (0%)

Query: 46  DVFLIGKPGSLRRSLAMSYLE-LTQREVEYICLSRDTTEADIKQRREIVNGTAIYYDQSA 104
            V L+G PG+ +  LA      L+ R V Y+ L+RDTTE D+K RR I  G A + D   
Sbjct: 1   GVLLVGPPGTGKSELAERLAAALSNRPVFYVQLTRDTTEEDLKGRRNIDPGGASWVDGPL 60

Query: 105 VRAAIEGRVLILEGIEKAERNVLPVLNNLLENREMHLEDGRFLVSASTYD 154
           VRAA EG + +L+ I +A  +VL  L +LL+ R + L +G  LV A+   
Sbjct: 61  VRAAREGEIAVLDEINRANPDVLNSLLSLLDERRLLLPEGGELVKAAPDG 110


This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model. Length = 135

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 162
TIGR01650 327 PD_CobS cobaltochelatase, CobS subunit. This model 99.95
TIGR02640 262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.93
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.93
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 99.9
PF07726131 AAA_3: ATPase family associated with various cellu 99.88
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 99.87
COG0714 329 MoxR-like ATPases [General function prediction onl 99.87
PHA02244 383 ATPase-like protein 99.87
KOG1808|consensus 1856 99.85
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.74
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 99.6
COG2256 436 MGS1 ATPase related to the helicase subunit of the 99.6
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 99.58
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 99.58
PRK13407 334 bchI magnesium chelatase subunit I; Provisional 99.58
PRK11331 459 5-methylcytosine-specific restriction enzyme subun 99.56
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.55
PRK13531 498 regulatory ATPase RavA; Provisional 99.54
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.51
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 99.49
KOG2004|consensus 906 99.48
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.46
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.46
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 99.45
TIGR02030 337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.45
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.44
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.43
PRK05342 412 clpX ATP-dependent protease ATP-binding subunit Cl 99.4
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 99.38
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 99.36
CHL00081 350 chlI Mg-protoporyphyrin IX chelatase 99.36
COG0606 490 Predicted ATPase with chaperone activity [Posttran 99.35
TIGR00382 413 clpX endopeptidase Clp ATP-binding regulatory subu 99.35
TIGR00368 499 Mg chelatase-related protein. The N-terminal end m 99.35
KOG2028|consensus 554 99.34
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.34
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.34
PRK09862 506 putative ATP-dependent protease; Provisional 99.34
CHL00095 821 clpC Clp protease ATP binding subunit 99.33
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.32
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.32
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.3
PRK13342 413 recombination factor protein RarA; Reviewed 99.29
PF00004132 AAA: ATPase family associated with various cellula 99.28
smart00350 509 MCM minichromosome maintenance proteins. 99.28
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 99.28
TIGR02974 329 phageshock_pspF psp operon transcriptional activat 99.27
PRK10865 857 protein disaggregation chaperone; Provisional 99.22
COG1221 403 PspF Transcriptional regulators containing an AAA- 99.21
PHA02544 316 44 clamp loader, small subunit; Provisional 99.19
PRK11608 326 pspF phage shock protein operon transcriptional ac 99.19
PRK15424 538 propionate catabolism operon regulatory protein Pr 99.18
TIGR01817 534 nifA Nif-specific regulatory protein. This model r 99.17
PRK11388 638 DNA-binding transcriptional regulator DhaR; Provis 99.15
PRK13341 725 recombination factor protein RarA/unknown domain f 99.12
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.11
PRK05022 509 anaerobic nitric oxide reductase transcription reg 99.11
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 99.1
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.09
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 99.09
TIGR02329 526 propionate_PrpR propionate catabolism operon regul 99.08
PRK04195 482 replication factor C large subunit; Provisional 99.08
PLN03025 319 replication factor C subunit; Provisional 99.08
TIGR02880 284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.07
PRK15429 686 formate hydrogenlyase transcriptional activator Fh 99.07
COG1239 423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 99.07
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 99.06
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.06
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.06
COG3829 560 RocR Transcriptional regulator containing PAS, AAA 99.05
KOG1051|consensus 898 99.05
PF00493 331 MCM: MCM2/3/5 family This family extends the MCM d 99.04
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.03
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 99.02
KOG0743|consensus 457 99.01
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.01
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.0
CHL00181 287 cbbX CbbX; Provisional 99.0
COG2204 464 AtoC Response regulator containing CheY-like recei 98.99
PTZ00111 915 DNA replication licensing factor MCM4; Provisional 98.99
PRK10820 520 DNA-binding transcriptional regulator TyrR; Provis 98.98
KOG0733|consensus 802 98.98
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.97
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 98.97
smart00382148 AAA ATPases associated with a variety of cellular 98.96
COG3604 550 FhlA Transcriptional regulator containing GAF, AAA 98.96
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 98.95
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 98.94
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 98.94
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 98.93
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 98.93
PRK11361 457 acetoacetate metabolism regulatory protein AtoC; P 98.92
PRK12377248 putative replication protein; Provisional 98.92
TIGR02915 445 PEP_resp_reg putative PEP-CTERM system response re 98.91
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 98.91
PRK08084235 DNA replication initiation factor; Provisional 98.9
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 98.9
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 98.89
PRK08116268 hypothetical protein; Validated 98.89
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.89
PRK07940 394 DNA polymerase III subunit delta'; Validated 98.88
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 98.88
PRK10923 469 glnG nitrogen regulation protein NR(I); Provisiona 98.87
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 98.87
CHL00195 489 ycf46 Ycf46; Provisional 98.86
PF12775 272 AAA_7: P-loop containing dynein motor region D3; P 98.86
PRK03992 389 proteasome-activating nucleotidase; Provisional 98.85
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 98.85
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 98.84
CHL00176 638 ftsH cell division protein; Validated 98.84
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 98.84
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.84
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 98.83
PRK07952244 DNA replication protein DnaC; Validated 98.83
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 98.83
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 98.82
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.82
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 98.81
KOG0989|consensus 346 98.81
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.81
PRK08181269 transposase; Validated 98.8
PRK06620214 hypothetical protein; Validated 98.8
PF13173128 AAA_14: AAA domain 98.8
PRK15115 444 response regulator GlrR; Provisional 98.79
PRK12402 337 replication factor C small subunit 2; Reviewed 98.79
PRK10865 857 protein disaggregation chaperone; Provisional 98.79
KOG0734|consensus 752 98.79
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 98.78
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 98.77
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 98.77
KOG0727|consensus408 98.77
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 98.76
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 98.76
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 98.75
KOG0745|consensus 564 98.75
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 98.75
PRK06893229 DNA replication initiation factor; Validated 98.73
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 98.73
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 98.73
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 98.72
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 98.72
PRK06526254 transposase; Provisional 98.72
COG4650 531 RtcR Sigma54-dependent transcription regulator con 98.72
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.71
CHL00095 821 clpC Clp protease ATP binding subunit 98.71
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 98.7
PRK00440 319 rfc replication factor C small subunit; Reviewed 98.69
PRK10365 441 transcriptional regulatory protein ZraR; Provision 98.69
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 98.69
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 98.69
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 98.69
COG1241 682 MCM2 Predicted ATPase involved in replication cont 98.69
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 98.68
KOG1969|consensus 877 98.68
TIGR01818 463 ntrC nitrogen regulation protein NR(I). This model 98.67
PRK08939306 primosomal protein DnaI; Reviewed 98.67
KOG0478|consensus 804 98.67
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 98.66
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 98.66
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 98.66
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 98.66
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 98.65
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 98.64
COG0470 325 HolB ATPase involved in DNA replication [DNA repli 98.64
PRK08727233 hypothetical protein; Validated 98.64
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 98.63
PRK06921266 hypothetical protein; Provisional 98.63
PRK13765 637 ATP-dependent protease Lon; Provisional 98.62
KOG1808|consensus 1856 98.62
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 98.62
PRK05642234 DNA replication initiation factor; Validated 98.62
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 98.61
PRK09183259 transposase/IS protein; Provisional 98.6
PRK00411 394 cdc6 cell division control protein 6; Reviewed 98.6
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 98.6
KOG0480|consensus 764 98.6
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 98.58
CHL00206 2281 ycf2 Ycf2; Provisional 98.58
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 98.57
COG3284 606 AcoR Transcriptional activator of acetoin/glycerol 98.56
KOG0738|consensus 491 98.56
PRK00149 450 dnaA chromosomal replication initiation protein; R 98.54
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 98.54
KOG0737|consensus 386 98.54
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 98.52
PRK06835329 DNA replication protein DnaC; Validated 98.51
KOG0733|consensus 802 98.51
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 98.51
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 98.51
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.5
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 98.49
TIGR02688 449 conserved hypothetical protein TIGR02688. Members 98.49
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 98.48
KOG0731|consensus 774 98.48
KOG0991|consensus 333 98.47
PRK14088 440 dnaA chromosomal replication initiation protein; P 98.46
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 98.46
KOG0735|consensus 952 98.45
PRK08058 329 DNA polymerase III subunit delta'; Validated 98.45
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.44
KOG0742|consensus 630 98.44
KOG0730|consensus 693 98.44
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 98.43
PRK09112 351 DNA polymerase III subunit delta'; Validated 98.4
KOG0477|consensus 854 98.4
COG3283 511 TyrR Transcriptional regulator of aromatic amino a 98.4
PTZ00112 1164 origin recognition complex 1 protein; Provisional 98.4
PRK09087226 hypothetical protein; Validated 98.38
PRK12422 445 chromosomal replication initiation protein; Provis 98.36
PRK05707 328 DNA polymerase III subunit delta'; Validated 98.36
PRK14086 617 dnaA chromosomal replication initiation protein; P 98.36
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 98.35
PRK05564 313 DNA polymerase III subunit delta'; Validated 98.35
KOG0739|consensus 439 98.31
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 98.31
PRK07471 365 DNA polymerase III subunit delta'; Validated 98.3
KOG0651|consensus388 98.27
PHA00729226 NTP-binding motif containing protein 98.25
KOG0726|consensus 440 98.25
KOG0741|consensus744 98.25
PRK04296190 thymidine kinase; Provisional 98.23
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 98.22
PF01443 234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 98.22
KOG0736|consensus 953 98.21
PRK14087 450 dnaA chromosomal replication initiation protein; P 98.21
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 98.21
COG1618179 Predicted nucleotide kinase [Nucleotide transport 98.2
KOG0652|consensus 424 98.19
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 98.18
PF05970 364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 98.17
KOG0741|consensus 744 98.15
PRK13947171 shikimate kinase; Provisional 98.13
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.13
PF12780 268 AAA_8: P-loop containing dynein motor region D4; I 98.11
KOG0729|consensus 435 98.11
PRK00131175 aroK shikimate kinase; Reviewed 98.11
PRK10536262 hypothetical protein; Provisional 98.11
KOG0728|consensus 404 98.08
PRK08118167 topology modulation protein; Reviewed 98.08
KOG3347|consensus176 98.07
COG1220 444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 98.07
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 98.07
PRK07993 334 DNA polymerase III subunit delta'; Validated 98.06
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 98.06
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 98.06
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 98.06
PHA02774613 E1; Provisional 98.05
PRK08699 325 DNA polymerase III subunit delta'; Validated 98.04
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 98.04
PF06068 398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 98.03
PRK07399 314 DNA polymerase III subunit delta'; Validated 98.03
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 98.03
PRK03839180 putative kinase; Provisional 98.02
cd01128 249 rho_factor Transcription termination factor rho is 98.02
KOG2170|consensus 344 98.01
PRK13695174 putative NTPase; Provisional 98.01
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 98.0
PRK00625173 shikimate kinase; Provisional 97.99
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 97.98
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein 97.98
PRK06871 325 DNA polymerase III subunit delta'; Validated 97.98
PRK14530215 adenylate kinase; Provisional 97.96
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 97.96
PRK13949169 shikimate kinase; Provisional 97.95
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 97.94
PRK14532188 adenylate kinase; Provisional 97.94
PRK13946184 shikimate kinase; Provisional 97.93
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 97.91
PRK03731171 aroL shikimate kinase II; Reviewed 97.91
KOG0730|consensus 693 97.91
PRK07261171 topology modulation protein; Provisional 97.91
COG4178604 ABC-type uncharacterized transport system, permeas 97.9
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 97.9
COG0593 408 DnaA ATPase involved in DNA replication initiation 97.89
COG0703172 AroK Shikimate kinase [Amino acid transport and me 97.89
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 97.89
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 97.89
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 97.88
PRK14531183 adenylate kinase; Provisional 97.87
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 97.87
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 97.86
PRK06217183 hypothetical protein; Validated 97.86
PRK08769 319 DNA polymerase III subunit delta'; Validated 97.86
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 97.86
PRK06090 319 DNA polymerase III subunit delta'; Validated 97.86
KOG0482|consensus 721 97.85
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 97.85
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 97.84
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 97.83
KOG0481|consensus 729 97.83
PF03969 362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 97.82
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 97.81
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 97.81
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 97.81
PHA02624 647 large T antigen; Provisional 97.81
PRK06762166 hypothetical protein; Provisional 97.81
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 97.8
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 97.8
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 97.79
PRK04132 846 replication factor C small subunit; Provisional 97.79
PRK06964 342 DNA polymerase III subunit delta'; Validated 97.78
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 97.78
PRK05057172 aroK shikimate kinase I; Reviewed 97.77
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 97.77
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 97.77
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 97.77
PLN02165 334 adenylate isopentenyltransferase 97.76
PRK02496184 adk adenylate kinase; Provisional 97.75
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.75
PRK08154309 anaerobic benzoate catabolism transcriptional regu 97.74
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 97.74
PRK05917 290 DNA polymerase III subunit delta'; Validated 97.73
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 97.73
KOG0744|consensus 423 97.73
PRK13833323 conjugal transfer protein TrbB; Provisional 97.72
PRK14528186 adenylate kinase; Provisional 97.72
KOG0740|consensus 428 97.72
cd03246173 ABCC_Protease_Secretion This family represents the 97.71
PLN02199303 shikimate kinase 97.71
KOG0990|consensus 360 97.71
PF1324576 AAA_19: Part of AAA domain 97.71
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 97.71
TIGR00767 415 rho transcription termination factor Rho. Members 97.69
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 97.68
PRK13948182 shikimate kinase; Provisional 97.68
PRK04182180 cytidylate kinase; Provisional 97.68
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.67
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 97.67
PTZ00088 229 adenylate kinase 1; Provisional 97.67
KOG0058|consensus 716 97.67
PRK05973237 replicative DNA helicase; Provisional 97.66
PRK13894319 conjugal transfer ATPase TrbB; Provisional 97.66
PF13086 236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 97.66
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 97.66
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 97.65
PF07931174 CPT: Chloramphenicol phosphotransferase-like prote 97.64
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 97.64
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 97.64
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 97.64
cd03216163 ABC_Carb_Monos_I This family represents the domain 97.63
cd00984 242 DnaB_C DnaB helicase C terminal domain. The hexame 97.63
PRK04841 903 transcriptional regulator MalT; Provisional 97.62
TIGR02533 486 type_II_gspE general secretory pathway protein E. 97.62
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 97.62
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 97.61
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 97.61
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 97.61
COG0467 260 RAD55 RecA-superfamily ATPases implicated in signa 97.6
smart00487201 DEXDc DEAD-like helicases superfamily. 97.59
PRK14527191 adenylate kinase; Provisional 97.59
PRK06696223 uridine kinase; Validated 97.58
PRK08233182 hypothetical protein; Provisional 97.57
PRK15455 644 PrkA family serine protein kinase; Provisional 97.56
PRK00279215 adk adenylate kinase; Reviewed 97.56
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 97.56
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 97.55
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 97.55
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 97.55
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 97.55
PLN02674244 adenylate kinase 97.54
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 97.52
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 97.52
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 97.52
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 97.51
PRK06547172 hypothetical protein; Provisional 97.51
cd03115173 SRP The signal recognition particle (SRP) mediates 97.5
TIGR02538 564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 97.5
PLN02200234 adenylate kinase family protein 97.5
PRK13851344 type IV secretion system protein VirB11; Provision 97.49
PRK01184184 hypothetical protein; Provisional 97.48
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 97.47
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 97.46
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 97.46
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.46
PF05729166 NACHT: NACHT domain 97.45
PRK10436 462 hypothetical protein; Provisional 97.45
COG1936180 Predicted nucleotide kinase (related to CMP and AM 97.45
PRK14526211 adenylate kinase; Provisional 97.45
PRK07132 299 DNA polymerase III subunit delta'; Validated 97.44
PRK04040188 adenylate kinase; Provisional 97.44
PHA02530 300 pseT polynucleotide kinase; Provisional 97.43
PRK13975196 thymidylate kinase; Provisional 97.43
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 97.42
PRK05541176 adenylylsulfate kinase; Provisional 97.41
PRK10646153 ADP-binding protein; Provisional 97.41
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 97.41
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 97.41
PRK00300205 gmk guanylate kinase; Provisional 97.4
PRK09825176 idnK D-gluconate kinase; Provisional 97.4
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 97.39
TIGR03574 249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 97.39
PRK14529 223 adenylate kinase; Provisional 97.39
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 97.37
TIGR03878 259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 97.37
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 97.36
PRK13764 602 ATPase; Provisional 97.36
PRK00889175 adenylylsulfate kinase; Provisional 97.35
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 97.34
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 97.33
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.33
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 97.33
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 97.33
KOG0735|consensus 952 97.33
cd01394218 radB RadB. The archaeal protein radB shares simila 97.32
PRK05480209 uridine/cytidine kinase; Provisional 97.31
TIGR02768 744 TraA_Ti Ti-type conjugative transfer relaxase TraA 97.3
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 97.29
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 97.29
PRK09361225 radB DNA repair and recombination protein RadB; Pr 97.29
cd01122 271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 97.29
KOG1970|consensus 634 97.28
TIGR00235207 udk uridine kinase. Model contains a number of lon 97.27
PRK10875 615 recD exonuclease V subunit alpha; Provisional 97.26
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 97.25
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 97.25
COG1116 248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 97.25
TIGR02524 358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 97.24
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 97.24
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.24
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.24
KOG1942|consensus 456 97.23
PRK14738206 gmk guanylate kinase; Provisional 97.23
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 97.22
cd01121 372 Sms Sms (bacterial radA) DNA repair protein. This 97.22
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 97.21
COG0324 308 MiaA tRNA delta(2)-isopentenylpyrophosphate transf 97.21
KOG0479|consensus 818 97.21
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 97.2
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.2
PLN02459 261 probable adenylate kinase 97.2
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 97.19
PHA02653 675 RNA helicase NPH-II; Provisional 97.19
PRK12608 380 transcription termination factor Rho; Provisional 97.19
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 97.19
COG4088 261 Predicted nucleotide kinase [Nucleotide transport 97.18
PRK04328 249 hypothetical protein; Provisional 97.18
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 97.17
COG0802149 Predicted ATPase or kinase [General function predi 97.17
PRK12339197 2-phosphoglycerate kinase; Provisional 97.17
TIGR00750 300 lao LAO/AO transport system ATPase. Mutations have 97.17
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 97.17
COG4525 259 TauB ABC-type taurine transport system, ATPase com 97.16
KOG0060|consensus659 97.15
PF03029 238 ATP_bind_1: Conserved hypothetical ATP binding pro 97.13
PRK09376 416 rho transcription termination factor Rho; Provisio 97.13
PRK14021 542 bifunctional shikimate kinase/3-dehydroquinate syn 97.13
PRK09270229 nucleoside triphosphate hydrolase domain-containin 97.13
PRK14974336 cell division protein FtsY; Provisional 97.12
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.12
PRK08356195 hypothetical protein; Provisional 97.12
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 97.11
PF01745 233 IPT: Isopentenyl transferase; InterPro: IPR002648 97.11
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 97.1
COG1373 398 Predicted ATPase (AAA+ superfamily) [General funct 97.1
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 97.1
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 97.1
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 97.09
PRK07667193 uridine kinase; Provisional 97.09
PRK11545163 gntK gluconate kinase 1; Provisional 97.08
TIGR01526325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 97.08
PRK08099399 bifunctional DNA-binding transcriptional repressor 97.06
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.06
COG1485 367 Predicted ATPase [General function prediction only 97.06
KOG0732|consensus 1080 97.06
COG2804 500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 97.05
PF05272198 VirE: Virulence-associated protein E; InterPro: IP 97.05
TIGR02236310 recomb_radA DNA repair and recombination protein R 97.05
PRK06067234 flagellar accessory protein FlaH; Validated 97.04
PF00005137 ABC_tran: ABC transporter This structure is on hol 97.04
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 97.04
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 97.04
COG4619223 ABC-type uncharacterized transport system, ATPase 97.04
TIGR00174 287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 97.04
PRK14730195 coaE dephospho-CoA kinase; Provisional 97.03
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 97.03
PRK04301317 radA DNA repair and recombination protein RadA; Va 97.03
KOG0927|consensus614 97.03
PRK00771 437 signal recognition particle protein Srp54; Provisi 97.02
PRK13973213 thymidylate kinase; Provisional 97.01
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 97.01
PRK06761 282 hypothetical protein; Provisional 97.0
PRK09302 509 circadian clock protein KaiC; Reviewed 97.0
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 97.0
PLN03130 1622 ABC transporter C family member; Provisional 97.0
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 96.99
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 96.99
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 96.98
PF00931 287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 96.98
PRK06851367 hypothetical protein; Provisional 96.98
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.98
KOG0922|consensus 674 96.98
KOG0736|consensus 953 96.98
PF08433 270 KTI12: Chromatin associated protein KTI12 ; InterP 96.98
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 96.96
cd01393226 recA_like RecA is a bacterial enzyme which has rol 96.96
PRK13808 333 adenylate kinase; Provisional 96.95
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 96.94
PF1355562 AAA_29: P-loop containing region of AAA domain 96.94
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 96.94
PRK13826 1102 Dtr system oriT relaxase; Provisional 96.93
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
Probab=99.95  E-value=1.9e-27  Score=202.39  Aligned_cols=124  Identities=15%  Similarity=0.182  Sum_probs=110.8

Q ss_pred             HHHHhcCCCCcEEEEcCCCchHHHHHHHHHHHhCCceEEEEeccCCChhhhcceeEe--ecCe--EEEeccHHHHHhhcC
Q psy4122          36 WILQKDNMSQDVFLIGKPGSLRRSLAMSYLELTQREVEYICLSRDTTEADIKQRREI--VNGT--AIYYDQSAVRAAIEG  111 (162)
Q Consensus        36 ~i~~~~~~g~~vlL~GppG~GKT~La~~lA~~lg~p~~~v~~~~~~~~~dL~g~~~~--~~G~--~~~~~gpl~~A~~~G  111 (162)
                      .++.++..+++++|+||||||||++++++|+.+|+|+.+++++++++..||+|...+  ++|.  +.|++||+..|+++|
T Consensus        56 ~vl~~l~~~~~ilL~G~pGtGKTtla~~lA~~l~~~~~rV~~~~~l~~~DliG~~~~~l~~g~~~~~f~~GpL~~A~~~g  135 (327)
T TIGR01650        56 AICAGFAYDRRVMVQGYHGTGKSTHIEQIAARLNWPCVRVNLDSHVSRIDLVGKDAIVLKDGKQITEFRDGILPWALQHN  135 (327)
T ss_pred             HHHHHHhcCCcEEEEeCCCChHHHHHHHHHHHHCCCeEEEEecCCCChhhcCCCceeeccCCcceeEEecCcchhHHhCC
Confidence            355555568899999999999999999999999999999999999999999997554  3553  899999999999999


Q ss_pred             cEEEEeCCCCCCccHHHHHHHhhc-CCeEEEcC-CcEEecCcchHhhhhh
Q psy4122         112 RVLILEGIEKAERNVLPVLNNLLE-NREMHLED-GRFLVSASTYDKLLQV  159 (162)
Q Consensus       112 ~vlllDEId~a~~~v~~~L~~lle-~r~l~l~~-g~~i~~~~~f~~~~~~  159 (162)
                      .|+++||||+++|+++++|+++|| +|++++++ ++.+.+||+|+.++=+
T Consensus       136 ~illlDEin~a~p~~~~~L~~lLE~~~~l~i~~~~~~i~~hp~FrviAT~  185 (327)
T TIGR01650       136 VALCFDEYDAGRPDVMFVIQRVLEAGGKLTLLDQNRVIRAHPAFRLFATA  185 (327)
T ss_pred             eEEEechhhccCHHHHHHHHHHhccCCeEEECCCceEecCCCCeEEEEee
Confidence            999999999999999999999999 57999986 7777799999988743



This model describes the aerobic cobalamin pathway Pseudomonas denitrificans CobS gene product, which is a cobalt chelatase subunit, with a MW ~37 kDa. The aerobic pathway cobalt chelatase is a heterotrimeric, ATP-dependent enzyme that catalyzes cobalt insertion during cobalamin biosynthesis. The other two subunits are the P. denitrificans CobT (TIGR01651) and CobN (pfam02514 CobN/Magnesium Chelatase) proteins. To avoid potential confusion with the nonhomologous Salmonella typhimurium/E.coli cobS gene product, the P. denitrificans gene symbol is not used in the name of this model.

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>KOG1808|consensus Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2004|consensus Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG1051|consensus Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0745|consensus Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG1969|consensus Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>KOG0478|consensus Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>KOG1808|consensus Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0480|consensus Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0477|consensus Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG0728|consensus Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>KOG3347|consensus Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>KOG2170|consensus Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0482|consensus Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>KOG0481|consensus Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>KOG0990|consensus Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>KOG1970|consensus Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>KOG1942|consensus Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0479|consensus Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>COG0802 Predicted ATPase or kinase [General function prediction only] Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0060|consensus Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>KOG0927|consensus Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
2r44_A 331 Uncharacterized protein; putative ATPase, structur 99.74
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.56
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.54
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 99.54
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 99.51
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 99.51
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.51
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.5
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.47
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.46
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 99.46
3co5_A143 Putative two-component system transcriptional RES 99.45
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 99.43
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 99.43
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 99.42
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 99.41
3f8t_A 506 Predicted ATPase involved in replication control, 99.41
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.4
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 99.39
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.36
3pvs_A 447 Replication-associated recombination protein A; ma 99.34
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 99.33
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 99.29
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 99.24
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 99.23
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.23
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.23
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.22
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.22
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 99.21
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 99.2
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.2
3bos_A242 Putative DNA replication factor; P-loop containing 99.19
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.19
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.17
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.17
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 99.15
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.14
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPa 99.13
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 99.11
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 99.11
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 99.11
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 99.1
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 99.08
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.07
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.07
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.05
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 99.04
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 99.03
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 99.02
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.02
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 99.01
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 99.01
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.01
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 99.0
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 99.0
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 98.99
2chq_A 319 Replication factor C small subunit; DNA-binding pr 98.99
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 98.98
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 98.97
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 98.97
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 98.97
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 98.97
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 98.96
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.95
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 98.93
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 98.91
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 98.91
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 98.9
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 98.89
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 98.88
2qgz_A308 Helicase loader, putative primosome component; str 98.87
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 98.86
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 98.85
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 98.85
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 98.85
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 98.85
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 98.84
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 98.82
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 98.8
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 98.79
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 98.78
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 98.77
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 98.72
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 98.66
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 98.63
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 98.63
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 98.6
1tue_A212 Replication protein E1; helicase, replication, E1E 98.59
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 98.57
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 98.56
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 98.55
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.48
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 98.47
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 98.46
2fna_A 357 Conserved hypothetical protein; structural genomic 98.45
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 98.33
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 98.29
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 98.25
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 98.2
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 98.19
3vaa_A199 Shikimate kinase, SK; structural genomics, center 98.17
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 98.15
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 98.15
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 98.15
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 98.12
1kag_A173 SKI, shikimate kinase I; transferase, structural g 98.09
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 98.08
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 98.05
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 98.05
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 98.05
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 98.01
1via_A175 Shikimate kinase; structural genomics, transferase 98.01
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 98.0
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 97.99
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 97.97
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 97.95
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 97.93
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 97.93
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 97.92
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.92
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 97.91
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 97.91
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 97.9
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.89
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 97.89
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 97.88
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 97.88
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 97.88
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 97.87
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 97.87
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.86
2vli_A183 Antibiotic resistance protein; transferase, tunica 97.86
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 97.85
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 97.85
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 97.84
2eyu_A 261 Twitching motility protein PILT; pilus retraction 97.84
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 97.81
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 97.81
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 97.8
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 97.8
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 97.8
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 97.79
3tlx_A243 Adenylate kinase 2; structural genomics, structura 97.79
2ewv_A 372 Twitching motility protein PILT; pilus retraction 97.78
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 97.78
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 97.78
1zd8_A 227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 97.76
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 97.76
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 97.75
1cke_A 227 CK, MSSA, protein (cytidine monophosphate kinase); 97.75
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 97.74
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.74
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 97.73
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 97.72
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 97.72
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.71
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 97.7
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 97.7
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 97.69
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 97.69
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 97.68
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 97.68
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 97.68
2xb4_A 223 Adenylate kinase; ATP-binding, nucleotide-binding, 97.65
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 97.64
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 97.62
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 97.62
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 97.61
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 97.61
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 97.61
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 97.6
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 97.59
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 97.59
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 97.58
3vkw_A 446 Replicase large subunit; alpha/beta domain, helica 97.58
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 97.56
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 97.55
1n0w_A 243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.55
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 97.55
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 97.54
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 97.51
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 97.51
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 97.51
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 97.51
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 97.51
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.51
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 97.5
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 97.49
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 97.47
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 97.47
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 97.45
1q3t_A 236 Cytidylate kinase; nucleotide monophosphate kinase 97.45
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 97.44
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 97.43
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 97.42
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 97.41
3r20_A 233 Cytidylate kinase; structural genomics, seattle st 97.4
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 97.4
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 97.39
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 97.39
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 97.39
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 97.38
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 97.38
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 97.38
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 97.37
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 97.36
2zts_A 251 Putative uncharacterized protein PH0186; KAIC like 97.36
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 97.35
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 97.35
4a74_A231 DNA repair and recombination protein RADA; hydrola 97.33
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 97.32
1uj2_A 252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 97.3
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.3
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 97.3
1jr3_D 343 DNA polymerase III, delta subunit; processivity, p 97.3
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 97.29
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.28
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 97.27
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 97.26
1p9r_A 418 General secretion pathway protein E; bacterial typ 97.26
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 97.25
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 97.25
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 97.25
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 97.23
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 97.23
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 97.22
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 97.21
2jeo_A 245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 97.21
2z43_A324 DNA repair and recombination protein RADA; archaea 97.19
2r6a_A 454 DNAB helicase, replicative helicase; replication, 97.18
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 97.15
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 97.13
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 97.13
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 97.13
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 97.11
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 97.11
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 97.1
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 97.1
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 97.09
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 97.09
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 97.08
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 97.08
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 97.07
3bgw_A 444 DNAB-like replicative helicase; ATPase, replicatio 97.06
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 97.05
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 97.04
2hf9_A226 Probable hydrogenase nickel incorporation protein 97.03
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 97.02
1q57_A 503 DNA primase/helicase; dntpase, DNA replication, tr 97.01
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 97.0
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 96.99
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 96.99
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 96.96
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 96.96
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 96.95
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 96.93
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 96.93
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 96.88
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 96.87
2ged_A193 SR-beta, signal recognition particle receptor beta 96.87
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.87
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 96.86
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 96.86
3gmt_A 230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 96.86
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 96.85
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 96.85
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 96.85
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 96.85
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 96.84
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 96.83
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 96.82
3kta_A182 Chromosome segregation protein SMC; structural mai 96.81
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 96.81
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 96.8
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.79
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 96.79
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 96.79
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 96.79
3io5_A 333 Recombination and repair protein; storage dimer, i 96.79
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 96.78
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 96.78
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 96.78
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 96.78
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 96.77
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 96.77
1u94_A 356 RECA protein, recombinase A; homologous recombinat 96.76
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 96.76
2i1q_A 322 DNA repair and recombination protein RADA; ATPase, 96.75
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 96.75
1b0u_A 262 Histidine permease; ABC transporter, transport pro 96.75
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 96.74
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 96.74
2wji_A165 Ferrous iron transport protein B homolog; membrane 96.72
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 96.72
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 96.72
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 96.72
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 96.72
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 96.72
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 96.71
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 96.71
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 96.71
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 96.71
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 96.71
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 96.69
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 96.69
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 96.69
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 96.68
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 96.68
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 96.67
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 96.67
1g6h_A 257 High-affinity branched-chain amino acid transport 96.67
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 96.67
1sgw_A214 Putative ABC transporter; structural genomics, P p 96.67
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 96.67
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 96.66
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 96.65
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 96.65
1ji0_A240 ABC transporter; ATP binding protein, structural g 96.65
2ocp_A 241 DGK, deoxyguanosine kinase; protein-nucleotide com 96.65
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 96.64
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 96.64
1nrj_B218 SR-beta, signal recognition particle receptor beta 96.64
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 96.64
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 96.64
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 96.64
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 96.64
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 96.63
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 96.63
3lda_A 400 DNA repair protein RAD51; DNA binding protein, ATP 96.63
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 96.63
1xp8_A 366 RECA protein, recombinase A; recombination, radior 96.62
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 96.62
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 96.62
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.61
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 96.61
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 96.61
3h1t_A 590 Type I site-specific restriction-modification syst 96.6
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 96.6
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 96.59
3sop_A 270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 96.59
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 96.59
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 96.58
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 96.58
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 96.58
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 96.57
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 96.57
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 96.57
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 96.57
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 96.56
2ghi_A260 Transport protein; multidrug resistance protein, M 96.56
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 96.56
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 96.56
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 96.55
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 96.55
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 96.54
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 96.53
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 96.53
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 96.53
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 96.53
1vma_A306 Cell division protein FTSY; TM0570, structural gen 96.52
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 96.52
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 96.52
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 96.51
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 96.51
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 96.51
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 96.51
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 96.5
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 96.5
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 96.5
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 96.5
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 96.49
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 96.49
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 96.49
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 96.49
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 96.49
1xjc_A169 MOBB protein homolog; structural genomics, midwest 96.48
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 96.48
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 96.48
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 96.48
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 96.47
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 96.46
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 96.46
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 96.45
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 96.45
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 96.44
3iby_A 256 Ferrous iron transport protein B; G protein, G dom 96.43
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 96.43
3b6e_A216 Interferon-induced helicase C domain-containing P; 96.43
2og2_A359 Putative signal recognition particle receptor; nuc 96.43
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 96.42
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 96.42
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 96.41
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 96.41
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 96.41
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 96.4
1p5z_B 263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 96.4
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 96.4
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 96.39
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 96.39
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 96.39
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 96.39
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 96.38
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 96.38
1a7j_A 290 Phosphoribulokinase; transferase, calvin cycle; 2. 96.38
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 96.38
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 96.38
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 96.38
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 96.37
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 96.37
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 96.36
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 96.36
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 96.36
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 96.36
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 96.36
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 96.36
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 96.35
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 96.35
3t1o_A198 Gliding protein MGLA; G domain containing protein, 96.34
1yrb_A 262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 96.34
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 96.34
3i8s_A 274 Ferrous iron transport protein B; GTPase, GPCR, ir 96.34
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 96.33
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 96.33
3ice_A 422 Transcription termination factor RHO; transcriptio 96.32
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 96.32
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 96.32
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 96.32
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 96.32
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 96.32
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 96.32
1h65_A 270 Chloroplast outer envelope protein OEP34; GTPase, 96.32
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 96.29
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 96.29
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 96.29
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 96.29
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 96.27
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 96.25
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 96.25
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 96.25
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 96.24
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 96.24
2fh5_B214 SR-beta, signal recognition particle receptor beta 96.24
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 96.24
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 96.24
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 96.23
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 96.21
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 96.21
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 96.21
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 96.19
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 96.18
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 96.18
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 96.18
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 96.18
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 96.17
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 96.17
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 96.16
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 96.15
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 96.15
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 96.15
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 96.14
3lxx_A239 GTPase IMAP family member 4; structural genomics c 96.13
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 96.13
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 96.13
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 96.12
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 96.11
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 96.11
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 96.1
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 96.09
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 96.09
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 96.08
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 96.08
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 96.06
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 96.06
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 96.06
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 96.06
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 96.05
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 96.02
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 96.02
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 96.02
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 95.99
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 95.98
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 95.98
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 95.97
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 95.95
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 95.95
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 95.94
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 95.93
2xtp_A 260 GTPase IMAP family member 2; immune system, G prot 95.92
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 95.92
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 95.89
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 95.88
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 95.88
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 95.88
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 95.87
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 95.86
3a1s_A 258 Iron(II) transport protein B; FEOB, iron transport 95.86
2aka_B 299 Dynamin-1; fusion protein, GTPase domain, myosin, 95.86
3llu_A196 RAS-related GTP-binding protein C; structural geno 95.86
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 95.85
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
Probab=99.74  E-value=8.2e-18  Score=139.14  Aligned_cols=94  Identities=11%  Similarity=0.172  Sum_probs=83.5

Q ss_pred             CCcEEEEcCCCchHHHHHHHHHHHhCCceEEEEeccCCChhhhcceeEee--cCeEEEeccHHHHHhhcCcEEEEeCCCC
Q psy4122          44 SQDVFLIGKPGSLRRSLAMSYLELTQREVEYICLSRDTTEADIKQRREIV--NGTAIYYDQSAVRAAIEGRVLILEGIEK  121 (162)
Q Consensus        44 g~~vlL~GppG~GKT~La~~lA~~lg~p~~~v~~~~~~~~~dL~g~~~~~--~G~~~~~~gpl~~A~~~G~vlllDEId~  121 (162)
                      +.+++|+||||||||++|+.+|+.++.++..++++.+++.+++.|.....  .|.+.|.+|++     .+++++|||||+
T Consensus        46 ~~~vll~G~pGtGKT~la~~la~~~~~~~~~i~~~~~~~~~~l~g~~~~~~~~~~~~~~~g~l-----~~~vl~iDEi~~  120 (331)
T 2r44_A           46 GGHILLEGVPGLAKTLSVNTLAKTMDLDFHRIQFTPDLLPSDLIGTMIYNQHKGNFEVKKGPV-----FSNFILADEVNR  120 (331)
T ss_dssp             TCCEEEESCCCHHHHHHHHHHHHHTTCCEEEEECCTTCCHHHHHEEEEEETTTTEEEEEECTT-----CSSEEEEETGGG
T ss_pred             CCeEEEECCCCCcHHHHHHHHHHHhCCCeEEEecCCCCChhhcCCceeecCCCCceEeccCcc-----cccEEEEEcccc
Confidence            67999999999999999999999999999999999999999999865543  46777888775     468999999999


Q ss_pred             CCccHHHHHHHhhcCCeEEEc
Q psy4122         122 AERNVLPVLNNLLENREMHLE  142 (162)
Q Consensus       122 a~~~v~~~L~~lle~r~l~l~  142 (162)
                      +++++++.|+++++++.+.+.
T Consensus       121 ~~~~~~~~Ll~~l~~~~~~~~  141 (331)
T 2r44_A          121 SPAKVQSALLECMQEKQVTIG  141 (331)
T ss_dssp             SCHHHHHHHHHHHHHSEEEET
T ss_pred             CCHHHHHHHHHHHhcCceeeC
Confidence            999999999999999987763



>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.68
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.57
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.53
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 99.52
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.51
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.5
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 99.33
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.22
d1ny5a2 247 Transcriptional activator sigm54 (NtrC1), C-termin 99.19
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.13
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.12
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.11
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.09
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.07
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.06
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.03
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.02
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 98.99
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.89
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.88
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.88
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.87
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 98.86
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.77
d1svma_362 Papillomavirus large T antigen helicase domain {Si 98.73
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 98.72
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 98.71
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.71
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.66
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.65
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 98.64
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.62
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 98.57
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 98.52
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 98.5
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 98.49
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 98.44
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 98.42
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 98.36
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 98.33
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 98.32
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 98.31
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 98.3
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 98.24
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 98.2
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 98.19
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 98.19
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 98.13
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 98.13
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 98.13
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 98.12
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 98.11
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 98.11
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 98.1
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 98.09
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 98.03
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 98.02
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 98.01
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.99
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 97.99
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.98
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.95
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.94
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 97.91
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 97.91
d1tuea_205 Replication protein E1 helicase domain {Human papi 97.89
d1ckea_ 225 CMP kinase {Escherichia coli [TaxId: 562]} 97.88
d1q3ta_ 223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 97.81
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 97.8
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.8
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.77
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 97.71
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.71
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 97.7
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 97.69
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 97.68
d2hyda1255 Putative multidrug export ATP-binding/permease pro 97.67
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 97.63
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 97.61
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 97.58
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.5
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.49
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 97.49
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 97.49
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 97.46
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 97.3
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 97.28
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 97.23
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 97.23
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 97.2
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 97.2
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 97.17
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 97.13
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 97.09
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 97.08
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 97.06
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 97.05
d1vmaa2213 GTPase domain of the signal recognition particle r 97.02
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 97.01
d1okkd2207 GTPase domain of the signal recognition particle r 97.01
d2fh5b1207 Signal recognition particle receptor beta-subunit 97.0
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 96.99
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.98
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.98
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 96.95
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 96.95
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 96.94
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 96.94
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 96.92
d2qy9a2211 GTPase domain of the signal recognition particle r 96.91
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.91
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.9
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 96.89
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 96.86
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 96.86
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 96.85
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 96.85
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 96.85
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 96.85
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 96.83
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 96.83
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 96.83
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 96.82
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 96.82
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 96.82
d1nrjb_209 Signal recognition particle receptor beta-subunit 96.82
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 96.81
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 96.8
d2awna2232 Maltose transport protein MalK, N-terminal domain 96.8
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 96.79
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 96.78
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 96.78
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 96.77
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 96.76
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 96.76
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 96.75
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 96.74
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 96.73
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 96.73
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 96.71
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 96.7
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 96.69
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.69
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 96.68
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 96.68
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 96.68
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 96.67
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 96.67
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 96.67
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 96.67
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 96.66
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 96.66
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 96.66
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 96.65
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 96.65
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 96.65
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 96.65
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 96.63
d1g2912240 Maltose transport protein MalK, N-terminal domain 96.62
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 96.61
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 96.6
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 96.59
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 96.59
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 96.58
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 96.58
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 96.58
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 96.56
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 96.56
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 96.55
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 96.55
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 96.54
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 96.52
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 96.52
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 96.5
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 96.5
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 96.48
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 96.47
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 96.46
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 96.44
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 96.44
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 96.44
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 96.4
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 96.4
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 96.39
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 96.39
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 96.39
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 96.38
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 96.35
d2ocpa1 241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 96.34
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 96.32
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 96.31
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.29
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 96.28
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 96.26
d1xpua3 289 Transcription termination factor Rho, ATPase domai 96.24
d1p5zb_ 241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 96.23
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 96.21
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 96.2
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 96.19
d1deka_ 241 Deoxynucleoside monophosphate kinase {Bacteriophag 96.18
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 96.17
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 96.13
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 96.12
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 96.08
d2bv3a2 276 Elongation factor G (EF-G), N-terminal (G) domain 96.08
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 96.08
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 96.06
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 96.04
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 96.03
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 96.03
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 96.01
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 95.99
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 95.97
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 95.96
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 95.95
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 95.93
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 95.92
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 95.91
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 95.85
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 95.84
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 95.83
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 95.82
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 95.8
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 95.79
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 95.73
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 95.66
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 95.63
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 95.62
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 95.54
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 95.5
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 95.4
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 95.33
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 95.3
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 95.25
d1byia_ 224 Dethiobiotin synthetase {Escherichia coli [TaxId: 95.2
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 95.19
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 95.12
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 95.04
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 95.02
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 94.99
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 94.65
d2dy1a2 267 Elongation factor G (EF-G), N-terminal (G) domain 94.54
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 94.45
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 94.43
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 94.36
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 94.18
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 94.11
d1nija1 222 Hypothetical protein YjiA, N-terminal domain {Esch 93.97
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 93.95
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 93.75
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 93.74
d1e2ka_ 329 Thymidine kinase {Herpes simplex virus type 1, dif 93.69
d1g7sa4 227 Initiation factor IF2/eIF5b, N-terminal (G) domain 93.45
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 93.33
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 93.22
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 93.13
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 92.97
d1t5la1 413 Nucleotide excision repair enzyme UvrB {Bacillus c 92.29
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 92.28
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 92.19
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 92.15
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 91.82
d2akab1 299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 91.68
d1cp2a_ 269 Nitrogenase iron protein {Clostridium pasteurianum 91.43
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 91.31
d1c4oa1 408 Nucleotide excision repair enzyme UvrB {Thermus th 91.07
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 90.89
d1g3qa_ 237 Cell division regulator MinD {Archaeon Pyrococcus 90.63
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 90.49
d1hyqa_ 232 Cell division regulator MinD {Archaeon Archaeoglob 89.7
d2afhe1 289 Nitrogenase iron protein {Azotobacter vinelandii [ 89.39
d1wxqa1 319 GTP-binding protein PH0525 {Pyrococcus horikoshii 88.77
d1jnya3 224 Elongation factor eEF-1alpha, N-terminal (G) domai 88.7
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 88.59
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 88.56
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 88.34
d1f60a3 239 Elongation factor eEF-1alpha, N-terminal (G) domai 87.21
d1r5ba3 245 Eukaryotic peptide chain release factor ERF2, G do 86.92
d1jwyb_ 306 Dynamin G domain {Dictyostelium discoideum [TaxId: 86.58
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 86.54
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 86.5
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 86.12
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 85.6
d1vcha1174 Putative phosphoribosyltransferase TTHA1613 {Therm 85.52
d1bg2a_ 323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 85.32
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 84.95
d1f5na2 277 Interferon-induced guanylate-binding protein 1 (GB 84.93
d1goja_ 354 Kinesin {Neurospora crassa [TaxId: 5141]} 84.77
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 84.67
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 84.03
d1jala1 278 YchF GTP-binding protein N-terminal domain {Haemop 83.95
d1ni3a1 296 YchF GTP-binding protein N-terminal domain {Fissio 83.56
d1f9va_ 342 Kinesin motor Ncd (non-claret disjunctional) {Bake 83.44
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 83.11
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 82.98
d1x88a1 345 Kinesin {Human (Homo sapiens), mitotic kinesin eg5 82.74
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 82.62
d1kk8a2 789 Myosin S1, motor domain {Bay scallop (Aequipecten 82.15
d1j3ba1 318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 81.59
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 80.46
d1o5za2 296 Folylpolyglutamate synthetase {Thermotoga maritima 80.28
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ATPase subunit of magnesium chelatase, BchI
species: Rhodobacter capsulatus [TaxId: 1061]
Probab=99.68  E-value=6.6e-18  Score=138.76  Aligned_cols=110  Identities=15%  Similarity=0.207  Sum_probs=86.4

Q ss_pred             CCCcEEEEcCCCchHHHHHHHHHHHhCC-------------------------------ceEEEEeccCCChhhhcceeE
Q psy4122          43 MSQDVFLIGKPGSLRRSLAMSYLELTQR-------------------------------EVEYICLSRDTTEADIKQRRE   91 (162)
Q Consensus        43 ~g~~vlL~GppG~GKT~La~~lA~~lg~-------------------------------p~~~v~~~~~~~~~dL~g~~~   91 (162)
                      .++|+||+||||||||++|+.+|.++..                               |...+..+..++.++++|...
T Consensus        27 ~~h~vLl~G~pG~GKT~lar~~~~iLp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~G~~d  106 (333)
T d1g8pa_          27 GIGGVLVFGDRGTGKSTAVRALAALLPEIEAVEGCPVSSPNVEMIPDWATVLSTNVIRKPTPVVDLPLGVSEDRVVGALD  106 (333)
T ss_dssp             GGCCEEEECCGGGCTTHHHHHHHHHSCCEEEETTCTTCCSSGGGSCTTCCCSCCCEEEECCCEEEECTTCCHHHHHCEEC
T ss_pred             CCCeEEEECCCCccHHHHHHHHHHhCCCchhhccCccccCccccccchhhccccCcccccCceeeccCCCCcccccCcch
Confidence            3468999999999999999999988720                               112345566778888887443


Q ss_pred             e----ecCeEEEeccHHHHHhhcCcEEEEeCCCCCCccHHHHHHHhhcCCeEEEc-CCcEEecCcchH
Q psy4122          92 I----VNGTAIYYDQSAVRAAIEGRVLILEGIEKAERNVLPVLNNLLENREMHLE-DGRFLVSASTYD  154 (162)
Q Consensus        92 ~----~~G~~~~~~gpl~~A~~~G~vlllDEId~a~~~v~~~L~~lle~r~l~l~-~g~~i~~~~~f~  154 (162)
                      .    .+|...++.|++.+|  +++++++|||+++++++++.|.+.||++++.+. +|..+.-+.+|.
T Consensus       107 ~~~~~~~g~~~~~~G~l~~A--~~gvl~iDEi~~~~~~~~~aLl~~me~~~v~i~r~g~~~~~p~~f~  172 (333)
T d1g8pa_         107 IERAISKGEKAFEPGLLARA--NRGYLYIDECNLLEDHIVDLLLDVAQSGENVVERDGLSIRHPARFV  172 (333)
T ss_dssp             HHHHHHHCGGGEECCHHHHH--TTEEEEETTGGGSCHHHHHHHHHHHHHSEEEECCTTCCEEEECCEE
T ss_pred             hhhccccCcceeeccccccc--cccEeecccHHHHHHHHHHHHhhhhcCCeEEecccCceecCCCCEE
Confidence            2    357888899999887  899999999999999999999999999999996 354444444443



>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure