Psyllid ID: psy4150


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-----
MLAKDKYVKSKAQFPHINRDLDRMIQRDFHVTHSLASALENLVTYGLRSFYNNLVEVSKEDGSCPILGKDNDLQNLLQQLKPKLDINIMSSEYAWSHLKFIRLREILESHFRLHAEKGETTKVIIFANYRVVVAEIFDVLKPLEPMVKASMFVGQSSGVTQQEQKEIMKKFRAGEFNTLIATSVGEEGLDIGEIDLVICFDAQKSPIKMVQRLGRTGRKRNGRCVILLTQGREAHNFQTSMQTCKSYVEKIINNKSIYANLAKNGPRMIPAHVTPRIKCLHIVVKDRVTPAKPSKKKPKENEKANKKSKKKLETDGNSEPAGKQNKTNAKKTKKQPMMTQSNDIRTCFENITKKKKTFIDFLTQSSGEPVSAMDDEVVIVQNKIKPMQRKRKNNP
ccccHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccccccccccHHHHHHHHHHcHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHcccccccccEEEEEccccccHHHHHHHHHHHHcccccEEEEccccccccccccccEEEEccccccHHHHHHHHcccccccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccHHHHHHccccccHHHHHcccc
cHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccccccccEEEEEEccHHHHHHHHHHHHHccccEEEEEEEcccccccHHHHHHHHHHHHccccEEEEEEEccccccccccEEEEEEEcccccHHHHHHHccccccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHccccHHHHHcccccccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccEEEEEccccEcccccHHHHcccEHccccccccccHHHHHHHHHHHHHccccccEEccccc
mlakdkyvkskaqfphinrdlDRMIQRDFHVTHSLASALENLVTYGLRSFYNNLVEVskedgscpilgkdnDLQNLLQQlkpkldinimSSEYAWSHLKFIRLREILESHFRLHAEKGETTKVIIFANYRVVVAEIFDvlkplepmvkasmfvgqssgvtQQEQKEIMKKFRAGEFNTLIATsvgeegldigeiDLVIcfdaqkspIKMVQRLGrtgrkrngRCVILLTQgreahnfqtsMQTCKSYVEKIINNKSIYANLakngprmipahvtprikCLHIVvkdrvtpakpskkkpkenekaNKKSKKkletdgnsepagkqnktnakktkkqpmmtqsndIRTCFENITKKKKTFIDFLtqssgepvsamdDEVVIVQNKikpmqrkrknnp
mlakdkyvkskaqfphinrdLDRMIQRDFHVTHSLASALENLVTYGLRSFYNNLVEVSKEDGSCPILGKDNDLQNLLQQLKPKLDINIMSSEYAWSHLKFIRLREILESHFRLhaekgettkvIIFANYRVVVAEIFDVLKPLEPMVKASMFvgqssgvtqQEQKEIMKKFRAGEFNTLIATSVGEEGLDIGEIDLVICFDAQKSPIKMVqrlgrtgrkrngRCVILLtqgreahnfqtsMQTCKSYVEKIINNKSIYANLAKNGPRMIPAHVTPRIKCLhivvkdrvtpakpskkkpkenekankkskkkletdgnsepagkqnktnakktkkqpmmtqsndirTCFENITKKKKTFIDFLTqssgepvsamddEVVIVqnkikpmqrkrknnp
MLAKDKYVKSKAQFPHINRDLDRMIQRDFHVTHSLASALENLVTYGLRSFYNNLVEVSKEDGSCPIlgkdndlqnllqqlkpkldINIMSSEYAWSHLKFIRLREILESHFRLHAEKGETTKVIIFANYRVVVAEIFDVLKPLEPMVKASMFVGQSSGVTQQEQKEIMKKFRAGEFNTLIATSVGEEGLDIGEIDLVICFDAQKSPIKMVQRLGRTGRKRNGRCVILLTQGREAHNFQTSMQTCKSYVEKIINNKSIYANLAKNGPRMIPAHVTPRIKCLHIVVKDRVTPakpskkkpkenekankkskkkLETDGNSEPagkqnktnakktkkqPMMTQSNDIRTCFENITKKKKTFIDFLTQSSGEPVSAMDDEVVIVQNKIKPMQRKRKNNP
**************PHINRDLDRMIQRDFHVTHSLASALENLVTYGLRSFYNNLVEVSKEDGSCPILGKDNDLQNLLQQLKPKLDINIMSSEYAWSHLKFIRLREILESHFRLHAEKGETTKVIIFANYRVVVAEIFDVLKPLEPMVKASMFVG************IMKKFRAGEFNTLIATSVGEEGLDIGEIDLVICFDAQKSPIKMVQRLGRTGRKRNGRCVILLTQGREAHNFQTSMQTCKSYVEKIINNKSIYANLAKNGPRMIPAHVTPRIKCLHIVVKDR********************************************************IRTCFENITKKKKTFIDFLT**************VI****************
**********************RMIQRDFHVTHSLASALENLVTYGLRSFYNNLVE***************DLQNLLQQLKPK***********WSHLKFIRLREILESHFRLHAEKGETTKVIIFANYRVVVAEIFDVLKPLEPMVKASMF*****************KFRAGEFNTLIATSVGEEGLDIGEIDLVICFDAQKSPIKMVQRLGRTGRKRNGRCVILLTQGREAHNFQTSMQTC*******************************************************************************************************************************************************
MLAKDKYVKSKAQFPHINRDLDRMIQRDFHVTHSLASALENLVTYGLRSFYNNLVEVSKEDGSCPILGKDNDLQNLLQQLKPKLDINIMSSEYAWSHLKFIRLREILESHFRLHAEKGETTKVIIFANYRVVVAEIFDVLKPLEPMVKASMFVGQ*********KEIMKKFRAGEFNTLIATSVGEEGLDIGEIDLVICFDAQKSPIKMVQRLGRTGRKRNGRCVILLTQGREAHNFQTSMQTCKSYVEKIINNKSIYANLAKNGPRMIPAHVTPRIKCLHIVVKDR***************************************************TQSNDIRTCFENITKKKKTFIDFLTQSSGEPVSAMDDEVVIVQNKIK**********
MLAKDKYVKSKAQFPHINRDLDRMIQRDFHVTHSLASALENLVTYGLRSFYNNLVEVSKEDGSCP*LGKDNDLQNLLQQLKPKLDINIMSSEYAWSHLKFIRLREILESHFRLHAEKGETTKVIIFANYRVVVAEIFDVLKPLEPMVKASMFVGQSSGVTQQEQKEIMKKFRAGEFNTLIATSVGEEGLDIGEIDLVICFDAQKSPIKMVQRLGRTGRKRNGRCVILLTQGREAHNFQTSMQTCKSYVEKIINNKSIYANLAKNGPRMIPAHVTPRIKCLHIVVKD*******************************SEPAGKQNKTNAKKTKKQPMMTQSNDIRTCFENITKKKKTFIDFLTQSSGEPVSAMDDEVVIVQNKIK**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLAKDKYVKSKAQFPHINRDLDRMIQRDFHVTHSLASALENLVTYGLRSFYNNLVEVSKEDGSCPILGKDNDLQNLLQQLKPKLDINIMSSEYAWSHLKFIRLREILESHFRLHAEKGETTKVIIFANYRVVVAEIFDVLKPLEPMVKASMFVGQSSGVTQQEQKEIMKKFRAGEFNTLIATSVGEEGLDIGEIDLVICFDAQKSPIKMVQRLGRTGRKRNGRCVILLTQGREAHNFQTSMQTCKSYVEKIINNKSIYANLAKNGPRMIPAHVTPRIKCLHIVVKDRVTPAKPSKKKPKENEKANKKSKKKLETDGNSEPAGKQNKTNAKKTKKQPMMTQSNDIRTCFENITKKKKTFIDFLTQSSGEPVSAMDDEVVIVQNKIKPMQRKRKNNP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query395 2.2.26 [Sep-21-2011]
Q8IYD8 2048 Fanconi anemia group M pr yes N/A 0.731 0.141 0.355 6e-47
Q8BGE5 2021 Fanconi anemia group M pr yes N/A 0.703 0.137 0.344 1e-44
A4RN08 1102 ATP-dependent DNA helicas N/A N/A 0.807 0.289 0.347 2e-43
Q2URJ5 1129 ATP-dependent DNA helicas yes N/A 0.711 0.248 0.346 4e-41
Q7SDF3 1168 ATP-dependent DNA helicas N/A N/A 0.762 0.257 0.321 2e-40
A1CS00 1119 ATP-dependent DNA helicas N/A N/A 0.602 0.212 0.356 8e-40
Q2HG76 1134 ATP-dependent DNA helicas N/A N/A 0.655 0.228 0.338 1e-39
Q9HE09783 Putative ATP-dependent RN yes N/A 0.622 0.314 0.371 7e-39
Q1DY43 1110 ATP-dependent DNA helicas N/A N/A 0.693 0.246 0.326 8e-39
A1D4V5 1111 ATP-dependent DNA helicas N/A N/A 0.746 0.265 0.322 2e-38
>sp|Q8IYD8|FANCM_HUMAN Fanconi anemia group M protein OS=Homo sapiens GN=FANCM PE=1 SV=2 Back     alignment and function desciption
 Score =  188 bits (477), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 116/326 (35%), Positives = 188/326 (57%), Gaps = 37/326 (11%)

Query: 1   MLAKDKYVKSKAQFPHINRDLDRMIQRDFHVTHSLASALENLVTYGLRSFYNNLVEVSKE 60
           +LA+D++ K+ +  P+I      +I+ +F +  SL    E L   G+RS Y  L  +   
Sbjct: 335 ILARDQFRKNPS--PNIVGIQQGIIEGEFAICISLYHGYELLQQMGMRSLYFFLCGIM-- 390

Query: 61  DGSCPI------LGKDNDLQNLLQQLKPKL------DINIMSS--------EYAWSHLKF 100
           DG+  +      LG++ D   L   L+           N +S+        ++ +SH K 
Sbjct: 391 DGTKGMTRSKNELGRNEDFMKLYNHLECMFARTRSTSANGISAIQQGDKNKKFVYSHPKL 450

Query: 101 IRLREILESHFR-LHAE-----KGETTKVIIFANYRVVVAEIFDVLKPLEPMVKASMFVG 154
            +L E++  HF+  +AE     K + T+V+IF+++R  V EI ++L   +P+++   FVG
Sbjct: 451 KKLEEVVIEHFKSWNAENTTEKKRDETRVMIFSSFRDSVQEIAEMLSQHQPIIRVMTFVG 510

Query: 155 QSSG-----VTQQEQKEIMKKFRAGEFNTLIATSVGEEGLDIGEIDLVICFDAQKSPIKM 209
            +SG      TQ+EQ E++K+FR G +NTL++T VGEEGLDIGE+DL+ICFD+QKSPI++
Sbjct: 511 HASGKSTKGFTQKEQLEVVKQFRDGGYNTLVSTCVGEEGLDIGEVDLIICFDSQKSPIRL 570

Query: 210 VQRLGRTGRKRNGRCVILLTQGREAHNFQTSMQTCKSYVEKIINNKSIYANLAKNGPRMI 269
           VQR+GRTGRKR GR VI+L++GRE   +  S    +S  + I +N+ +  +  +  PRM+
Sbjct: 571 VQRMGRTGRKRQGRIVIILSEGREERIYNQSQSNKRSIYKAISSNRQVL-HFYQRSPRMV 629

Query: 270 PAHVTPRIKCLHIVVKDRVTPAKPSK 295
           P  + P++  +  +      P KPS+
Sbjct: 630 PDGINPKLHKM-FITHGVYEPEKPSR 654




ATPase required for FANCD2 ubiquitination, a key reaction in DNA repair. Binds to ssDNA but not to dsDNA. Recruited to forks stalled by DNA interstrand cross-links, and required for cellular resistance to such lesions.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q8BGE5|FANCM_MOUSE Fanconi anemia group M protein homolog OS=Mus musculus GN=Fancm PE=1 SV=3 Back     alignment and function description
>sp|A4RN08|MPH1_MAGO7 ATP-dependent DNA helicase MPH1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MPH1 PE=3 SV=1 Back     alignment and function description
>sp|Q2URJ5|MPH1_ASPOR ATP-dependent DNA helicase mph1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mph1 PE=3 SV=2 Back     alignment and function description
>sp|Q7SDF3|MPH1_NEUCR ATP-dependent DNA helicase mph-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mph-1 PE=3 SV=1 Back     alignment and function description
>sp|A1CS00|MPH1_ASPCL ATP-dependent DNA helicase mph1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mph1 PE=3 SV=1 Back     alignment and function description
>sp|Q2HG76|MPH1_CHAGB ATP-dependent DNA helicase MPH1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MPH1 PE=3 SV=1 Back     alignment and function description
>sp|Q9HE09|MFH2_SCHPO Putative ATP-dependent RNA helicase mfh2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfh2 PE=3 SV=1 Back     alignment and function description
>sp|Q1DY43|MPH1_COCIM ATP-dependent DNA helicase MPH1 OS=Coccidioides immitis (strain RS) GN=MPH1 PE=3 SV=1 Back     alignment and function description
>sp|A1D4V5|MPH1_NEOFI ATP-dependent DNA helicase MPH1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mph1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query395
328698487 2033 PREDICTED: hypothetical protein LOC10016 0.630 0.122 0.471 5e-61
405953921 2327 Fanconi anemia group M protein [Crassost 0.670 0.113 0.413 3e-50
321472411 657 hypothetical protein DAPPUDRAFT_48010 [D 0.675 0.406 0.395 1e-49
432938949 1928 PREDICTED: Fanconi anemia group M protei 0.703 0.144 0.372 6e-49
410898563 1899 PREDICTED: Fanconi anemia group M protei 0.703 0.146 0.372 8e-48
307207083 1344 Fanconi anemia group M protein [Harpegna 0.843 0.247 0.332 1e-47
345306292 2081 PREDICTED: LOW QUALITY PROTEIN: Fanconi 0.772 0.146 0.351 1e-47
395504025 1871 PREDICTED: Fanconi anemia group M protei 0.701 0.148 0.375 3e-47
307176233 1323 Fanconi anemia group M protein [Camponot 0.643 0.191 0.361 4e-47
47230040 1724 unnamed protein product [Tetraodon nigro 0.708 0.162 0.370 6e-47
>gi|328698487|ref|XP_001948012.2| PREDICTED: hypothetical protein LOC100166297 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  241 bits (615), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 124/263 (47%), Positives = 177/263 (67%), Gaps = 14/263 (5%)

Query: 28  DFHVTHSLASALENLVTYGLRSFYNNLVEVSKEDGSCPILGKDNDLQNLLQQLKPKLDIN 87
           DF +  SLA ALE L  YG++ FY   +E+ KE   C  L  D D QNLL  +  +L+  
Sbjct: 444 DFTICMSLAYALELLTIYGVKVFYLQSLEM-KETHKC--LSNDADFQNLLHGINKELN-- 498

Query: 88  IMSSEYAWSHLKFIRLREILESHFRLHAEKGETTKVIIFANYRVVVAEIFDVLKPLEPMV 147
             S +  WSH K   L++I++++F     +  ++K+IIF  YR+VV E+F++LK     V
Sbjct: 499 --SQDLTWSHPKLFELKKIVQNYFGFKNVEA-SSKIIIFCQYRLVVVEVFELLKTFGSSV 555

Query: 148 KASMFVGQS----SGVTQQEQKEIMKKFRAGEFNTLIATSVGEEGLDIGEIDLVICFDAQ 203
           K  MFVGQS     G+ Q+EQ E+M +F++G+FN LIATSV EEGLDIG++DL+IC +A 
Sbjct: 556 KPVMFVGQSLKEKGGLRQKEQLEVMSRFKSGDFNVLIATSVAEEGLDIGDVDLIICLEAN 615

Query: 204 KSPIKMVQRLGRTGRKRNGRCVILLTQGREAHNFQTSMQTCKSYVEKIINNKSIYANLAK 263
           KSPIK VQRLGRTGRKR+G+C+ LLT+G+E   + +S+ + K+ V K++ NK+I + LA 
Sbjct: 616 KSPIKFVQRLGRTGRKRSGKCITLLTEGKEQIKYNSSVSSSKTLVIKMLKNKAILSKLAP 675

Query: 264 NGPRMIPAHVTPRIKCLHIVVKD 286
            GPR++P H+ P  +CL I VK+
Sbjct: 676 EGPRLVPKHIHP--QCLMIHVKE 696




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|405953921|gb|EKC21486.1| Fanconi anemia group M protein [Crassostrea gigas] Back     alignment and taxonomy information
>gi|321472411|gb|EFX83381.1| hypothetical protein DAPPUDRAFT_48010 [Daphnia pulex] Back     alignment and taxonomy information
>gi|432938949|ref|XP_004082559.1| PREDICTED: Fanconi anemia group M protein homolog [Oryzias latipes] Back     alignment and taxonomy information
>gi|410898563|ref|XP_003962767.1| PREDICTED: Fanconi anemia group M protein homolog [Takifugu rubripes] Back     alignment and taxonomy information
>gi|307207083|gb|EFN84892.1| Fanconi anemia group M protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|345306292|ref|XP_003428451.1| PREDICTED: LOW QUALITY PROTEIN: Fanconi anemia group M protein-like, partial [Ornithorhynchus anatinus] Back     alignment and taxonomy information
>gi|395504025|ref|XP_003756361.1| PREDICTED: Fanconi anemia group M protein, partial [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|307176233|gb|EFN65868.1| Fanconi anemia group M protein [Camponotus floridanus] Back     alignment and taxonomy information
>gi|47230040|emb|CAG10454.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query395
UNIPROTKB|B2RTQ9 2022 FANCM "FANCM protein" [Homo sa 0.486 0.094 0.426 1.4e-44
UNIPROTKB|Q8IYD8 2048 FANCM "Fanconi anemia group M 0.486 0.093 0.426 1.5e-44
ZFIN|ZDB-GENE-090929-1 1761 fancm "Fanconi anemia, complem 0.488 0.109 0.446 1.6e-43
UNIPROTKB|J9NY43 2022 FANCM "Uncharacterized protein 0.481 0.093 0.420 3.6e-42
UNIPROTKB|E2RNF7 2047 FANCM "Uncharacterized protein 0.481 0.092 0.420 3.8e-42
UNIPROTKB|J9P777 2048 FANCM "Uncharacterized protein 0.481 0.092 0.420 3.8e-42
UNIPROTKB|F1NE03 1836 Gga.50035 "Uncharacterized pro 0.486 0.104 0.436 1e-41
UNIPROTKB|I3LAY7 2028 FANCM "Uncharacterized protein 0.481 0.093 0.430 2.4e-41
UNIPROTKB|F1SI11 2054 FANCM "Uncharacterized protein 0.481 0.092 0.430 2.5e-41
UNIPROTKB|A4RN08 1102 MPH1 "ATP-dependent DNA helica 0.453 0.162 0.430 6e-39
UNIPROTKB|B2RTQ9 FANCM "FANCM protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 430 (156.4 bits), Expect = 1.4e-44, Sum P(3) = 1.4e-44
 Identities = 87/204 (42%), Positives = 138/204 (67%)

Query:    90 SSEYAWSHLKFIRLREILESHFRL-HAE-----KGETTKVIIFANYRVVVAEIFDVLKPL 143
             + ++ +SH K  +L E++  HF+  +AE     K + T+V+IF+++R  V EI ++L   
Sbjct:   414 NKKFVYSHPKLKKLEEVVIEHFKSWNAENTTEKKRDETRVMIFSSFRDSVQEIAEMLSQH 473

Query:   144 EPMVKASMFVGQSSG-----VTQQEQKEIMKKFRAGEFNTLIATSVGEEGLDIGEIDLVI 198
             +P+++   FVG +SG      TQ+EQ E++K+FR G +NTL++T VGEEGLDIGE+DL+I
Sbjct:   474 QPIIRVMTFVGHASGKSTKGFTQKEQLEVVKQFRDGGYNTLVSTCVGEEGLDIGEVDLII 533

Query:   199 CFDAQKSPIKMVQRLGRTGRKRNGRCVILLTQGREAHNFQTSMQTCKSYVEKIINNKSIY 258
             CFD+QKSPI++VQR+GRTGRKR GR VI+L++GRE   +  S    +S  + I +N+ + 
Sbjct:   534 CFDSQKSPIRLVQRMGRTGRKRQGRIVIILSEGREERIYNQSQSNKRSIYKAISSNRQVL 593

Query:   259 ANLAKNGPRMIPAHVTPRIKCLHI 282
              +  +  PRM+P  + P++  + I
Sbjct:   594 -HFYQRSPRMVPDGINPKLHKMFI 616


GO:0003677 "DNA binding" evidence=IEA
GO:0004518 "nuclease activity" evidence=IEA
GO:0006259 "DNA metabolic process" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
UNIPROTKB|Q8IYD8 FANCM "Fanconi anemia group M protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090929-1 fancm "Fanconi anemia, complementation group M" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|J9NY43 FANCM "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2RNF7 FANCM "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P777 FANCM "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NE03 Gga.50035 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|I3LAY7 FANCM "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1SI11 FANCM "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|A4RN08 MPH1 "ATP-dependent DNA helicase MPH1" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.40.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query395
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 5e-53
PRK13766 773 PRK13766, PRK13766, Hef nuclease; Provisional 9e-40
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 1e-23
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 3e-21
smart0049082 smart00490, HELICc, helicase superfamily c-termina 1e-19
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 9e-19
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 3e-14
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 7e-11
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 2e-09
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 9e-09
cd12091122 cd12091, FANCM_ID, insert domain of FANCM helicase 3e-08
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 6e-08
COG0556663 COG0556, UvrB, Helicase subunit of the DNA excisio 5e-07
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 1e-06
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 3e-06
PRK09751 1490 PRK09751, PRK09751, putative ATP-dependent helicas 3e-06
cd09639353 cd09639, Cas3_I, CRISPR/Cas system-associated prot 6e-06
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 6e-06
TIGR00631655 TIGR00631, uvrb, excinuclease ABC, B subunit 6e-06
PRK04537572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 1e-05
TIGR00580926 TIGR00580, mfd, transcription-repair coupling fact 1e-05
COG1205 851 COG1205, COG1205, Distinct helicase family with a 1e-05
TIGR01587358 TIGR01587, cas3_core, CRISPR-associated helicase C 3e-05
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 2e-04
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 3e-04
PRK05298652 PRK05298, PRK05298, excinuclease ABC subunit B; Pr 5e-04
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 5e-04
TIGR00643630 TIGR00643, recG, ATP-dependent DNA helicase RecG 0.001
COG1200677 COG1200, RecG, RecG-like helicase [DNA replication 0.003
PRK13767 876 PRK13767, PRK13767, ATP-dependent helicase; Provis 0.003
COG11971139 COG1197, Mfd, Transcription-repair coupling factor 0.003
COG4098441 COG4098, comFA, Superfamily II DNA/RNA helicase re 0.004
COG1203733 COG1203, COG1203, CRISPR-associated helicase Cas3 0.004
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
 Score =  184 bits (469), Expect = 5e-53
 Identities = 91/229 (39%), Positives = 129/229 (56%), Gaps = 23/229 (10%)

Query: 34  SLASALENLVTYGLRSFYNNLVEVSKE-----DGSCPILGKDNDLQNLLQQLKPKLDINI 88
            LA ALE L T G+R FY  L ++ +E       +   L  D          K  L + I
Sbjct: 286 KLAHALELLETQGIRPFYQYLEKLEEEATKGGSKAAKSLLADPYF-------KRALRLLI 338

Query: 89  MSSEYAWSHLKFIRLREILESHFRLHAEKGETTKVIIFANYRVVVAEIFDVLKPLEPMVK 148
            + E    H K  +LREIL+       EK   ++VI+F  YR    EI + LK +    +
Sbjct: 339 RADESGVEHPKLEKLREILKEQL----EKNGDSRVIVFTEYRDTAEEIVNFLKKIGIKAR 394

Query: 149 ASMFVGQSS-----GVTQQEQKEIMKKFRAGEFNTLIATSVGEEGLDIGEIDLVICFDAQ 203
              F+GQ+S     G++Q+EQKEI+ +FR GE+N L+ATSVGEEGLDI E+DLVI ++  
Sbjct: 395 -VRFIGQASREGDKGMSQKEQKEIIDQFRKGEYNVLVATSVGEEGLDIPEVDLVIFYEPV 453

Query: 204 KSPIKMVQRLGRTGRKRNGRCVILLTQG-REAHNFQTSMQTCKSYVEKI 251
            S I+ +QR GRTGRKR GR V+L+T+G R+   + +S +  +  +E I
Sbjct: 454 PSEIRSIQRKGRTGRKRKGRVVVLVTEGTRDEAYYYSSRRKEQKMIESI 502


Length = 542

>gnl|CDD|237496 PRK13766, PRK13766, Hef nuclease; Provisional Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|213060 cd12091, FANCM_ID, insert domain of FANCM helicase and similar proteins Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|223630 COG0556, UvrB, Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|137505 PRK09751, PRK09751, putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>gnl|CDD|187770 cd09639, Cas3_I, CRISPR/Cas system-associated protein Cas3 Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|233063 TIGR00631, uvrb, excinuclease ABC, B subunit Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|233032 TIGR00580, mfd, transcription-repair coupling factor (mfd) Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|233483 TIGR01587, cas3_core, CRISPR-associated helicase Cas3 Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|235395 PRK05298, PRK05298, excinuclease ABC subunit B; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|233069 TIGR00643, recG, ATP-dependent DNA helicase RecG Back     alignment and domain information
>gnl|CDD|224121 COG1200, RecG, RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>gnl|CDD|237497 PRK13767, PRK13767, ATP-dependent helicase; Provisional Back     alignment and domain information
>gnl|CDD|224118 COG1197, Mfd, Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>gnl|CDD|226583 COG4098, comFA, Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224124 COG1203, COG1203, CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 395
KOG0331|consensus519 100.0
KOG0330|consensus476 100.0
KOG0333|consensus673 100.0
COG0556663 UvrB Helicase subunit of the DNA excision repair c 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.98
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.98
KOG0338|consensus691 99.97
KOG0342|consensus543 99.96
KOG0326|consensus459 99.96
KOG0343|consensus 758 99.96
KOG0328|consensus400 99.96
KOG0340|consensus442 99.96
KOG0335|consensus482 99.96
KOG0341|consensus610 99.96
KOG0345|consensus567 99.95
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.95
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.95
KOG0336|consensus629 99.95
PTZ00110545 helicase; Provisional 99.94
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 99.94
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 99.94
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 99.94
KOG0332|consensus477 99.94
KOG0354|consensus746 99.94
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.94
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 99.94
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.94
PRK05298652 excinuclease ABC subunit B; Provisional 99.93
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.93
KOG0348|consensus708 99.92
KOG0339|consensus731 99.92
KOG0327|consensus397 99.91
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.91
KOG4284|consensus 980 99.9
KOG0346|consensus569 99.9
PTZ00424401 helicase 45; Provisional 99.9
KOG0334|consensus 997 99.9
KOG0344|consensus593 99.9
KOG0347|consensus731 99.89
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.89
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.88
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 99.88
PRK13766 773 Hef nuclease; Provisional 99.88
KOG0350|consensus620 99.87
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.85
KOG0337|consensus529 99.84
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.83
PRK04914 956 ATP-dependent helicase HepA; Validated 99.82
PHA02653675 RNA helicase NPH-II; Provisional 99.82
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.81
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.79
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.79
PRK13767 876 ATP-dependent helicase; Provisional 99.79
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.78
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 99.78
PRK106891147 transcription-repair coupling factor; Provisional 99.78
PRK09200790 preprotein translocase subunit SecA; Reviewed 99.78
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 99.78
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.76
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.74
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 99.74
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.73
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 99.72
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.71
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.71
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.7
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.7
PRK00254 720 ski2-like helicase; Provisional 99.69
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 99.68
PRK02362 737 ski2-like helicase; Provisional 99.68
KOG0349|consensus725 99.68
PHA02558501 uvsW UvsW helicase; Provisional 99.67
PRK01172 674 ski2-like helicase; Provisional 99.66
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.65
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.65
KOG0329|consensus387 99.64
smart0049082 HELICc helicase superfamily c-terminal domain. 99.63
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.63
PRK09401 1176 reverse gyrase; Reviewed 99.62
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.59
COG1202 830 Superfamily II helicase, archaea-specific [General 99.58
KOG0351|consensus 941 99.57
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.56
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.5
PRK14701 1638 reverse gyrase; Provisional 99.49
KOG0352|consensus 641 99.47
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.45
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.43
PRK09694878 helicase Cas3; Provisional 99.41
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.4
PRK05580679 primosome assembly protein PriA; Validated 99.36
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.35
PRK12904830 preprotein translocase subunit SecA; Reviewed 99.34
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.31
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.27
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.27
COG1204 766 Superfamily II helicase [General function predicti 99.26
COG1205 851 Distinct helicase family with a unique C-terminal 99.26
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.25
KOG4150|consensus 1034 99.22
KOG0353|consensus 695 99.15
KOG0387|consensus 923 99.09
KOG0392|consensus1549 99.08
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.05
KOG0385|consensus 971 99.03
KOG0384|consensus 1373 99.0
KOG0951|consensus 1674 98.99
KOG0952|consensus 1230 98.91
KOG0950|consensus 1008 98.9
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 98.89
KOG0391|consensus 1958 98.87
KOG0388|consensus1185 98.86
KOG0922|consensus 674 98.83
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 98.82
KOG0389|consensus941 98.81
KOG1002|consensus791 98.71
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 98.69
KOG0923|consensus 902 98.68
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 98.68
KOG0390|consensus776 98.65
COG1198730 PriA Primosomal protein N' (replication factor Y) 98.63
KOG0953|consensus700 98.57
KOG0920|consensus 924 98.55
KOG0924|consensus 1042 98.52
PRK12326764 preprotein translocase subunit SecA; Reviewed 98.52
KOG0947|consensus 1248 98.51
KOG1123|consensus776 98.48
KOG0948|consensus 1041 98.39
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 98.37
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 98.34
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 98.33
KOG1000|consensus689 98.29
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 98.27
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 98.25
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 98.22
KOG1015|consensus 1567 98.19
COG4096 875 HsdR Type I site-specific restriction-modification 98.08
KOG0949|consensus 1330 98.07
KOG0386|consensus 1157 98.04
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 98.03
KOG0926|consensus 1172 98.03
CHL00122 870 secA preprotein translocase subunit SecA; Validate 98.02
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 97.86
KOG4439|consensus901 97.83
KOG0925|consensus 699 97.81
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 97.78
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 97.71
PF0215136 UVR: UvrB/uvrC motif; InterPro: IPR001943 During t 97.68
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 97.68
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 97.65
COG4889 1518 Predicted helicase [General function prediction on 97.54
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 97.47
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 97.22
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 97.14
smart00492141 HELICc3 helicase superfamily c-terminal domain. 97.07
smart00491142 HELICc2 helicase superfamily c-terminal domain. 96.91
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 96.9
PF13871278 Helicase_C_4: Helicase_C-like 96.74
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 96.6
PRK14873665 primosome assembly protein PriA; Provisional 96.38
KOG1001|consensus674 96.36
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 96.35
KOG0701|consensus 1606 96.35
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 96.28
PRK05580 679 primosome assembly protein PriA; Validated 96.05
TIGR00595 505 priA primosomal protein N'. All proteins in this f 96.05
KOG1016|consensus 1387 96.04
TIGR00643630 recG ATP-dependent DNA helicase RecG. 95.85
PRK14873 665 primosome assembly protein PriA; Provisional 95.4
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 95.27
PRK10689 1147 transcription-repair coupling factor; Provisional 94.47
COG1200677 RecG RecG-like helicase [DNA replication, recombin 94.28
COG1198 730 PriA Primosomal protein N' (replication factor Y) 94.27
KOG0921|consensus 1282 94.13
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 93.47
PRK07883557 hypothetical protein; Validated 93.32
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 92.97
PRK00558 598 uvrC excinuclease ABC subunit C; Validated 92.95
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 92.9
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 92.09
PRK12306 519 uvrC excinuclease ABC subunit C; Reviewed 91.53
TIGR00194 574 uvrC excinuclease ABC, C subunit. This family cons 91.43
PRK14671 621 uvrC excinuclease ABC subunit C; Provisional 91.34
PRK14670 574 uvrC excinuclease ABC subunit C; Provisional 91.19
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 91.16
PRK14669 624 uvrC excinuclease ABC subunit C; Provisional 91.15
PRK14667 567 uvrC excinuclease ABC subunit C; Provisional 91.1
PRK14666 694 uvrC excinuclease ABC subunit C; Provisional 91.06
COG3880176 Modulator of heat shock repressor CtsR, McsA [Sign 90.89
COG0322 581 UvrC Nuclease subunit of the excinuclease complex 90.79
PRK14672 691 uvrC excinuclease ABC subunit C; Provisional 90.57
PRK14668 577 uvrC excinuclease ABC subunit C; Provisional 90.16
PRK14701 1638 reverse gyrase; Provisional 90.07
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 89.96
KOG0331|consensus519 89.94
KOG1513|consensus 1300 89.6
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 89.47
KOG0298|consensus1394 89.4
KOG0347|consensus 731 89.07
KOG0951|consensus1674 88.66
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 88.5
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 88.21
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 87.41
KOG2340|consensus698 87.27
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 87.17
PF10593239 Z1: Z1 domain; InterPro: IPR018310 This entry repr 86.58
PF04364137 DNA_pol3_chi: DNA polymerase III chi subunit, HolC 85.91
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 85.88
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 85.61
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 84.08
PRK09401 1176 reverse gyrase; Reviewed 83.55
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 83.35
PTZ00110545 helicase; Provisional 82.2
KOG0343|consensus 758 81.66
KOG1133|consensus821 81.33
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 80.74
>KOG0331|consensus Back     alignment and domain information
Probab=100.00  E-value=5.7e-35  Score=295.66  Aligned_cols=197  Identities=25%  Similarity=0.292  Sum_probs=162.4

Q ss_pred             HHHHHHHhcchHHHHHHHHhC---CCcchhhhccccCcccc-ccccccCChhHHHHHHhhcccccccc-cceeeeccccH
Q psy4150          25 IQRDFHVTHSLASALENLVTY---GLRSFYNNLVEVSKEDG-SCPILGKDNDLQNLLQQLKPKLDINI-MSSEYAWSHLK   99 (395)
Q Consensus        25 lead~~~~~~l~~~~~~L~~~---g~r~~~~fsatl~~~~~-~~~~l~~~~~~~~~v~~~~~~~~~~~-~~~~~~~~~~K   99 (395)
                      -|||.|++|||.++++.|..+   ..+|+++||||.|.++. ....++.++.-+.+..........+. .....+....|
T Consensus       246 DEADrMldmGFe~qI~~Il~~i~~~~rQtlm~saTwp~~v~~lA~~fl~~~~~i~ig~~~~~~a~~~i~qive~~~~~~K  325 (519)
T KOG0331|consen  246 DEADRMLDMGFEPQIRKILSQIPRPDRQTLMFSATWPKEVRQLAEDFLNNPIQINVGNKKELKANHNIRQIVEVCDETAK  325 (519)
T ss_pred             ccHHhhhccccHHHHHHHHHhcCCCcccEEEEeeeccHHHHHHHHHHhcCceEEEecchhhhhhhcchhhhhhhcCHHHH
Confidence            399999999999999999886   45789999999999985 33455555544433322211111111 11112335668


Q ss_pred             HHHHHHHHHHHHHhhhccCCCccEEEEcCcHHHHHHHHHHHcccCCCCceeEEeccCCCCCHHHHHHHHHHHhcCCccEE
Q psy4150         100 FIRLREILESHFRLHAEKGETTKVIIFANYRVVVAEIFDVLKPLEPMVKASMFVGQSSGVTQQEQKEIMKKFRAGEFNTL  179 (395)
Q Consensus       100 ~~~L~~lL~~~~~~~~~~~~~~r~iVF~~t~~~ae~l~~~L~~~~~~~~~~~lhg~~~~~~~~~R~~~l~~Fk~g~~~vL  179 (395)
                      ...|..+|..+..     ..++|+||||+|++.|+.|+..|+..+  +.+..|||   +.+|.+|..+|+.|++|++.||
T Consensus       326 ~~~l~~lL~~~~~-----~~~~KvIIFc~tkr~~~~l~~~l~~~~--~~a~~iHG---d~sQ~eR~~~L~~FreG~~~vL  395 (519)
T KOG0331|consen  326 LRKLGKLLEDISS-----DSEGKVIIFCETKRTCDELARNLRRKG--WPAVAIHG---DKSQSERDWVLKGFREGKSPVL  395 (519)
T ss_pred             HHHHHHHHHHHhc-----cCCCcEEEEecchhhHHHHHHHHHhcC--cceeeecc---cccHHHHHHHHHhcccCCcceE
Confidence            8999999988752     467899999999999999999999998  99999999   9999999999999999999999


Q ss_pred             EEcCccccCCCCCCCCEEEEcCCCCChhhHhhhcccccccc-CceEEEEEeCC
Q psy4150         180 IATSVGEEGLDIGEIDLVICFDAQKSPIKMVQRLGRTGRKR-NGRCVILLTQG  231 (395)
Q Consensus       180 VaT~v~~~GlDip~v~~VI~~d~p~s~~~yiQr~GRagR~~-~g~~i~l~~~~  231 (395)
                      |||||++||||||+|++|||||+|.++++|+||+|||||+| .|.++.|++..
T Consensus       396 VATdVAaRGLDi~dV~lVInydfP~~vEdYVHRiGRTGRa~~~G~A~tfft~~  448 (519)
T KOG0331|consen  396 VATDVAARGLDVPDVDLVINYDFPNNVEDYVHRIGRTGRAGKKGTAITFFTSD  448 (519)
T ss_pred             EEcccccccCCCccccEEEeCCCCCCHHHHHhhcCccccCCCCceEEEEEeHH
Confidence            99999999999999999999999999999999999999985 78889888764



>KOG0330|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF02151 UVR: UvrB/uvrC motif; InterPro: IPR001943 During the process of Escherichia coli nucleotide excision repair, DNA damage recognition and processing are achieved by the action of the uvrA, uvrB, and uvrC gene products [] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG0701|consensus Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PRK07883 hypothetical protein; Validated Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00558 uvrC excinuclease ABC subunit C; Validated Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK12306 uvrC excinuclease ABC subunit C; Reviewed Back     alignment and domain information
>TIGR00194 uvrC excinuclease ABC, C subunit Back     alignment and domain information
>PRK14671 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>PRK14670 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK14669 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>PRK14667 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>PRK14666 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>COG3880 Modulator of heat shock repressor CtsR, McsA [Signal transduction mechanisms] Back     alignment and domain information
>COG0322 UvrC Nuclease subunit of the excinuclease complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14672 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>PRK14668 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>KOG1513|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases Back     alignment and domain information
>PF04364 DNA_pol3_chi: DNA polymerase III chi subunit, HolC; InterPro: IPR007459 The DNA polymerase III holoenzyme (2 Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG1133|consensus Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query395
1wp9_A494 Crystal Structure Of Pyrococcus Furiosus Hef Helica 1e-26
3tmi_A695 Structural Basis For Rna Recognition And Activation 5e-13
2ykg_A696 Structural Insights Into Rna Recognition By Rig-I L 6e-13
4ay2_A687 Capturing 5' Tri-Phosphorylated Rna Duplex By Rig-I 6e-13
3tbk_A555 Mouse Rig-I Atpase Domain Length = 555 4e-12
4a2w_A936 Structure Of Full-Length Duck Rig-I Length = 936 3e-11
4a2q_A797 Structure Of Duck Rig-I Tandem Cards And Helicase D 3e-11
4gl2_A699 Structural Basis For Dsrna Duplex Backbone Recognit 4e-11
4a2p_A556 Structure Of Duck Rig-I Helicase Domain Length = 55 4e-11
4i1s_A243 Melanoma Differentiation Associated Protein-5 Helic 7e-10
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 6e-08
2yjt_D170 Crystal Structure Of E. Coli Dead-Box Protein Srmb 8e-08
2fwr_A472 Structure Of Archaeoglobus Fulgidis Xpb Length = 47 2e-07
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 2e-07
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 2e-07
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 2e-07
2hyi_C413 Structure Of The Human Exon Junction Complex With A 2e-07
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 2e-07
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 2e-07
2fzl_A219 Structure Of C-Terminal Domain Of Archaeoglobus Ful 2e-07
2jgn_A185 Ddx3 Helicase Domain Length = 185 7e-07
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 1e-06
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 2e-06
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 3e-06
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 3e-06
3v4r_A667 Crystal Structure Of A Uvrb Dimer-Dna Complex Lengt 7e-06
2d7d_A661 Structural Insights Into The Cryptic Dna Dependent 7e-06
2fdc_A658 Structural Basis Of Dna Damage Recognition And Proc 7e-06
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 8e-06
1d9z_A657 Crystal Structure Of The Dna Repair Protein Uvrb In 8e-06
1t5l_A658 Crystal Structure Of The Dna Repair Protein Uvrb Po 8e-06
1d9x_A658 Crystal Structure Of The Dna Repair Protein Uvrb Le 8e-06
3uwx_B683 Crystal Structure Of Uvra-Uvrb Complex Length = 683 8e-06
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 2e-05
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 3e-05
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 3e-05
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 4e-05
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 6e-05
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 6e-05
2vso_A395 Crystal Structure Of A Translation Initiation Compl 8e-05
3i32_A300 Dimeric Structure Of A Hera Helicase Fragment Inclu 1e-04
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 1e-04
3eaq_A212 Novel Dimerization Motif In The Dead Box Rna Helica 2e-04
1fuu_A394 Yeast Initiation Factor 4a Length = 394 4e-04
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 5e-04
1d2m_A665 Uvrb Protein Of Thermus Thermophilus Hb8; A Nucleot 6e-04
1c4o_A664 Crystal Structure Of The Dna Nucleotide Excision Re 6e-04
2rb4_A175 Crystal Structure Of The Helicase Domain Of Human D 8e-04
>pdb|1WP9|A Chain A, Crystal Structure Of Pyrococcus Furiosus Hef Helicase Domain Length = 494 Back     alignment and structure

Iteration: 1

Score = 117 bits (293), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 66/164 (40%), Positives = 102/164 (62%), Gaps = 12/164 (7%) Query: 88 IMSSEYAWSHLKFIRLREILESHFRLHAEKGETTKVIIFANYRVVVAEIFDVLKPLEPMV 147 + + E H K +L+EI+ R ++ + +K+I+F NYR +I + L ++ + Sbjct: 333 VQAKEIGLDHPKMDKLKEII----REQLQRKQNSKIIVFTNYRETAKKIVNEL--VKDGI 386 Query: 148 KASMFVGQSS-----GVTQQEQKEIMKKFRAGEFNTLIATSVGEEGLDIGEIDLVICFDA 202 KA FVGQ+S G++Q+EQK I+ +F GEFN L+ATSVGEEGLD+ E+DLV+ ++ Sbjct: 387 KAKRFVGQASKENDRGLSQREQKLILDEFARGEFNVLVATSVGEEGLDVPEVDLVVFYEP 446 Query: 203 QKSPIKMVQRLGRTGRKRNGRCVILLTQG-REAHNFQTSMQTCK 245 S I+ +QR GRTGR GR +IL+ +G R+ + +S Q K Sbjct: 447 VPSAIRSIQRRGRTGRHMPGRVIILMAKGTRDEAYYWSSRQKEK 490
>pdb|3TMI|A Chain A, Structural Basis For Rna Recognition And Activation Of Rig-I Length = 695 Back     alignment and structure
>pdb|2YKG|A Chain A, Structural Insights Into Rna Recognition By Rig-I Length = 696 Back     alignment and structure
>pdb|4AY2|A Chain A, Capturing 5' Tri-Phosphorylated Rna Duplex By Rig-I Length = 687 Back     alignment and structure
>pdb|3TBK|A Chain A, Mouse Rig-I Atpase Domain Length = 555 Back     alignment and structure
>pdb|4A2W|A Chain A, Structure Of Full-Length Duck Rig-I Length = 936 Back     alignment and structure
>pdb|4A2Q|A Chain A, Structure Of Duck Rig-I Tandem Cards And Helicase Domain Length = 797 Back     alignment and structure
>pdb|4GL2|A Chain A, Structural Basis For Dsrna Duplex Backbone Recognition By Mda5 Length = 699 Back     alignment and structure
>pdb|4A2P|A Chain A, Structure Of Duck Rig-I Helicase Domain Length = 556 Back     alignment and structure
>pdb|4I1S|A Chain A, Melanoma Differentiation Associated Protein-5 Helicase Domain Complex With Inhibitor Non-structural Protein V Length = 243 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 Back     alignment and structure
>pdb|2FWR|A Chain A, Structure Of Archaeoglobus Fulgidis Xpb Length = 472 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2FZL|A Chain A, Structure Of C-Terminal Domain Of Archaeoglobus Fulgidus Xpb Length = 219 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|3V4R|A Chain A, Crystal Structure Of A Uvrb Dimer-Dna Complex Length = 667 Back     alignment and structure
>pdb|2D7D|A Chain A, Structural Insights Into The Cryptic Dna Dependent Atp-Ase Activity Of Uvrb Length = 661 Back     alignment and structure
>pdb|2FDC|A Chain A, Structural Basis Of Dna Damage Recognition And Processing By Uvrb: Crystal Structure Of A UvrbDNA COMPLEX Length = 658 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|1D9Z|A Chain A, Crystal Structure Of The Dna Repair Protein Uvrb In Complex With Atp Length = 657 Back     alignment and structure
>pdb|1T5L|A Chain A, Crystal Structure Of The Dna Repair Protein Uvrb Point Mutant Y96a Revealing A Novel Fold For Domain 2 Length = 658 Back     alignment and structure
>pdb|1D9X|A Chain A, Crystal Structure Of The Dna Repair Protein Uvrb Length = 658 Back     alignment and structure
>pdb|3UWX|B Chain B, Crystal Structure Of Uvra-Uvrb Complex Length = 683 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|1D2M|A Chain A, Uvrb Protein Of Thermus Thermophilus Hb8; A Nucleotide Excision Repair Enzyme Length = 665 Back     alignment and structure
>pdb|1C4O|A Chain A, Crystal Structure Of The Dna Nucleotide Excision Repair Enzyme Uvrb From Thermus Thermophilus Length = 664 Back     alignment and structure
>pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query395
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 2e-41
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 3e-37
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 4e-36
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 3e-35
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 6e-34
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 6e-33
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 1e-13
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 1e-13
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 3e-13
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 4e-13
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 1e-12
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 2e-12
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 2e-12
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 2e-12
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 3e-12
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 4e-12
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 4e-12
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 5e-12
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 7e-12
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 1e-11
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 2e-11
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 4e-11
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 4e-11
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 7e-11
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 1e-10
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 1e-10
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 3e-10
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 3e-10
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 6e-10
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 7e-10
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 2e-09
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 7e-09
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 8e-06
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 1e-05
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 1e-05
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 1e-04
3h1t_A590 Type I site-specific restriction-modification syst 4e-04
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 7e-04
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
 Score =  151 bits (382), Expect = 2e-41
 Identities = 72/225 (32%), Positives = 121/225 (53%), Gaps = 13/225 (5%)

Query: 23  RMIQRDFHVTHSLASALENLVTYGLRSFYNNLVEVSKEDGSCPILGKDNDLQNLLQQLKP 82
           R +     +   L  A+E L T GL +    + ++ +E  +           +  +++K 
Sbjct: 270 RGLLLYHAMALKLHHAIELLETQGLSALRAYIKKLYEEAKAGSTKASKEIFSD--KRMKK 327

Query: 83  KLDINIMSSEYAWSHLKFIRLREILESHFRLHAEKGETTKVIIFANYRVVVAEIFDVLKP 142
            + + + + E    H K  +L+EI+        ++ + +K+I+F NYR    +I + L  
Sbjct: 328 AISLLVQAKEIGLDHPKMDKLKEIIREQL----QRKQNSKIIVFTNYRETAKKIVNELV- 382

Query: 143 LEPMVKASMFVGQSS-----GVTQQEQKEIMKKFRAGEFNTLIATSVGEEGLDIGEIDLV 197
            +  +KA  FVGQ+S     G++Q+EQK I+ +F  GEFN L+ATSVGEEGLD+ E+DLV
Sbjct: 383 -KDGIKAKRFVGQASKENDRGLSQREQKLILDEFARGEFNVLVATSVGEEGLDVPEVDLV 441

Query: 198 ICFDAQKSPIKMVQRLGRTGRKRNGRCVILLTQGREAHNFQTSMQ 242
           + ++   S I+ +QR GRTGR   GR +IL+ +G     +  S +
Sbjct: 442 VFYEPVPSAIRSIQRRGRTGRHMPGRVIILMAKGTRDEAYYWSSR 486


>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Length = 661 Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Length = 664 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Length = 510 Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Length = 590 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query395
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.96
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.96
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.95
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.94
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.94
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.93
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.93
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.93
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.93
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.93
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.92
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.91
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.91
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.91
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.91
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.91
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.84
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.9
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.9
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.9
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.89
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.89
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.88
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.88
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.88
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 99.88
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.87
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.87
4gl2_A699 Interferon-induced helicase C domain-containing P; 99.87
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.87
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.86
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.86
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.86
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 99.86
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.85
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.84
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.84
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.82
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.81
3jux_A822 Protein translocase subunit SECA; protein transloc 99.8
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.79
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.79
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.79
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.78
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.78
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.77
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.77
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.76
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.76
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.75
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 99.75
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.75
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.73
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.73
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.72
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.72
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.72
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.71
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.71
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.7
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.7
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.7
3h1t_A590 Type I site-specific restriction-modification syst 99.69
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 99.69
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.68
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.66
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.66
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.53
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.46
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.31
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 98.44
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 98.43
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 98.15
1e52_A63 Excinuclease ABC subunit; DNA excision repair, UVR 98.1
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 97.55
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 96.55
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 95.98
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 93.84
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 93.24
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 93.11
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 92.97
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 90.87
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 90.12
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 90.11
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 89.88
3bor_A237 Human initiation factor 4A-II; translation initiat 89.72
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 88.41
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 88.03
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 87.8
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 86.6
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 86.43
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 86.2
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 85.47
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 84.57
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 83.43
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 83.22
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 82.12
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 80.64
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
Probab=99.96  E-value=8.9e-29  Score=263.45  Aligned_cols=221  Identities=16%  Similarity=0.228  Sum_probs=124.6

Q ss_pred             ccHHHHHHHHHHHHHHhhhccCCCccEEEEcCcHHHHHHHHHHHcccCCCCceeEEeccCCCCCHHHHHHHHHHHhcCCc
Q psy4150          97 HLKFIRLREILESHFRLHAEKGETTKVIIFANYRVVVAEIFDVLKPLEPMVKASMFVGQSSGVTQQEQKEIMKKFRAGEF  176 (395)
Q Consensus        97 ~~K~~~L~~lL~~~~~~~~~~~~~~r~iVF~~t~~~ae~l~~~L~~~~~~~~~~~lhg~~~~~~~~~R~~~l~~Fk~g~~  176 (395)
                      ..+...|...|......      +.++||||+|+..++.|++.|.+.|  +++.++||   ++++.+|..++++|+.|++
T Consensus       422 ~~~~~~Ll~~l~~~~~~------~~~vlVf~~t~~~ae~L~~~L~~~g--i~~~~lh~---~~~~~~R~~~~~~f~~g~~  490 (664)
T 1c4o_A          422 ENQILDLMEGIRERAAR------GERTLVTVLTVRMAEELTSFLVEHG--IRARYLHH---ELDAFKRQALIRDLRLGHY  490 (664)
T ss_dssp             TTHHHHHHHHHHHHHHT------TCEEEEECSSHHHHHHHHHHHHHTT--CCEEEECT---TCCHHHHHHHHHHHHTTSC
T ss_pred             cchHHHHHHHHHHHHhc------CCEEEEEECCHHHHHHHHHHHHhcC--CCceeecC---CCCHHHHHHHHHHhhcCCc
Confidence            34666666666554432      5799999999999999999999998  89999999   9999999999999999999


Q ss_pred             cEEEEcCccccCCCCCCCCEEEEcCC-----CCChhhHhhhccccccccCceEEEEEeCCchhhHHHHHHHHhHHHHHHH
Q psy4150         177 NTLIATSVGEEGLDIGEIDLVICFDA-----QKSPIKMVQRLGRTGRKRNGRCVILLTQGREAHNFQTSMQTCKSYVEKI  251 (395)
Q Consensus       177 ~vLVaT~v~~~GlDip~v~~VI~~d~-----p~s~~~yiQr~GRagR~~~g~~i~l~~~~~e~~~~~~~~~~~~~~i~~~  251 (395)
                      +|||||+++++|+|+|+|++||++|.     |++..+|+||+|||||.+.|.+++++...+....      .........
T Consensus       491 ~VLvaT~~l~~GlDip~v~lVI~~d~d~~G~p~s~~~~iQr~GRagR~~~G~~i~~~~~~~~~~~------~~i~~~~~~  564 (664)
T 1c4o_A          491 DCLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNARGEVWLYADRVSEAMQ------RAIEETNRR  564 (664)
T ss_dssp             SEEEESCCCCTTCCCTTEEEEEETTTTSCSGGGSHHHHHHHHGGGTTSTTCEEEEECSSCCHHHH------HHHHHHHHH
T ss_pred             eEEEccChhhcCccCCCCCEEEEeCCcccCCCCCHHHHHHHHCccCcCCCCEEEEEEcCCCHHHH------HHHHHHHHH
Confidence            99999999999999999999999998     8999999999999999999999988876544322      112222222


Q ss_pred             HcccchhhhhcccCCCCCCCCcchhhhhhcccccccCCCCCCCCCCchhhHHhhhcchhhhccCCCCCcccccccchhhh
Q psy4150         252 INNKSIYANLAKNGPRMIPAHVTPRIKCLHIVVKDRVTPAKPSKKKPKENEKANKKSKKKLETDGNSEPAGKQNKTNAKK  331 (395)
Q Consensus       252 i~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~~  331 (395)
                      ......++..+...|..+...+...+.    .  ...  . . .    .  -....+.+++.              ..+.
T Consensus       565 r~~~~~~~~~~~~~p~~~~~~i~~~~~----~--~~~--~-~-~----~--~~~~~~~~~~~--------------~~i~  614 (664)
T 1c4o_A          565 RALQEAYNLEHGITPETVRKEVRAVIR----P--EGY--E-E-A----P--LEADLSGEDLR--------------ERIA  614 (664)
T ss_dssp             HHHHHHHHHHHTCCCCCC--------------------------------------------------------------
T ss_pred             HHHHHHHHHhcCCCCcchhHHHHHHhh----h--hhc--c-h-h----h--hhhhcCHHHHH--------------HHHH
Confidence            222334444555566666555544332    0  000  0 0 0    0  01122334444              6899


Q ss_pred             hhccchhhhhHHHHHHHHhhhhchhhHHHHHhhhc
Q psy4150         332 TKKQPMMTQSNDIRTCFENITKKKKTFIDFLTQSS  366 (395)
Q Consensus       332 ~~~~~m~~a~~~l~~~fe~a~~~rd~~~~~~~~~~  366 (395)
                      +++++|.+||++|+  ||.||++||+|..|++++.
T Consensus       615 ~l~~~m~~aa~~l~--fe~Aa~lRd~i~~l~~~~~  647 (664)
T 1c4o_A          615 ELELAMWQAAEALD--FERAARLRDEIRALEARLQ  647 (664)
T ss_dssp             -----------------------------------
T ss_pred             HHHHHHHHHHHhcC--hHHHHHHHHHHHHHHHHHH
Confidence            99999999999999  9999999999999998863



>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 395
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 8e-27
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 8e-17
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 5e-10
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 1e-08
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 3e-08
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 5e-08
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 2e-07
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 3e-07
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 4e-07
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 3e-06
d1gm5a4206 c.37.1.19 (A:550-755) RecG helicase domain {Thermo 7e-05
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: putative ATP-dependent RNA helicase PF2015
species: Pyrococcus furiosus [TaxId: 2261]
 Score =  106 bits (264), Expect = 8e-27
 Identities = 71/220 (32%), Positives = 119/220 (54%), Gaps = 15/220 (6%)

Query: 27  RDFHVTHSLASALENLVTYGLRSFYNNLVEVSKEDGSCPILGKDNDLQNLLQQLKPKLDI 86
               +   L  A+E L T GL +    + ++ +E  +           +  +++K  + +
Sbjct: 74  LYHAMALKLHHAIELLETQGLSALRAYIKKLYEEAKAGSTKASKEIFSD--KRMKKAISL 131

Query: 87  NIMSSEYAWSHLKFIRLREILESHFRLHAEKGETTKVIIFANYRVVVAEIFDVLKPLEPM 146
            + + E    H K  +L+EI+        ++ + +K+I+F NYR    +I + L   +  
Sbjct: 132 LVQAKEIGLDHPKMDKLKEIIREQL----QRKQNSKIIVFTNYRETAKKIVNELV--KDG 185

Query: 147 VKASMFVGQSSGV-----TQQEQKEIMKKFRAGEFNTLIATSVGEEGLDIGEIDLVICFD 201
           +KA  FVGQ+S       +Q+EQK I+ +F  GEFN L+ATSVGEEGLD+ E+DLV+ ++
Sbjct: 186 IKAKRFVGQASKENDRGLSQREQKLILDEFARGEFNVLVATSVGEEGLDVPEVDLVVFYE 245

Query: 202 AQKSPIKMVQRLGRTGRKRNGRCVILLTQGR--EAHNFQT 239
              S I+ +QR GRTGR   GR +IL+ +G   EA+ + +
Sbjct: 246 PVPSAIRSIQRRGRTGRHMPGRVIILMAKGTRDEAYYWSS 285


>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Length = 206 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query395
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.96
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.96
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.96
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.96
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.96
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.96
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.96
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.95
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.95
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.95
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.88
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.83
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.82
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.81
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.78
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.77
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.7
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.7
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.67
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.52
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.41
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 99.3
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 98.78
d1e52a_56 C-terminal UvrC-binding domain of UvrB {Escherichi 98.51
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 97.41
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 97.0
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 91.45
d2eyqa2117 Transcription-repair coupling factor, TRCF {Escher 88.79
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 87.67
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 87.19
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 84.45
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 82.72
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 81.15
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Initiation factor 4a
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.96  E-value=1.4e-29  Score=221.75  Aligned_cols=137  Identities=28%  Similarity=0.446  Sum_probs=117.4

Q ss_pred             cccHHHHHHHHHHHHHHhhhccCCCccEEEEcCcHHHHHHHHHHHcccCCCCceeEEeccCCCCCHHHHHHHHHHHhcCC
Q psy4150          96 SHLKFIRLREILESHFRLHAEKGETTKVIIFANYRVVVAEIFDVLKPLEPMVKASMFVGQSSGVTQQEQKEIMKKFRAGE  175 (395)
Q Consensus        96 ~~~K~~~L~~lL~~~~~~~~~~~~~~r~iVF~~t~~~ae~l~~~L~~~~~~~~~~~lhg~~~~~~~~~R~~~l~~Fk~g~  175 (395)
                      .+.|++.|.+++..+        ...++||||+|+..++.+++.|...+  +.+..+||   ++++.+|..+++.|+.|+
T Consensus        11 ~e~K~~~L~~ll~~~--------~~~k~iIF~~s~~~~~~l~~~L~~~~--~~~~~~~~---~~~~~~r~~~l~~f~~~~   77 (162)
T d1fuka_          11 EEYKYECLTDLYDSI--------SVTQAVIFCNTRRKVEELTTKLRNDK--FTVSAIYS---DLPQQERDTIMKEFRSGS   77 (162)
T ss_dssp             GGGHHHHHHHHHHHT--------TCSCEEEEESSHHHHHHHHHHHHHTT--CCEEEECT---TSCHHHHHHHHHHHHTTS
T ss_pred             cHHHHHHHHHHHHhC--------CCCcEEEEEEEEchHHHHHHHHhhcC--ceEEEecc---CCchhhHHHHHHHHhhcc
Confidence            345999999988763        45899999999999999999999999  99999999   999999999999999999


Q ss_pred             ccEEEEcCccccCCCCCCCCEEEEcCCCCChhhHhhhcccccccc-CceEEEEEeCCchhhHHHHHHHHhHHHHHHHHcc
Q psy4150         176 FNTLIATSVGEEGLDIGEIDLVICFDAQKSPIKMVQRLGRTGRKR-NGRCVILLTQGREAHNFQTSMQTCKSYVEKIINN  254 (395)
Q Consensus       176 ~~vLVaT~v~~~GlDip~v~~VI~~d~p~s~~~yiQr~GRagR~~-~g~~i~l~~~~~e~~~~~~~~~~~~~~i~~~i~~  254 (395)
                      ++||||||+++||+|+|+|++|||||+|+++..|+||+|||||.| .|.+++++++.+.         .....+++.++.
T Consensus        78 ~~iLv~Tdv~~rGiDi~~v~~VI~~d~P~~~~~yihR~GR~gR~g~~g~~i~~~~~~d~---------~~~~~i~~~~~~  148 (162)
T d1fuka_          78 SRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKGVAINFVTNEDV---------GAMRELEKFYST  148 (162)
T ss_dssp             CSEEEEEGGGTTTCCCCSCSEEEESSCCSSGGGGGGSSCSCC-----CEEEEEEETTTH---------HHHHHHHHHSSC
T ss_pred             cceeeccccccccccCCCceEEEEeccchhHHHHHhhccccccCCCccEEEEEcCHHHH---------HHHHHHHHHHcC
Confidence            999999999999999999999999999999999999999999997 6888888876432         223456666554



>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e52a_ a.2.9.1 (A:) C-terminal UvrC-binding domain of UvrB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2eyqa2 c.37.1.19 (A:349-465) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure