Psyllid ID: psy4156
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 160 | ||||||
| 118794945 | 394 | AGAP001318-PA [Anopheles gambiae str. PE | 0.612 | 0.248 | 0.714 | 5e-33 | |
| 340710557 | 394 | PREDICTED: acetyl-CoA acetyltransferase, | 0.606 | 0.246 | 0.721 | 9e-33 | |
| 195441403 | 392 | GK20386 [Drosophila willistoni] gi|19416 | 0.6 | 0.244 | 0.739 | 1e-32 | |
| 170060190 | 393 | acetyl-coA acetyl transferase II [Culex | 0.6 | 0.244 | 0.729 | 2e-32 | |
| 193702418 | 393 | PREDICTED: acetyl-CoA acetyltransferase, | 0.587 | 0.239 | 0.776 | 3e-32 | |
| 194864803 | 392 | GG14778 [Drosophila erecta] gi|190652898 | 0.6 | 0.244 | 0.729 | 4e-32 | |
| 350427397 | 394 | PREDICTED: acetyl-CoA acetyltransferase, | 0.606 | 0.246 | 0.701 | 6e-32 | |
| 24655093 | 392 | CG9149 [Drosophila melanogaster] gi|2309 | 0.6 | 0.244 | 0.729 | 6e-32 | |
| 195490351 | 392 | GE21141 [Drosophila yakuba] gi|194179204 | 0.6 | 0.244 | 0.729 | 6e-32 | |
| 195586883 | 392 | GD13606 [Drosophila simulans] gi|1941952 | 0.6 | 0.244 | 0.729 | 6e-32 |
| >gi|118794945|ref|XP_321828.3| AGAP001318-PA [Anopheles gambiae str. PEST] gi|116116539|gb|EAA01190.3| AGAP001318-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
Score = 145 bits (366), Expect = 5e-33, Method: Compositional matrix adjust.
Identities = 70/98 (71%), Positives = 84/98 (85%)
Query: 36 SDNDVVIVSAARTPIGSFLGSLSELKAHDLGSTAIKEVLKRANVLPNEISEVILGQALTA 95
S +V IVSAARTPIG+F+G+L+ L A DLG+ A+KEVL+RA+V P ++SEVILGQALTA
Sbjct: 3 SAGEVFIVSAARTPIGNFMGTLASLSAADLGAVAVKEVLQRASVDPADVSEVILGQALTA 62
Query: 96 GQGQNPARQASIKANIPNEVPASLVNMLCGSGLKSVTL 133
GQGQNPARQASIKA +P EVPA +NMLCGSGLK+V L
Sbjct: 63 GQGQNPARQASIKAGVPKEVPAYNINMLCGSGLKTVAL 100
|
Source: Anopheles gambiae str. PEST Species: Anopheles gambiae Genus: Anopheles Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|340710557|ref|XP_003393854.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic-like [Bombus terrestris] gi|385258402|gb|AFI55097.1| acetyl-CoA acetyltransferase [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|195441403|ref|XP_002068499.1| GK20386 [Drosophila willistoni] gi|194164584|gb|EDW79485.1| GK20386 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|170060190|ref|XP_001865693.1| acetyl-coA acetyl transferase II [Culex quinquefasciatus] gi|167878700|gb|EDS42083.1| acetyl-coA acetyl transferase II [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|193702418|ref|XP_001945243.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic-like isoform 1 [Acyrthosiphon pisum] gi|328725197|ref|XP_003248382.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|194864803|ref|XP_001971115.1| GG14778 [Drosophila erecta] gi|190652898|gb|EDV50141.1| GG14778 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|350427397|ref|XP_003494745.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|24655093|ref|NP_612094.2| CG9149 [Drosophila melanogaster] gi|23092751|gb|AAF47470.2| CG9149 [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195490351|ref|XP_002093103.1| GE21141 [Drosophila yakuba] gi|194179204|gb|EDW92815.1| GE21141 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|195586883|ref|XP_002083197.1| GD13606 [Drosophila simulans] gi|194195206|gb|EDX08782.1| GD13606 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 160 | ||||||
| FB|FBgn0035203 | 392 | CG9149 [Drosophila melanogaste | 0.6 | 0.244 | 0.729 | 4.2e-31 | |
| UNIPROTKB|F1SB62 | 406 | ACAT2 "Uncharacterized protein | 0.65 | 0.256 | 0.634 | 8.2e-28 | |
| ZFIN|ZDB-GENE-990714-22 | 395 | acat2 "acetyl-CoA acetyltransf | 0.662 | 0.268 | 0.579 | 8.2e-28 | |
| UNIPROTKB|Q17QI3 | 397 | ACAT2 "Uncharacterized protein | 0.631 | 0.254 | 0.637 | 5.7e-27 | |
| UNIPROTKB|F1Q466 | 406 | ACAT2 "Uncharacterized protein | 0.65 | 0.256 | 0.615 | 5.7e-27 | |
| TIGR_CMR|CHY_1355 | 393 | CHY_1355 "acetyl-CoA acetyltra | 0.593 | 0.241 | 0.663 | 7.3e-27 | |
| MGI|MGI:87871 | 397 | Acat2 "acetyl-Coenzyme A acety | 0.65 | 0.261 | 0.596 | 1.9e-26 | |
| RGD|1359366 | 397 | Acat2 "acetyl-CoA acetyltransf | 0.65 | 0.261 | 0.596 | 1.9e-26 | |
| UNIPROTKB|F1NT20 | 445 | ACAT2 "Uncharacterized protein | 0.643 | 0.231 | 0.572 | 5.5e-26 | |
| UNIPROTKB|E1BV95 | 217 | ACAT2 "Uncharacterized protein | 0.618 | 0.456 | 0.595 | 6.6e-26 |
| FB|FBgn0035203 CG9149 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 342 (125.4 bits), Expect = 4.2e-31, P = 4.2e-31
Identities = 70/96 (72%), Positives = 83/96 (86%)
Query: 38 NDVVIVSAARTPIGSFLGSLSELKAHDLGSTAIKEVLKRANVLPNEISEVILGQALTAGQ 97
+DV IVSAARTPIGSF G+LS+LKA DLGS I+EVL+RANV E++EVILGQAL+AGQ
Sbjct: 2 SDVFIVSAARTPIGSFNGTLSKLKASDLGSVVIQEVLRRANVEGQEVNEVILGQALSAGQ 61
Query: 98 GQNPARQASIKANIPNEVPASLVNMLCGSGLKSVTL 133
GQNPARQAS+KA +P +VPA +NMLCGSGLK+V L
Sbjct: 62 GQNPARQASLKAGLPIQVPAYGINMLCGSGLKTVAL 97
|
|
| UNIPROTKB|F1SB62 ACAT2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-990714-22 acat2 "acetyl-CoA acetyltransferase 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q17QI3 ACAT2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1Q466 ACAT2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_1355 CHY_1355 "acetyl-CoA acetyltransferase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:87871 Acat2 "acetyl-Coenzyme A acetyltransferase 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1359366 Acat2 "acetyl-CoA acetyltransferase 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NT20 ACAT2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BV95 ACAT2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 160 | |||
| PRK05790 | 393 | PRK05790, PRK05790, putative acyltransferase; Prov | 9e-51 | |
| pfam00108 | 262 | pfam00108, Thiolase_N, Thiolase, N-terminal domain | 2e-45 | |
| cd00751 | 386 | cd00751, thiolase, Thiolase are ubiquitous enzymes | 5e-43 | |
| PLN02644 | 394 | PLN02644, PLN02644, acetyl-CoA C-acetyltransferase | 4e-36 | |
| PRK08235 | 393 | PRK08235, PRK08235, acetyl-CoA acetyltransferase; | 8e-35 | |
| TIGR01930 | 386 | TIGR01930, AcCoA-C-Actrans, acetyl-CoA acetyltrans | 5e-34 | |
| PRK05656 | 393 | PRK05656, PRK05656, acetyl-CoA acetyltransferase; | 1e-33 | |
| PRK06954 | 397 | PRK06954, PRK06954, acetyl-CoA acetyltransferase; | 4e-26 | |
| COG0183 | 392 | COG0183, PaaJ, Acetyl-CoA acetyltransferase [Lipid | 6e-26 | |
| PRK06366 | 388 | PRK06366, PRK06366, acetyl-CoA acetyltransferase; | 4e-24 | |
| PRK06633 | 392 | PRK06633, PRK06633, acetyl-CoA acetyltransferase; | 4e-24 | |
| PRK09051 | 394 | PRK09051, PRK09051, beta-ketothiolase; Provisional | 3e-23 | |
| PRK07661 | 391 | PRK07661, PRK07661, acetyl-CoA acetyltransferase; | 5e-20 | |
| PRK09050 | 401 | PRK09050, PRK09050, beta-ketoadipyl CoA thiolase; | 5e-20 | |
| cd00826 | 393 | cd00826, nondecarbox_cond_enzymes, nondecarboxylat | 3e-19 | |
| TIGR02430 | 400 | TIGR02430, pcaF, 3-oxoadipyl-CoA thiolase | 3e-19 | |
| PRK06205 | 404 | PRK06205, PRK06205, acetyl-CoA acetyltransferase; | 4e-19 | |
| PRK13359 | 400 | PRK13359, PRK13359, beta-ketoadipyl CoA thiolase; | 9e-18 | |
| PRK08947 | 387 | PRK08947, fadA, 3-ketoacyl-CoA thiolase; Reviewed | 2e-16 | |
| PRK07108 | 392 | PRK07108, PRK07108, acetyl-CoA acetyltransferase; | 2e-16 | |
| PLN02287 | 452 | PLN02287, PLN02287, 3-ketoacyl-CoA thiolase | 8e-16 | |
| PRK08131 | 401 | PRK08131, PRK08131, acetyl-CoA acetyltransferase; | 7e-15 | |
| PRK07850 | 387 | PRK07850, PRK07850, acetyl-CoA acetyltransferase; | 2e-14 | |
| PRK09052 | 399 | PRK09052, PRK09052, acetyl-CoA acetyltransferase; | 1e-13 | |
| PRK07801 | 382 | PRK07801, PRK07801, acetyl-CoA acetyltransferase; | 7e-13 | |
| TIGR02445 | 385 | TIGR02445, fadA, fatty oxidation complex, beta sub | 8e-13 | |
| PRK07851 | 406 | PRK07851, PRK07851, acetyl-CoA acetyltransferase; | 3e-12 | |
| PRK06690 | 361 | PRK06690, PRK06690, acetyl-CoA acetyltransferase; | 2e-11 | |
| PRK08242 | 402 | PRK08242, PRK08242, acetyl-CoA acetyltransferase; | 3e-10 | |
| PRK06504 | 390 | PRK06504, PRK06504, acetyl-CoA acetyltransferase; | 1e-09 | |
| PRK06445 | 394 | PRK06445, PRK06445, acetyl-CoA acetyltransferase; | 1e-09 | |
| PRK08963 | 428 | PRK08963, fadI, 3-ketoacyl-CoA thiolase; Reviewed | 2e-07 | |
| PRK08170 | 426 | PRK08170, PRK08170, acetyl-CoA acetyltransferase; | 3e-07 | |
| cd00327 | 254 | cd00327, cond_enzymes, Condensing enzymes; Family | 7e-07 | |
| TIGR02446 | 430 | TIGR02446, FadI, fatty oxidation complex, beta sub | 5e-05 | |
| PRK06025 | 417 | PRK06025, PRK06025, acetyl-CoA acetyltransferase; | 1e-04 |
| >gnl|CDD|180261 PRK05790, PRK05790, putative acyltransferase; Provisional | Back alignment and domain information |
|---|
Score = 166 bits (422), Expect = 9e-51
Identities = 58/100 (58%), Positives = 75/100 (75%)
Query: 38 NDVVIVSAARTPIGSFLGSLSELKAHDLGSTAIKEVLKRANVLPNEISEVILGQALTAGQ 97
DVVIVSAARTPIG F G+L ++ A +LG+ IK L+RA V P ++ EVI+GQ L AG
Sbjct: 2 KDVVIVSAARTPIGKFGGALKDVSAVELGAIVIKAALERAGVPPEQVDEVIMGQVLQAGA 61
Query: 98 GQNPARQASIKANIPNEVPASLVNMLCGSGLKSVTLTSRQ 137
GQNPARQA++KA +P EVPA +N +CGSGLK+V L ++
Sbjct: 62 GQNPARQAALKAGLPVEVPALTINKVCGSGLKAVALAAQA 101
|
Length = 393 |
| >gnl|CDD|215722 pfam00108, Thiolase_N, Thiolase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|238383 cd00751, thiolase, Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine | Back alignment and domain information |
|---|
| >gnl|CDD|215347 PLN02644, PLN02644, acetyl-CoA C-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|181311 PRK08235, PRK08235, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233642 TIGR01930, AcCoA-C-Actrans, acetyl-CoA acetyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|168156 PRK05656, PRK05656, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180775 PRK06954, PRK06954, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223261 COG0183, PaaJ, Acetyl-CoA acetyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|102340 PRK06366, PRK06366, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168632 PRK06633, PRK06633, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181625 PRK09051, PRK09051, beta-ketothiolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181072 PRK07661, PRK07661, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181624 PRK09050, PRK09050, beta-ketoadipyl CoA thiolase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238422 cd00826, nondecarbox_cond_enzymes, nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine | Back alignment and domain information |
|---|
| >gnl|CDD|131483 TIGR02430, pcaF, 3-oxoadipyl-CoA thiolase | Back alignment and domain information |
|---|
| >gnl|CDD|235741 PRK06205, PRK06205, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183998 PRK13359, PRK13359, beta-ketoadipyl CoA thiolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181592 PRK08947, fadA, 3-ketoacyl-CoA thiolase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|180843 PRK07108, PRK07108, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215161 PLN02287, PLN02287, 3-ketoacyl-CoA thiolase | Back alignment and domain information |
|---|
| >gnl|CDD|181242 PRK08131, PRK08131, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181145 PRK07850, PRK07850, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181626 PRK09052, PRK09052, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181123 PRK07801, PRK07801, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131498 TIGR02445, fadA, fatty oxidation complex, beta subunit FadA | Back alignment and domain information |
|---|
| >gnl|CDD|181146 PRK07851, PRK07851, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180659 PRK06690, PRK06690, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236197 PRK08242, PRK08242, acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180595 PRK06504, PRK06504, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180563 PRK06445, PRK06445, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181597 PRK08963, fadI, 3-ketoacyl-CoA thiolase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|181265 PRK08170, PRK08170, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238201 cd00327, cond_enzymes, Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction | Back alignment and domain information |
|---|
| >gnl|CDD|131499 TIGR02446, FadI, fatty oxidation complex, beta subunit FadI | Back alignment and domain information |
|---|
| >gnl|CDD|235675 PRK06025, PRK06025, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 160 | |||
| PF00108 | 264 | Thiolase_N: Thiolase, N-terminal domain; InterPro: | 100.0 | |
| PRK06025 | 417 | acetyl-CoA acetyltransferase; Provisional | 99.97 | |
| PRK13359 | 400 | beta-ketoadipyl CoA thiolase; Provisional | 99.97 | |
| PRK06504 | 390 | acetyl-CoA acetyltransferase; Provisional | 99.96 | |
| PRK07850 | 387 | acetyl-CoA acetyltransferase; Provisional | 99.96 | |
| PRK06633 | 392 | acetyl-CoA acetyltransferase; Provisional | 99.96 | |
| PRK08131 | 401 | acetyl-CoA acetyltransferase; Provisional | 99.96 | |
| PRK09050 | 401 | beta-ketoadipyl CoA thiolase; Validated | 99.96 | |
| TIGR02446 | 430 | FadI fatty oxidation complex, beta subunit FadI. T | 99.96 | |
| PRK08242 | 402 | acetyl-CoA acetyltransferase; Validated | 99.96 | |
| PRK08963 | 428 | fadI 3-ketoacyl-CoA thiolase; Reviewed | 99.95 | |
| PRK09052 | 399 | acetyl-CoA acetyltransferase; Provisional | 99.95 | |
| PRK07108 | 392 | acetyl-CoA acetyltransferase; Provisional | 99.95 | |
| TIGR02430 | 400 | pcaF beta-ketoadipyl CoA thiolase. Members of this | 99.95 | |
| PRK08235 | 393 | acetyl-CoA acetyltransferase; Provisional | 99.95 | |
| KOG1390|consensus | 396 | 99.95 | ||
| PRK06205 | 404 | acetyl-CoA acetyltransferase; Provisional | 99.95 | |
| PRK05656 | 393 | acetyl-CoA acetyltransferase; Provisional | 99.95 | |
| PRK09051 | 394 | beta-ketothiolase; Provisional | 99.95 | |
| PRK06954 | 397 | acetyl-CoA acetyltransferase; Provisional | 99.95 | |
| PRK06366 | 388 | acetyl-CoA acetyltransferase; Provisional | 99.94 | |
| PRK09268 | 427 | acetyl-CoA acetyltransferase; Provisional | 99.94 | |
| PRK07661 | 391 | acetyl-CoA acetyltransferase; Provisional | 99.94 | |
| PRK08947 | 387 | fadA 3-ketoacyl-CoA thiolase; Reviewed | 99.94 | |
| PTZ00455 | 438 | 3-ketoacyl-CoA thiolase; Provisional | 99.94 | |
| TIGR02445 | 385 | fadA fatty oxidation complex, beta subunit FadA. T | 99.94 | |
| PRK08170 | 426 | acetyl-CoA acetyltransferase; Provisional | 99.93 | |
| PRK06445 | 394 | acetyl-CoA acetyltransferase; Provisional | 99.93 | |
| PLN02287 | 452 | 3-ketoacyl-CoA thiolase | 99.92 | |
| PLN02644 | 394 | acetyl-CoA C-acetyltransferase | 99.92 | |
| PRK05790 | 393 | putative acyltransferase; Provisional | 99.92 | |
| PRK07851 | 406 | acetyl-CoA acetyltransferase; Provisional | 99.91 | |
| COG0183 | 392 | PaaJ Acetyl-CoA acetyltransferase [Lipid metabolis | 99.91 | |
| PRK06690 | 361 | acetyl-CoA acetyltransferase; Provisional | 99.91 | |
| KOG1389|consensus | 435 | 99.91 | ||
| PRK07801 | 382 | acetyl-CoA acetyltransferase; Provisional | 99.91 | |
| cd00751 | 386 | thiolase Thiolase are ubiquitous enzymes that cata | 99.89 | |
| KOG1391|consensus | 396 | 99.89 | ||
| TIGR01930 | 386 | AcCoA-C-Actrans acetyl-CoA acetyltransferases. Thi | 99.88 | |
| PRK06365 | 430 | acetyl-CoA acetyltransferase; Provisional | 99.87 | |
| cd00826 | 393 | nondecarbox_cond_enzymes nondecarboxylating conden | 99.87 | |
| PRK12578 | 385 | acetyl-CoA acetyltransferase; Provisional | 99.86 | |
| PRK06157 | 398 | acetyl-CoA acetyltransferase; Validated | 99.86 | |
| PRK07516 | 389 | acetyl-CoA acetyltransferase; Provisional | 99.86 | |
| PRK06059 | 399 | lipid-transfer protein; Provisional | 99.85 | |
| PRK06064 | 389 | acetyl-CoA acetyltransferase; Provisional | 99.84 | |
| PRK06289 | 403 | acetyl-CoA acetyltransferase; Provisional | 99.83 | |
| KOG1392|consensus | 465 | 99.8 | ||
| PRK08256 | 391 | lipid-transfer protein; Provisional | 99.79 | |
| cd00829 | 375 | SCP-x_thiolase Thiolase domain associated with ste | 99.78 | |
| PRK08313 | 386 | acetyl-CoA acetyltransferase; Provisional | 99.77 | |
| COG0332 | 323 | FabH 3-oxoacyl-[acyl-carrier-protein] | 99.77 | |
| PRK06065 | 392 | acetyl-CoA acetyltransferase; Provisional | 99.76 | |
| PRK06158 | 384 | thiolase; Provisional | 99.73 | |
| CHL00203 | 326 | fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Pr | 99.73 | |
| KOG1406|consensus | 408 | 99.7 | ||
| PRK09352 | 319 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 99.7 | |
| TIGR00747 | 318 | fabH 3-oxoacyl-(acyl-carrier-protein) synthase III | 99.67 | |
| PRK09258 | 338 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 99.67 | |
| PRK06066 | 385 | acetyl-CoA acetyltransferase; Provisional | 99.66 | |
| PRK08142 | 388 | acetyl-CoA acetyltransferase; Provisional | 99.64 | |
| PLN02326 | 379 | 3-oxoacyl-[acyl-carrier-protein] synthase III | 99.64 | |
| cd00827 | 324 | init_cond_enzymes "initiating" condensing enzymes | 99.64 | |
| PRK12879 | 325 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 99.63 | |
| cd00830 | 320 | KAS_III Ketoacyl-acyl carrier protein synthase III | 99.63 | |
| PRK06816 | 378 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 99.63 | |
| TIGR00748 | 345 | HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase | 99.62 | |
| PRK12880 | 353 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 99.6 | |
| PRK05963 | 326 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 99.6 | |
| PRK07855 | 386 | lipid-transfer protein; Provisional | 99.6 | |
| PRK07204 | 329 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 99.58 | |
| PRK07937 | 352 | lipid-transfer protein; Provisional | 99.57 | |
| PRK04262 | 347 | hypothetical protein; Provisional | 99.57 | |
| PRK08257 | 498 | acetyl-CoA acetyltransferase; Validated | 99.55 | |
| cd00327 | 254 | cond_enzymes Condensing enzymes; Family of enzymes | 99.53 | |
| PRK06840 | 339 | hypothetical protein; Validated | 99.52 | |
| PRK07515 | 372 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 99.49 | |
| cd00831 | 361 | CHS_like Chalcone and stilbene synthases; plant-sp | 99.46 | |
| cd00825 | 332 | decarbox_cond_enzymes decarboxylating condensing e | 99.45 | |
| TIGR02845 | 327 | spore_V_AD stage V sporulation protein AD. Bacillu | 99.44 | |
| PRK08304 | 337 | stage V sporulation protein AD; Validated | 99.43 | |
| PLN03168 | 389 | chalcone synthase; Provisional | 99.38 | |
| PLN02577 | 459 | hydroxymethylglutaryl-CoA synthase | 99.38 | |
| PLN03169 | 391 | chalcone synthase family protein; Provisional | 99.36 | |
| PLN03171 | 399 | chalcone synthase-like protein; Provisional | 99.36 | |
| PLN02932 | 478 | 3-ketoacyl-CoA synthase | 99.35 | |
| TIGR01835 | 379 | HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synt | 99.35 | |
| PLN02377 | 502 | 3-ketoacyl-CoA synthase | 99.29 | |
| TIGR01833 | 454 | HMG-CoA-S_euk 3-hydroxy-3-methylglutaryl-CoA-synth | 99.27 | |
| PLN03170 | 401 | chalcone synthase; Provisional | 99.26 | |
| TIGR03150 | 407 | fabF beta-ketoacyl-acyl-carrier-protein synthase I | 99.26 | |
| PRK12404 | 334 | stage V sporulation protein AD; Provisional | 99.25 | |
| PLN02192 | 511 | 3-ketoacyl-CoA synthase | 99.25 | |
| PLN03173 | 391 | chalcone synthase; Provisional | 99.25 | |
| PLN03172 | 393 | chalcone synthase family protein; Provisional | 99.25 | |
| PRK07314 | 411 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 99.23 | |
| PLN02854 | 521 | 3-ketoacyl-CoA synthase | 99.16 | |
| PRK06147 | 348 | 3-oxoacyl-(acyl carrier protein) synthase; Validat | 99.13 | |
| smart00825 | 424 | PKS_KS Beta-ketoacyl synthase. The structure of be | 99.11 | |
| cd00834 | 406 | KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) | 99.01 | |
| cd00833 | 421 | PKS polyketide synthases (PKSs) polymerize simple | 99.0 | |
| PLN00415 | 466 | 3-ketoacyl-CoA synthase | 98.99 | |
| cd00828 | 407 | elong_cond_enzymes "elongating" condensing enzymes | 98.96 | |
| PTZ00050 | 421 | 3-oxoacyl-acyl carrier protein synthase; Provision | 98.93 | |
| PRK06333 | 424 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 98.87 | |
| PRK08722 | 414 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 98.85 | |
| PRK08439 | 406 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 98.76 | |
| COG3425 | 377 | PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipi | 98.75 | |
| PRK07103 | 410 | polyketide beta-ketoacyl:acyl carrier protein synt | 98.74 | |
| PF00109 | 254 | ketoacyl-synt: Beta-ketoacyl synthase, N-terminal | 98.74 | |
| PLN02836 | 437 | 3-oxoacyl-[acyl-carrier-protein] synthase | 98.7 | |
| PF00195 | 226 | Chal_sti_synt_N: Chalcone and stilbene synthases, | 98.66 | |
| PF08392 | 290 | FAE1_CUT1_RppA: FAE1/Type III polyketide synthase- | 98.65 | |
| PRK05952 | 381 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 98.62 | |
| PRK06519 | 398 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 98.5 | |
| PF01154 | 174 | HMG_CoA_synt_N: Hydroxymethylglutaryl-coenzyme A s | 98.49 | |
| PRK06501 | 425 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 98.48 | |
| PLN02787 | 540 | 3-oxoacyl-[acyl-carrier-protein] synthase II | 98.47 | |
| PRK07967 | 406 | 3-oxoacyl-(acyl carrier protein) synthase I; Revie | 98.45 | |
| PRK09116 | 405 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 98.44 | |
| cd00832 | 399 | CLF Chain-length factor (CLF) is a factor required | 98.44 | |
| COG3424 | 356 | BcsA Predicted naringenin-chalcone synthase [Secon | 98.34 | |
| PRK14691 | 342 | 3-oxoacyl-(acyl carrier protein) synthase II; Prov | 98.32 | |
| PRK07910 | 418 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 98.21 | |
| COG3321 | 1061 | Polyketide synthase modules and related proteins [ | 98.13 | |
| PF07451 | 329 | SpoVAD: Stage V sporulation protein AD (SpoVAD); I | 97.98 | |
| TIGR02813 | 2582 | omega_3_PfaA polyketide-type polyunsaturated fatty | 97.95 | |
| COG0304 | 412 | FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Li | 97.87 | |
| PF08545 | 80 | ACP_syn_III: 3-Oxoacyl-[acyl-carrier-protein (ACP) | 97.76 | |
| PRK09185 | 392 | 3-oxoacyl-(acyl carrier protein) synthase I; Revie | 97.72 | |
| KOG1394|consensus | 440 | 97.58 | ||
| KOG1393|consensus | 462 | 95.28 | ||
| KOG1202|consensus | 2376 | 95.23 | ||
| PRK08257 | 498 | acetyl-CoA acetyltransferase; Validated | 92.56 | |
| PF08541 | 90 | ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (AC | 91.77 | |
| PF02801 | 119 | Ketoacyl-synt_C: Beta-ketoacyl synthase, C-termina | 90.42 | |
| PRK06816 | 378 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 89.22 | |
| PRK06064 | 389 | acetyl-CoA acetyltransferase; Provisional | 87.64 | |
| COG1214 | 220 | Inactive homolog of metal-dependent proteases, put | 87.32 | |
| TIGR00748 | 345 | HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase | 87.3 | |
| TIGR03285 | 445 | methan_mark_14 putative methanogenesis marker prot | 87.28 | |
| PF13723 | 218 | Ketoacyl-synt_2: Beta-ketoacyl synthase, N-termina | 86.84 | |
| PRK12578 | 385 | acetyl-CoA acetyltransferase; Provisional | 86.74 | |
| PRK09604 | 332 | UGMP family protein; Validated | 86.43 | |
| cd00327 | 254 | cond_enzymes Condensing enzymes; Family of enzymes | 86.29 | |
| TIGR03150 | 407 | fabF beta-ketoacyl-acyl-carrier-protein synthase I | 85.72 | |
| PRK06158 | 384 | thiolase; Provisional | 85.5 | |
| PRK09185 | 392 | 3-oxoacyl-(acyl carrier protein) synthase I; Revie | 85.4 | |
| TIGR00747 | 318 | fabH 3-oxoacyl-(acyl-carrier-protein) synthase III | 85.33 | |
| cd00829 | 375 | SCP-x_thiolase Thiolase domain associated with ste | 83.48 | |
| PF09887 | 448 | DUF2114: Uncharacterized protein conserved in arch | 83.37 | |
| PRK07937 | 352 | lipid-transfer protein; Provisional | 83.29 | |
| PRK07204 | 329 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 83.04 | |
| PRK05963 | 326 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 81.6 | |
| smart00825 | 424 | PKS_KS Beta-ketoacyl synthase. The structure of be | 81.36 | |
| CHL00203 | 326 | fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Pr | 81.29 | |
| PRK12879 | 325 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 81.27 | |
| TIGR03725 | 202 | bact_YeaZ universal bacterial protein YeaZ. This f | 80.94 | |
| PRK12880 | 353 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 80.7 |
| >PF00108 Thiolase_N: Thiolase, N-terminal domain; InterPro: IPR020616 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.6e-33 Score=231.56 Aligned_cols=122 Identities=40% Similarity=0.602 Sum_probs=110.6
Q ss_pred CCceEEEeeeeccccccCccCCCCCHHHHHHHHHHHHHHHcCCCccccCceEEEeeecCCCCCChHHHHHHHcCCCCCCc
Q psy4156 37 DNDVVIVSAARTPIGSFLGSLSELKAHDLGSTAIKEVLKRANVLPNEISEVILGQALTAGQGQNPARQASIKANIPNEVP 116 (160)
Q Consensus 37 m~~V~Ivg~~rTpfg~~~g~~~~~~~~dL~~~A~~~aL~~agI~~~~ID~vi~G~~~~~~~g~~~ar~~al~~GLp~~vP 116 (160)
|++|||+++.|||||++.|.|++.++.||+.++++++|++++|+|++||.+++||+.+...+++++|.+++.+|||.++|
T Consensus 1 M~~v~Iv~a~RTPfg~~~G~l~~~~~~~L~~~a~~~al~~~~i~~~~Id~v~~G~~~~~~~g~~~ar~~~l~aGl~~~vp 80 (264)
T PF00108_consen 1 MRDVVIVGAVRTPFGKFGGSLADVSPEDLAAEAVKAALERAGIDPEDIDAVIVGNVLQEGEGQNIARQAALAAGLPESVP 80 (264)
T ss_dssp -TTEEEEEEEEE--ECTTSTTTTS-HHHHHHHHHHHHHHHHTSHGGGEEEEEEE-SSSCTTTCHHHHHHHHHTTS-TTSE
T ss_pred CCCEEEEEeeeCccccCCCccCCCCHHHHHHHHHHHHHHhcccchhhhhhcCcccccccccchhhhhhhhhhcccccccc
Confidence 78999999999999999999999999999999999999999999999999999999987778899999999999998999
Q ss_pred eEEEcccCccHHHHHHHHHHHHHcCCCcEEEEEeecccccCC
Q psy4156 117 ASLVNMLCGSGLKSVTLTSRQQVLLTLHWLGNGAQYHITADA 158 (160)
Q Consensus 117 a~~V~~aCaSGl~Al~~Aa~~I~sG~~~vlivgG~E~mt~~~ 158 (160)
+++||++|+||++|+++|+..|++|.+|++|++|+||||...
T Consensus 81 ~~~V~~~CaSG~~Av~~a~~~I~sG~~dvvlagGvE~mS~~p 122 (264)
T PF00108_consen 81 ATTVNRACASGLQAVHLAAMAIASGEADVVLAGGVESMSRVP 122 (264)
T ss_dssp EEEEE-GGGHHHHHHHHHHHHHHTTS-SEEEEEEEEETTTSC
T ss_pred eeeehhhhhHHHHHHHHhhhhhcCCCccEEEEeccccccccc
Confidence 999999999999999999999999999999999999999864
|
3.1.9 from EC) and 3-ketoacyl-CoA thiolase (2.3.1.16 from EC). 3-ketoacyl-CoA thiolase (also called thiolase I) has a broad chain-length specificity for its substrates and is involved in degradative pathways such as fatty acid beta-oxidation. Acetoacetyl-CoA thiolase (also called thiolase II) is specific for the thiolysis of acetoacetyl-CoA and involved in biosynthetic pathways such as poly beta-hydroxybutyrate synthesis or steroid biogenesis. In eukaryotes, there are two forms of 3-ketoacyl-CoA thiolase: one located in the mitochondrion and the other in peroxisomes. There are two conserved cysteine residues important for thiolase activity. The first located in the N-terminal section of the enzymes is involved in the formation of an acyl-enzyme intermediate; the second located at the C-terminal extremity is the active site base involved in deprotonation in the condensation reaction. Mammalian nonspecific lipid-transfer protein (nsL-TP) (also known as sterol carrier protein 2) is a protein which seems to exist in two different forms: a 14 Kd protein (SCP-2) and a larger 58 Kd protein (SCP-x). The former is found in the cytoplasm or the mitochondria and is involved in lipid transport; the latter is found in peroxisomes. The C-terminal part of SCP-x is identical to SCP-2 while the N-terminal portion is evolutionary related to thiolases [].; GO: 0016747 transferase activity, transferring acyl groups other than amino-acyl groups, 0008152 metabolic process; PDB: 1PXT_B 1AFW_B 1WL4_A 1WL5_A 4E1L_B 1WDK_D 1WDM_D 2D3T_D 1WDL_C 2WUA_B .... |
| >PRK06025 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13359 beta-ketoadipyl CoA thiolase; Provisional | Back alignment and domain information |
|---|
| >PRK06504 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07850 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06633 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08131 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09050 beta-ketoadipyl CoA thiolase; Validated | Back alignment and domain information |
|---|
| >TIGR02446 FadI fatty oxidation complex, beta subunit FadI | Back alignment and domain information |
|---|
| >PRK08242 acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK08963 fadI 3-ketoacyl-CoA thiolase; Reviewed | Back alignment and domain information |
|---|
| >PRK09052 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07108 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02430 pcaF beta-ketoadipyl CoA thiolase | Back alignment and domain information |
|---|
| >PRK08235 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1390|consensus | Back alignment and domain information |
|---|
| >PRK06205 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05656 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09051 beta-ketothiolase; Provisional | Back alignment and domain information |
|---|
| >PRK06954 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06366 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09268 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07661 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08947 fadA 3-ketoacyl-CoA thiolase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00455 3-ketoacyl-CoA thiolase; Provisional | Back alignment and domain information |
|---|
| >TIGR02445 fadA fatty oxidation complex, beta subunit FadA | Back alignment and domain information |
|---|
| >PRK08170 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06445 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02287 3-ketoacyl-CoA thiolase | Back alignment and domain information |
|---|
| >PLN02644 acetyl-CoA C-acetyltransferase | Back alignment and domain information |
|---|
| >PRK05790 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07851 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0183 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK06690 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1389|consensus | Back alignment and domain information |
|---|
| >PRK07801 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine | Back alignment and domain information |
|---|
| >KOG1391|consensus | Back alignment and domain information |
|---|
| >TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases | Back alignment and domain information |
|---|
| >PRK06365 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00826 nondecarbox_cond_enzymes nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine | Back alignment and domain information |
|---|
| >PRK12578 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06157 acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK07516 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06059 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >PRK06064 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06289 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1392|consensus | Back alignment and domain information |
|---|
| >PRK08256 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >cd00829 SCP-x_thiolase Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism | Back alignment and domain information |
|---|
| >PRK08313 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0332 FabH 3-oxoacyl-[acyl-carrier-protein] | Back alignment and domain information |
|---|
| >PRK06065 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06158 thiolase; Provisional | Back alignment and domain information |
|---|
| >CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional | Back alignment and domain information |
|---|
| >KOG1406|consensus | Back alignment and domain information |
|---|
| >PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III | Back alignment and domain information |
|---|
| >PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >PRK06066 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08142 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02326 3-oxoacyl-[acyl-carrier-protein] synthase III | Back alignment and domain information |
|---|
| >cd00827 init_cond_enzymes "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes | Back alignment and domain information |
|---|
| >PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >cd00830 KAS_III Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems | Back alignment and domain information |
|---|
| >PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >TIGR00748 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, putative | Back alignment and domain information |
|---|
| >PRK12880 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK07855 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >PRK07937 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >PRK04262 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08257 acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction | Back alignment and domain information |
|---|
| >PRK06840 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK07515 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >cd00831 CHS_like Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs | Back alignment and domain information |
|---|
| >cd00825 decarbox_cond_enzymes decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction | Back alignment and domain information |
|---|
| >TIGR02845 spore_V_AD stage V sporulation protein AD | Back alignment and domain information |
|---|
| >PRK08304 stage V sporulation protein AD; Validated | Back alignment and domain information |
|---|
| >PLN03168 chalcone synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02577 hydroxymethylglutaryl-CoA synthase | Back alignment and domain information |
|---|
| >PLN03169 chalcone synthase family protein; Provisional | Back alignment and domain information |
|---|
| >PLN03171 chalcone synthase-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN02932 3-ketoacyl-CoA synthase | Back alignment and domain information |
|---|
| >TIGR01835 HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synthase, prokaryotic clade | Back alignment and domain information |
|---|
| >PLN02377 3-ketoacyl-CoA synthase | Back alignment and domain information |
|---|
| >TIGR01833 HMG-CoA-S_euk 3-hydroxy-3-methylglutaryl-CoA-synthase, eukaryotic clade | Back alignment and domain information |
|---|
| >PLN03170 chalcone synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR03150 fabF beta-ketoacyl-acyl-carrier-protein synthase II | Back alignment and domain information |
|---|
| >PRK12404 stage V sporulation protein AD; Provisional | Back alignment and domain information |
|---|
| >PLN02192 3-ketoacyl-CoA synthase | Back alignment and domain information |
|---|
| >PLN03173 chalcone synthase; Provisional | Back alignment and domain information |
|---|
| >PLN03172 chalcone synthase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK07314 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PLN02854 3-ketoacyl-CoA synthase | Back alignment and domain information |
|---|
| >PRK06147 3-oxoacyl-(acyl carrier protein) synthase; Validated | Back alignment and domain information |
|---|
| >smart00825 PKS_KS Beta-ketoacyl synthase | Back alignment and domain information |
|---|
| >cd00834 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II | Back alignment and domain information |
|---|
| >cd00833 PKS polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations | Back alignment and domain information |
|---|
| >PLN00415 3-ketoacyl-CoA synthase | Back alignment and domain information |
|---|
| >cd00828 elong_cond_enzymes "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases | Back alignment and domain information |
|---|
| >PTZ00050 3-oxoacyl-acyl carrier protein synthase; Provisional | Back alignment and domain information |
|---|
| >PRK06333 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK08722 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK08439 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >COG3425 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK07103 polyketide beta-ketoacyl:acyl carrier protein synthase; Validated | Back alignment and domain information |
|---|
| >PF00109 ketoacyl-synt: Beta-ketoacyl synthase, N-terminal domain; InterPro: IPR014030 Beta-ketoacyl-ACP synthase 2 | Back alignment and domain information |
|---|
| >PLN02836 3-oxoacyl-[acyl-carrier-protein] synthase | Back alignment and domain information |
|---|
| >PF00195 Chal_sti_synt_N: Chalcone and stilbene synthases, N-terminal domain; InterPro: IPR001099 Synonym(s): Chalcone synthase, Flavonone synthase, 6'-deoxychalcone synthase Naringenin-chalcone synthases (2 | Back alignment and domain information |
|---|
| >PF08392 FAE1_CUT1_RppA: FAE1/Type III polyketide synthase-like protein; InterPro: IPR013601 This domain is found in proteins that are described as 3-ketoacyl-CoA synthases, type III polyketide synthases, fatty acid elongases and fatty acid condensing enzymes, and are found in both prokaryotic and eukaryotic (mainly plant) species | Back alignment and domain information |
|---|
| >PRK05952 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK06519 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PF01154 HMG_CoA_synt_N: Hydroxymethylglutaryl-coenzyme A synthase N terminal; InterPro: IPR013528 Synonym(s): 3-hydroxy-3-methylglutaryl-coenzyme A synthase, HMG-CoA synthase | Back alignment and domain information |
|---|
| >PRK06501 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PLN02787 3-oxoacyl-[acyl-carrier-protein] synthase II | Back alignment and domain information |
|---|
| >PRK07967 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed | Back alignment and domain information |
|---|
| >PRK09116 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >cd00832 CLF Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria | Back alignment and domain information |
|---|
| >COG3424 BcsA Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK14691 3-oxoacyl-(acyl carrier protein) synthase II; Provisional | Back alignment and domain information |
|---|
| >PRK07910 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >COG3321 Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF07451 SpoVAD: Stage V sporulation protein AD (SpoVAD); InterPro: IPR010894 This family contains the bacterial stage V sporulation protein AD (SpoVAD), which is approximately 340 residues long | Back alignment and domain information |
|---|
| >TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA | Back alignment and domain information |
|---|
| >COG0304 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF08545 ACP_syn_III: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III; InterPro: IPR013751 Fatty acid synthesis (FAS) is a vital aspect of cellular physiology which can occur by two distinct pathways | Back alignment and domain information |
|---|
| >PRK09185 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed | Back alignment and domain information |
|---|
| >KOG1394|consensus | Back alignment and domain information |
|---|
| >KOG1393|consensus | Back alignment and domain information |
|---|
| >KOG1202|consensus | Back alignment and domain information |
|---|
| >PRK08257 acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >PF08541 ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal ; InterPro: IPR013747 This domain is found on 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III 2 | Back alignment and domain information |
|---|
| >PF02801 Ketoacyl-synt_C: Beta-ketoacyl synthase, C-terminal domain; InterPro: IPR014031 Beta-ketoacyl-ACP synthase 2 | Back alignment and domain information |
|---|
| >PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >PRK06064 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1214 Inactive homolog of metal-dependent proteases, putative molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00748 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, putative | Back alignment and domain information |
|---|
| >TIGR03285 methan_mark_14 putative methanogenesis marker protein 14 | Back alignment and domain information |
|---|
| >PF13723 Ketoacyl-synt_2: Beta-ketoacyl synthase, N-terminal domain | Back alignment and domain information |
|---|
| >PRK12578 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09604 UGMP family protein; Validated | Back alignment and domain information |
|---|
| >cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction | Back alignment and domain information |
|---|
| >TIGR03150 fabF beta-ketoacyl-acyl-carrier-protein synthase II | Back alignment and domain information |
|---|
| >PRK06158 thiolase; Provisional | Back alignment and domain information |
|---|
| >PRK09185 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed | Back alignment and domain information |
|---|
| >TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III | Back alignment and domain information |
|---|
| >cd00829 SCP-x_thiolase Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism | Back alignment and domain information |
|---|
| >PF09887 DUF2114: Uncharacterized protein conserved in archaea (DUF2114); InterPro: IPR008303 There are currently no experimental data for members of this group or their homologues | Back alignment and domain information |
|---|
| >PRK07937 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >smart00825 PKS_KS Beta-ketoacyl synthase | Back alignment and domain information |
|---|
| >CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional | Back alignment and domain information |
|---|
| >PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >TIGR03725 bact_YeaZ universal bacterial protein YeaZ | Back alignment and domain information |
|---|
| >PRK12880 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 160 | ||||
| 1wl4_A | 397 | Human Cytosolic Acetoacetyl-Coa Thiolase Complexed | 4e-26 | ||
| 2wl4_A | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Of | 5e-26 | ||
| 2wkv_A | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Of | 5e-26 | ||
| 2wl5_C | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Of | 5e-26 | ||
| 2wkt_C | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Of | 5e-26 | ||
| 2wl6_A | 392 | Biosynthetic Thiolase From Z. Ramigera. The N316h-H | 6e-26 | ||
| 2vu2_A | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Wit | 6e-26 | ||
| 1dlu_A | 389 | Unliganded Biosynthetic Thiolase From Zoogloea Rami | 6e-26 | ||
| 2wku_A | 392 | Biosynthetic Thiolase From Z. Ramigera. The N316h M | 6e-26 | ||
| 2wl4_C | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Of | 6e-26 | ||
| 1m1t_A | 392 | Biosynthetic Thiolase, Q64a Mutant Length = 392 | 3e-25 | ||
| 1m1o_A | 392 | Crystal Structure Of Biosynthetic Thiolase, C89a Mu | 1e-24 | ||
| 1qfl_A | 389 | Biosynthetic Thiolase From Zoogloea Ramigera In Com | 1e-24 | ||
| 2wl5_A | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Of | 1e-24 | ||
| 2wl4_B | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Of | 1e-24 | ||
| 1m4s_A | 392 | Biosynthetic Thiolase, Cys89 Acetylated, Unliganded | 1e-24 | ||
| 2wl4_D | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Of | 1e-24 | ||
| 2wkt_A | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Of | 1e-24 | ||
| 4dd5_A | 396 | Biosynthetic Thiolase (Thla1) From Clostridium Diff | 4e-24 | ||
| 4e1l_A | 395 | Crystal Structure Of Acetoacetyl-Coa Thiolase (Thla | 8e-23 | ||
| 2ib7_A | 395 | Crystallographic And Kinetic Studies Of Human Mitoc | 4e-21 | ||
| 2f2s_A | 406 | Human Mitochondrial Acetoacetyl-Coa Thiolase Length | 7e-20 | ||
| 2ibu_A | 395 | Crystallographic And Kinetic Studies Of Human Mitoc | 1e-19 | ||
| 1ulq_A | 401 | Crystal Structure Of Tt0182 From Thermus Thermophil | 1e-11 | ||
| 3ss6_A | 394 | Crystal Structure Of The Bacillus Anthracis Acetyl- | 4e-11 | ||
| 2wua_A | 440 | Structure Of The Peroxisomal 3-Ketoacyl-Coa Thiolas | 7e-10 | ||
| 1wdk_C | 390 | Fatty Acid Beta-Oxidation Multienzyme Complex From | 9e-10 | ||
| 2c7y_A | 404 | Plant Enzyme Length = 404 | 6e-09 | ||
| 2wu9_A | 442 | Crystal Structure Of Peroxisomal Kat2 From Arabidop | 6e-09 | ||
| 2iik_A | 418 | Crystal Structure Of Human Peroxisomal Acetyl-Coa A | 6e-08 | ||
| 3goa_A | 387 | Crystal Structure Of The Salmonella Typhimurium Fad | 5e-07 | ||
| 1afw_A | 393 | The 1.8 Angstrom Crystal Structure Of The Dimeric P | 4e-05 | ||
| 1pxt_A | 390 | The 2.8 Angstroms Structure Of Peroxisomal 3-Ketoac | 4e-05 | ||
| 3svk_A | 407 | Crystal Structure Of Acetyl-Coa Acetyltransferase F | 7e-05 |
| >pdb|1WL4|A Chain A, Human Cytosolic Acetoacetyl-Coa Thiolase Complexed With Coa Length = 397 | Back alignment and structure |
|
| >pdb|2WL4|A Chain A, Biosynthetic Thiolase From Z. Ramigera. Complex Of The H348a Mutant With Coenzyme A Length = 392 | Back alignment and structure |
| >pdb|2WKV|A Chain A, Biosynthetic Thiolase From Z. Ramigera. Complex Of The N316d Mutant With Coenzyme A. Length = 392 | Back alignment and structure |
| >pdb|2WL5|C Chain C, Biosynthetic Thiolase From Z. Ramigera. Complex Of The H348n Mutant With Coenzyme A. Length = 392 | Back alignment and structure |
| >pdb|2WKT|C Chain C, Biosynthetic Thiolase From Z. Ramigera. Complex Of The N316a Mutant With Coenzyme A Length = 392 | Back alignment and structure |
| >pdb|2WL6|A Chain A, Biosynthetic Thiolase From Z. Ramigera. The N316h-H348n Mutant. Length = 392 | Back alignment and structure |
| >pdb|2VU2|A Chain A, Biosynthetic Thiolase From Z. Ramigera. Complex With S- Pantetheine-11-pivalate. Length = 392 | Back alignment and structure |
| >pdb|1DLU|A Chain A, Unliganded Biosynthetic Thiolase From Zoogloea Ramigera Length = 389 | Back alignment and structure |
| >pdb|2WKU|A Chain A, Biosynthetic Thiolase From Z. Ramigera. The N316h Mutant. Length = 392 | Back alignment and structure |
| >pdb|2WL4|C Chain C, Biosynthetic Thiolase From Z. Ramigera. Complex Of The H348a Mutant With Coenzyme A Length = 392 | Back alignment and structure |
| >pdb|1M1T|A Chain A, Biosynthetic Thiolase, Q64a Mutant Length = 392 | Back alignment and structure |
| >pdb|1M1O|A Chain A, Crystal Structure Of Biosynthetic Thiolase, C89a Mutant, Complexed With Acetoacetyl-Coa Length = 392 | Back alignment and structure |
| >pdb|1QFL|A Chain A, Biosynthetic Thiolase From Zoogloea Ramigera In Complex With A Reaction Intermediate. Length = 389 | Back alignment and structure |
| >pdb|2WL5|A Chain A, Biosynthetic Thiolase From Z. Ramigera. Complex Of The H348n Mutant With Coenzyme A. Length = 392 | Back alignment and structure |
| >pdb|2WL4|B Chain B, Biosynthetic Thiolase From Z. Ramigera. Complex Of The H348a Mutant With Coenzyme A Length = 392 | Back alignment and structure |
| >pdb|1M4S|A Chain A, Biosynthetic Thiolase, Cys89 Acetylated, Unliganded Form Length = 392 | Back alignment and structure |
| >pdb|2WL4|D Chain D, Biosynthetic Thiolase From Z. Ramigera. Complex Of The H348a Mutant With Coenzyme A Length = 392 | Back alignment and structure |
| >pdb|2WKT|A Chain A, Biosynthetic Thiolase From Z. Ramigera. Complex Of The N316a Mutant With Coenzyme A. Length = 392 | Back alignment and structure |
| >pdb|4DD5|A Chain A, Biosynthetic Thiolase (Thla1) From Clostridium Difficile Length = 396 | Back alignment and structure |
| >pdb|4E1L|A Chain A, Crystal Structure Of Acetoacetyl-Coa Thiolase (Thla2) From Clostridium Difficile Length = 395 | Back alignment and structure |
| >pdb|2IB7|A Chain A, Crystallographic And Kinetic Studies Of Human Mitochondrial Acetoacetyl-Coa Thiolase (T2): The Importance Of Potassium And Chloride For Its Structure And Function Length = 395 | Back alignment and structure |
| >pdb|2F2S|A Chain A, Human Mitochondrial Acetoacetyl-Coa Thiolase Length = 406 | Back alignment and structure |
| >pdb|2IBU|A Chain A, Crystallographic And Kinetic Studies Of Human Mitochondrial Acetoacetyl-coa Thiolase (t2): The Importance Of Potassium And Chloride For Its Structure And Function Length = 395 | Back alignment and structure |
| >pdb|1ULQ|A Chain A, Crystal Structure Of Tt0182 From Thermus Thermophilus Hb8 Length = 401 | Back alignment and structure |
| >pdb|3SS6|A Chain A, Crystal Structure Of The Bacillus Anthracis Acetyl-Coa Acetyltransferase Length = 394 | Back alignment and structure |
| >pdb|2WUA|A Chain A, Structure Of The Peroxisomal 3-Ketoacyl-Coa Thiolase From Sunflower Length = 440 | Back alignment and structure |
| >pdb|1WDK|C Chain C, Fatty Acid Beta-Oxidation Multienzyme Complex From Pseudomonas Fragi, Form I (Native2) Length = 390 | Back alignment and structure |
| >pdb|2C7Y|A Chain A, Plant Enzyme Length = 404 | Back alignment and structure |
| >pdb|2WU9|A Chain A, Crystal Structure Of Peroxisomal Kat2 From Arabidopsis Thaliana Length = 442 | Back alignment and structure |
| >pdb|2IIK|A Chain A, Crystal Structure Of Human Peroxisomal Acetyl-Coa Acyl Transferase 1 (Acaa1) Length = 418 | Back alignment and structure |
| >pdb|3GOA|A Chain A, Crystal Structure Of The Salmonella Typhimurium Fada 3- Ketoacyl-Coa Thiolase Length = 387 | Back alignment and structure |
| >pdb|1AFW|A Chain A, The 1.8 Angstrom Crystal Structure Of The Dimeric Peroxisomal Thiolase Of Saccharomyces Cerevisiae Length = 393 | Back alignment and structure |
| >pdb|1PXT|A Chain A, The 2.8 Angstroms Structure Of Peroxisomal 3-Ketoacyl-Coa Thiolase Of Saccharomyces Cerevisiae: A Five Layered A-B-A- B-A Structure, Constructed From Two Core Domains Of Identical Topology Length = 390 | Back alignment and structure |
| >pdb|3SVK|A Chain A, Crystal Structure Of Acetyl-Coa Acetyltransferase From Mycobacterium Avium Length = 407 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 160 | |||
| 1wl4_A | 397 | Acetyl-coenzyme A acetyltransferase 2; thiolase fo | 2e-57 | |
| 2vu1_A | 392 | Acetyl-COA acetyltransferase; acyltransferase, PHB | 5e-56 | |
| 4e1l_A | 395 | Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, | 1e-55 | |
| 4dd5_A | 396 | Acetyl-COA acetyltransferase; structural genomics, | 2e-55 | |
| 2ib8_A | 395 | Acetyl-COA acetyltransferase; thiolase fold, potas | 2e-54 | |
| 3ss6_A | 394 | Acetyl-COA acetyltransferase; structural genomics, | 3e-53 | |
| 1ulq_A | 401 | Putative acetyl-COA acetyltransferase; structural | 6e-47 | |
| 1afw_A | 393 | 3-ketoacetyl-COA thiolase; fatty acid metabolism; | 2e-44 | |
| 2iik_A | 418 | 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m | 2e-42 | |
| 2wu9_A | 442 | 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o | 6e-39 | |
| 1wdk_C | 390 | 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame | 1e-38 | |
| 3goa_A | 387 | 3-ketoacyl-COA thiolase; metabolism, fatty acid, p | 5e-35 | |
| 3svk_A | 407 | Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, | 3e-23 |
| >1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A Length = 397 | Back alignment and structure |
|---|
Score = 183 bits (466), Expect = 2e-57
Identities = 62/101 (61%), Positives = 71/101 (70%)
Query: 33 MVLSDNDVVIVSAARTPIGSFLGSLSELKAHDLGSTAIKEVLKRANVLPNEISEVILGQA 92
M + VVIVSAART IGSF G+L+ + DLGST IKEVLKRA V P ++SEVI G
Sbjct: 1 MNAGSDPVVIVSAARTIIGSFNGALAAVPVQDLGSTVIKEVLKRATVAPEDVSEVIFGHV 60
Query: 93 LTAGQGQNPARQASIKANIPNEVPASLVNMLCGSGLKSVTL 133
L AG GQNP RQAS+ A IP VPA M+CGSGLK+V L
Sbjct: 61 LAAGCGQNPVRQASVGAGIPYSVPAWSCQMICGSGLKAVCL 101
|
| >2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... Length = 392 | Back alignment and structure |
|---|
| >4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} Length = 395 | Back alignment and structure |
|---|
| >4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} Length = 396 | Back alignment and structure |
|---|
| >2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* Length = 395 | Back alignment and structure |
|---|
| >3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} Length = 394 | Back alignment and structure |
|---|
| >1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Length = 401 | Back alignment and structure |
|---|
| >1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A Length = 393 | Back alignment and structure |
|---|
| >2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} Length = 418 | Back alignment and structure |
|---|
| >2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A Length = 442 | Back alignment and structure |
|---|
| >1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* Length = 390 | Back alignment and structure |
|---|
| >3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} Length = 387 | Back alignment and structure |
|---|
| >3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium} Length = 407 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 160 | |||
| 4e1l_A | 395 | Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, | 99.94 | |
| 3goa_A | 387 | 3-ketoacyl-COA thiolase; metabolism, fatty acid, p | 99.94 | |
| 4dd5_A | 396 | Acetyl-COA acetyltransferase; structural genomics, | 99.94 | |
| 3ss6_A | 394 | Acetyl-COA acetyltransferase; structural genomics, | 99.94 | |
| 1afw_A | 393 | 3-ketoacetyl-COA thiolase; fatty acid metabolism; | 99.93 | |
| 3svk_A | 407 | Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, | 99.93 | |
| 1ulq_A | 401 | Putative acetyl-COA acetyltransferase; structural | 99.92 | |
| 1wl4_A | 397 | Acetyl-coenzyme A acetyltransferase 2; thiolase fo | 99.92 | |
| 2vu1_A | 392 | Acetyl-COA acetyltransferase; acyltransferase, PHB | 99.92 | |
| 2wu9_A | 442 | 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o | 99.92 | |
| 2ib8_A | 395 | Acetyl-COA acetyltransferase; thiolase fold, potas | 99.91 | |
| 1wdk_C | 390 | 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame | 99.91 | |
| 2iik_A | 418 | 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m | 99.91 | |
| 4egv_A | 520 | Acetyl-COA acetyltransferase; NEW SUB-family, thio | 99.86 | |
| 4dfe_A | 333 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci | 99.81 | |
| 3il3_A | 323 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, | 99.8 | |
| 4efi_A | 354 | 3-oxoacyl-(acyl-carrier protein) synthase; structu | 99.79 | |
| 3gwa_A | 365 | 3-oxoacyl-(acyl-carrier-protein) synthase III; str | 99.78 | |
| 1zow_A | 313 | 3-oxoacyl-[acyl-carrier-protein] synthase III; FAB | 99.78 | |
| 3h78_A | 359 | PQS biosynthetic enzyme; PQSD, anthranilic acid, a | 99.77 | |
| 3s21_A | 345 | 3-oxoacyl-[ACP] synthase III; non-decarboxylative | 99.77 | |
| 3il6_A | 321 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, | 99.76 | |
| 1u6e_A | 335 | 3-oxoacyl-[acyl-carrier-protein] synthase III; tra | 99.75 | |
| 4ewp_A | 350 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; trans | 99.74 | |
| 1hnj_A | 317 | Beta-ketoacyl-acyl carrier protein synthase III; F | 99.73 | |
| 3s3l_A | 357 | CERJ; acyltransferase, FABH homologue, KS III homo | 99.72 | |
| 1mzj_A | 339 | Beta-ketoacylsynthase III; beta-ketosynthase, arom | 99.72 | |
| 3v7i_A | 413 | Putative polyketide synthase; type III polyketide | 99.71 | |
| 2ebd_A | 309 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, | 99.71 | |
| 1ub7_A | 322 | 3-oxoacyl-[acyl-carrier protein] synthase; fatty a | 99.71 | |
| 3led_A | 392 | 3-oxoacyl-acyl carrier protein synthase III; struc | 99.7 | |
| 3awk_A | 402 | Chalcone synthase-like polyketide synthase; type I | 99.68 | |
| 1i88_A | 389 | CHS2, chalcone synthase 2; polyketide synthase, tr | 99.68 | |
| 2h84_A | 374 | Steely1; thiolase-fold, type III polyketide syntha | 99.68 | |
| 2p0u_A | 413 | Stilbenecarboxylate synthase 2; polyketide synthas | 99.67 | |
| 3a5r_A | 387 | Benzalacetone synthase; chalcone synthase, type II | 99.67 | |
| 3ov2_A | 393 | Curcumin synthase; type III polyketide synthase, t | 99.66 | |
| 2d3m_A | 406 | Pentaketide chromone synthase; chalcone synthase, | 99.66 | |
| 3oit_A | 387 | OS07G0271500 protein; type III polyketide synthase | 99.66 | |
| 1xes_A | 413 | Dihydropinosylvin synthase; native structure, tran | 99.65 | |
| 1ted_A | 393 | PKS18; thiolase fold, substrate binding tunnel, tr | 99.65 | |
| 1ee0_A | 402 | 2-pyrone synthase; polyketide synthase, thiolase f | 99.65 | |
| 1u0m_A | 382 | Putative polyketide synthase; type III polyketide | 99.64 | |
| 3lma_A | 347 | Stage V sporulation protein AD (spovad); NESG, str | 99.64 | |
| 1e5m_A | 416 | KAS II, beta ketoacyl acyl carrier protein synthas | 99.63 | |
| 2f82_A | 450 | HMG-COA synthase; HMGS1, transferase; 2.10A {Brass | 99.62 | |
| 2x3e_A | 331 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, | 99.61 | |
| 3mqd_A | 428 | Beta-ketoacyl synthase; ssgcid, ALS collaborative | 99.61 | |
| 3euo_A | 379 | Type III pentaketide synthase; alpha helix, acyltr | 99.61 | |
| 4ewg_A | 412 | Beta-ketoacyl synthase; ssgcid, structural genomic | 99.59 | |
| 2v4w_A | 460 | Hydroxymethylglutaryl-COA synthase, mitochondrial; | 99.59 | |
| 3v4n_A | 388 | HMG-COA synthase; hydroxymethylglutaryl-COA syntha | 99.57 | |
| 3e1h_A | 465 | PKSIIINC, putative uncharacterized protein; resorc | 99.57 | |
| 3o04_A | 413 | LMO2201 protein, beta-keto-acyl carrier protein sy | 99.54 | |
| 3sqz_A | 425 | Putative hydroxymethylglutaryl-COA synthase; thiol | 99.53 | |
| 1ox0_A | 430 | Beta ketoacyl-acyl carrier protein synthase; trans | 99.52 | |
| 1xpm_A | 396 | 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA s | 99.52 | |
| 2p8u_A | 478 | Hydroxymethylglutaryl-COA synthase, cytoplasmic; h | 99.48 | |
| 3ho9_A | 427 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, | 99.48 | |
| 3tsy_A | 979 | Fusion protein 4-coumarate--COA ligase 1, resvera | 99.46 | |
| 2wya_A | 460 | Hydroxymethylglutaryl-COA synthase, mitochondrial; | 99.43 | |
| 2gqd_A | 437 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; dupli | 99.39 | |
| 2vba_A | 406 | 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytop | 99.39 | |
| 1tqy_B | 415 | Actinorhodin polyketide putative beta-ketoacyl SY; | 99.38 | |
| 1j3n_A | 408 | 3-oxoacyl-(acyl-carrier protein) synthase II; cond | 99.35 | |
| 2ix4_A | 431 | 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ke | 99.34 | |
| 2iwz_A | 438 | 3-oxoacyl-[acyl-carrier-protein] synthase; mitocho | 99.34 | |
| 4ddo_A | 451 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgci | 99.33 | |
| 3kzu_A | 428 | 3-oxoacyl-(acyl-carrier-protein) synthase II; seat | 99.33 | |
| 1tqy_A | 424 | Beta-ketoacyl synthase/acyl transferase; alpha-bet | 99.32 | |
| 3hhd_A | 965 | Fatty acid synthase; transferase, multienzyme, meg | 99.28 | |
| 2qo3_A | 915 | Eryaii erythromycin polyketide synthase modules 3; | 99.23 | |
| 2hg4_A | 917 | DEBS, 6-deoxyerythronolide B synthase; ketosynthas | 99.23 | |
| 2wge_A | 416 | 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta | 99.2 | |
| 2gp6_A | 434 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiol | 99.18 | |
| 3zen_D | 3089 | Fatty acid synthase; transferase, mycolic acid bio | 98.93 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 98.63 | |
| 2pff_A | 1688 | Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl | 98.62 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 98.59 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 98.38 | |
| 1zow_A | 313 | 3-oxoacyl-[acyl-carrier-protein] synthase III; FAB | 88.75 | |
| 1u6e_A | 335 | 3-oxoacyl-[acyl-carrier-protein] synthase III; tra | 87.42 | |
| 1hnj_A | 317 | Beta-ketoacyl-acyl carrier protein synthase III; F | 86.51 | |
| 2ebd_A | 309 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, | 86.33 | |
| 2x3e_A | 331 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, | 85.68 | |
| 3gwa_A | 365 | 3-oxoacyl-(acyl-carrier-protein) synthase III; str | 85.63 | |
| 2gel_A | 231 | Putative GRAM negative resuscitation promoting FA; | 85.44 | |
| 1mzj_A | 339 | Beta-ketoacylsynthase III; beta-ketosynthase, arom | 85.44 | |
| 3s21_A | 345 | 3-oxoacyl-[ACP] synthase III; non-decarboxylative | 85.0 | |
| 4dfe_A | 333 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci | 84.69 | |
| 3h78_A | 359 | PQS biosynthetic enzyme; PQSD, anthranilic acid, a | 84.11 | |
| 3lma_A | 347 | Stage V sporulation protein AD (spovad); NESG, str | 83.66 | |
| 3il3_A | 323 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, | 83.1 | |
| 1ub7_A | 322 | 3-oxoacyl-[acyl-carrier protein] synthase; fatty a | 82.24 | |
| 4e1l_A | 395 | Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, | 82.17 | |
| 4ewp_A | 350 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; trans | 82.16 | |
| 3r6m_A | 213 | YEAZ, resuscitation promoting factor; actin/HSP70 | 82.06 | |
| 1xho_A | 148 | Chorismate mutase; southeast collaboratory for str | 80.51 | |
| 1ted_A | 393 | PKS18; thiolase fold, substrate binding tunnel, tr | 80.13 |
| >4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} | Back alignment and structure |
|---|
Probab=99.94 E-value=1.5e-26 Score=198.15 Aligned_cols=121 Identities=46% Similarity=0.642 Sum_probs=116.0
Q ss_pred CCCceEEEeeeeccccccCccCCCCCHHHHHHHHHHHHHHHcCCCccccCceEEEeeecCCCCCChHHHHHHHcCCCCCC
Q psy4156 36 SDNDVVIVSAARTPIGSFLGSLSELKAHDLGSTAIKEVLKRANVLPNEISEVILGQALTAGQGQNPARQASIKANIPNEV 115 (160)
Q Consensus 36 ~m~~V~Ivg~~rTpfg~~~g~~~~~~~~dL~~~A~~~aL~~agI~~~~ID~vi~G~~~~~~~g~~~ar~~al~~GLp~~v 115 (160)
+|++|||+|++||||+++++.++++++.||+.+|++++|+++|++|++||.+++|++.+.+.++++++.++..+|+|..+
T Consensus 3 ~m~~v~Ivg~~rT~~g~~~~~~~~~~~~~L~~~a~~~Al~~agi~~~~Id~v~~g~~~~~~~~~~~a~~~~~~lGl~~~~ 82 (395)
T 4e1l_A 3 AMKDVVIVSAVRTPIGSFGGVFKNTSAVQLGTIAVKEAISRVGLNLSEIDEVIIGNVLQTGLGQNVARQIAINAGIPNSV 82 (395)
T ss_dssp CCCCEEEEEEEECCCEETTSTTTTSCHHHHHHHHHHHHHHHTTCCGGGCCEEEEECCCCSSTTCCHHHHHHHHTTCCTTS
T ss_pred CCCeEEEEECccCCccccCCCcCCCCHHHHHHHHHHHHHHHcCCCHHHCCEEEEEeccCCCCcchHHHHHHHHcCCCCCc
Confidence 37899999999999999999999999999999999999999999999999999999988777789999999999998789
Q ss_pred ceEEEcccCccHHHHHHHHHHHHHcCCCcEEEEEeeccccc
Q psy4156 116 PASLVNMLCGSGLKSVTLTSRQQVLLTLHWLGNGAQYHITA 156 (160)
Q Consensus 116 Pa~~V~~aCaSGl~Al~~Aa~~I~sG~~~vlivgG~E~mt~ 156 (160)
|+++|+++|+|+++|++.|++.|++|..++++++|+|+||.
T Consensus 83 p~~~v~~~Css~~~al~~A~~~I~~G~~~~vlv~g~e~~s~ 123 (395)
T 4e1l_A 83 PSYTVNKLCGSGLKSVQLAAQSITSGENDVVIAGGTENMSQ 123 (395)
T ss_dssp CEEEECCGGGHHHHHHHHHHHHHHTTSCSEEEEEEEEETTT
T ss_pred eEEEccccchHHHHHHHHHHHHHhCCCCCEEEEEEEecccC
Confidence 99999999999999999999999999999999999999986
|
| >3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} | Back alignment and structure |
|---|
| >3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A | Back alignment and structure |
|---|
| >3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A | Back alignment and structure |
|---|
| >2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... | Back alignment and structure |
|---|
| >2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A | Back alignment and structure |
|---|
| >2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* | Back alignment and structure |
|---|
| >1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* | Back alignment and structure |
|---|
| >2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} | Back alignment and structure |
|---|
| >4egv_A Acetyl-COA acetyltransferase; NEW SUB-family, thiolase fold; 2.71A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >4efi_A 3-oxoacyl-(acyl-carrier protein) synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.35A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3gwa_A 3-oxoacyl-(acyl-carrier-protein) synthase III; structural genomics, synthetase; 1.60A {Burkholderia pseudomallei} PDB: 3gwe_A | Back alignment and structure |
|---|
| >1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A | Back alignment and structure |
|---|
| >3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A* | Back alignment and structure |
|---|
| >3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A | Back alignment and structure |
|---|
| >3il6_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; HET: B83; 2.50A {Enterococcus faecalis} PDB: 3il5_A* 3il4_A* | Back alignment and structure |
|---|
| >1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A | Back alignment and structure |
|---|
| >4ewp_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; transferase; 2.20A {Micrococcus luteus nctc 2665} | Back alignment and structure |
|---|
| >1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A* | Back alignment and structure |
|---|
| >3s3l_A CERJ; acyltransferase, FABH homologue, KS III homologue, dimethyl transfer, transferase; 2.00A {Streptomyces tendae} PDB: 3t5y_A* 3t6s_A* 3t8e_A 3t5y_B* | Back alignment and structure |
|---|
| >1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2 | Back alignment and structure |
|---|
| >3v7i_A Putative polyketide synthase; type III polyketide synthase, acyltransferase, transferase,; 2.90A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1ub7_A 3-oxoacyl-[acyl-carrier protein] synthase; fatty acid synthesis, beta-ketoacyl-ACP synthase III, FABH; 2.30A {Thermus thermophilus} SCOP: c.95.1.2 c.95.1.2 | Back alignment and structure |
|---|
| >3led_A 3-oxoacyl-acyl carrier protein synthase III; structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.45A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2h84_A Steely1; thiolase-fold, type III polyketide synthase, PKS, chalcone-S synthase superfamily, type I PKS; HET: P6G; 2.90A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >3a5r_A Benzalacetone synthase; chalcone synthase, type III polyketide synthase, transferase, acyltransferase; HET: HC4; 1.60A {Rheum palmatum} PDB: 3a5q_A* 3a5s_A | Back alignment and structure |
|---|
| >3ov2_A Curcumin synthase; type III polyketide synthase, transferase; 2.32A {Curcuma longa} PDB: 3ov3_A | Back alignment and structure |
|---|
| >3oit_A OS07G0271500 protein; type III polyketide synthases, transferase; 2.00A {Oryza sativa} PDB: 3ale_A | Back alignment and structure |
|---|
| >1xes_A Dihydropinosylvin synthase; native structure, transferase; HET: 3IO; 1.70A {Pinus sylvestris} PDB: 1xet_A* 1u0u_A | Back alignment and structure |
|---|
| >1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A | Back alignment and structure |
|---|
| >1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2 | Back alignment and structure |
|---|
| >3lma_A Stage V sporulation protein AD (spovad); NESG, structural genomics, PSI-2, protein structure initiative; 1.99A {Bacillus licheniformis} PDB: 3lm6_A | Back alignment and structure |
|---|
| >1e5m_A KAS II, beta ketoacyl acyl carrier protein synthase II; condensing enzyme, biosynthetic role, carbon-carbon bond formation; 1.54A {Synechocystis SP} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >2f82_A HMG-COA synthase; HMGS1, transferase; 2.10A {Brassica juncea} PDB: 2f9a_A* 2fa0_A* 2fa3_A* | Back alignment and structure |
|---|
| >2x3e_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, transferase, acyltransferase, lipid synthesis, multifun enzyme; 1.81A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3mqd_A Beta-ketoacyl synthase; ssgcid, ALS collaborative crystallography, beta-ketoacyl SYN brucella melitensis, fragments of LIFE; HET: 3MQ; 1.25A {Brucella melitensis biovar abortus} PDB: 3lrf_A* 3u0e_A* 3u0f_A* | Back alignment and structure |
|---|
| >4ewg_A Beta-ketoacyl synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, transferase; 2.25A {Burkholderia phymatum} | Back alignment and structure |
|---|
| >3v4n_A HMG-COA synthase; hydroxymethylglutaryl-COA synthase, nitrosylation, transfera inhibitor complex; HET: BTB; 1.60A {Enterococcus faecalis} PDB: 3v4x_A* 1x9e_A 1ysl_B* 1ysl_A* 2hdb_A* | Back alignment and structure |
|---|
| >3e1h_A PKSIIINC, putative uncharacterized protein; resorcinolic lipid synthase, type III PKS, acyltransferase, transferase; 2.58A {Neurospora crassa} | Back alignment and structure |
|---|
| >3o04_A LMO2201 protein, beta-keto-acyl carrier protein synthase II; csgid, structural genomics; 1.85A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1ox0_A Beta ketoacyl-acyl carrier protein synthase; transferase; 1.30A {Streptococcus pneumoniae} SCOP: c.95.1.1 c.95.1.1 PDB: 1oxh_A 2alm_A 2rjt_A | Back alignment and structure |
|---|
| >1xpm_A 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA synthase, HMGS, coenzyme A, thiolase fold, condensing enzyme; HET: HMG CAA; 1.60A {Staphylococcus aureus subsp} SCOP: c.95.1.2 c.95.1.2 PDB: 1xpl_A* 1xpk_A* 1tvz_A 1txt_A* | Back alignment and structure |
|---|
| >2p8u_A Hydroxymethylglutaryl-COA synthase, cytoplasmic; hydromethylglutaryl COA, mevalonate pathway, structural GENO structural genomics consortium, SGC; HET: COA; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ho9_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, platensimycin, platencin A1, KAS2, acyltransferase, fatty acid biosynthesis; HET: N3A; 1.90A {Escherichia coli} PDB: 3hnz_A* 3ho2_A* 3i8p_A* 3g11_A* 2gfx_A* 3g0y_A* 2gfv_A* 2gfw_A 2gfy_A* 1kas_A 1b3n_A | Back alignment and structure |
|---|
| >3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} | Back alignment and structure |
|---|
| >2wya_A Hydroxymethylglutaryl-COA synthase, mitochondrial; steroid biosynthesis, cholesterol biosynthesis, mitochondrion, phosphoprotein; HET: HMG; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2gqd_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; duplicated babababb fold, transferase; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2vba_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytoplasm, antibiotic, transferase, amino-thiazole, acyltransferase, lipid synthesis; HET: P4T; 1.36A {Escherichia coli} SCOP: c.95.1.1 c.95.1.1 PDB: 1fj4_A* 1g5x_A 2aq7_A* 1fj8_A* 2aqb_A 2bui_A 2buh_A 2vb7_A* 2vb8_A 2vb9_A* 1h4f_A 1dd8_A 2cdh_A 2bz4_A 2byz_A 2bz3_A* 2byy_A* 1f91_A* 2cf2_A 2byw_A ... | Back alignment and structure |
|---|
| >1tqy_B Actinorhodin polyketide putative beta-ketoacyl SY; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >1j3n_A 3-oxoacyl-(acyl-carrier protein) synthase II; condensing enzymes, fatty acid elongation, acyl-carrier protein (ACP); HET: CIT; 2.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >2ix4_A 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ketoacyl-(acyl carrier protein) synthase, lipid metabol condensing enzyme; 1.95A {Arabidopsis thaliana} SCOP: c.95.1.1 c.95.1.1 PDB: 1w0i_A | Back alignment and structure |
|---|
| >2iwz_A 3-oxoacyl-[acyl-carrier-protein] synthase; mitochondria, mitochondrion, lipid synthesis, fatty acid SYN fatty acid biosynthesis; 1.65A {Homo sapiens} PDB: 2iwy_A 2c9h_A | Back alignment and structure |
|---|
| >4ddo_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgcid, struct genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia vietnamiensis} PDB: 4f32_A* | Back alignment and structure |
|---|
| >3kzu_A 3-oxoacyl-(acyl-carrier-protein) synthase II; seattle structural genomics center for infectious disease, ssgcid, acyltransferase; 1.75A {Brucella melitensis} PDB: 3e60_A | Back alignment and structure |
|---|
| >1tqy_A Beta-ketoacyl synthase/acyl transferase; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A | Back alignment and structure |
|---|
| >2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea} | Back alignment and structure |
|---|
| >2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5, transferase; 2.73A {Saccharopolyspora erythraea} | Back alignment and structure |
|---|
| >2wge_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta ketoacyl synthase I thiolactomycin, cytoplasm, transferase, acyltransferase; HET: TLM; 1.80A {Mycobacterium tuberculosis} PDB: 2wgd_A* 2wgg_A* 2wgf_A* | Back alignment and structure |
|---|
| >2gp6_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiolase fold, structural genomics, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* | Back alignment and structure |
|---|
| >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
| >1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A | Back alignment and structure |
|---|
| >1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A | Back alignment and structure |
|---|
| >1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A* | Back alignment and structure |
|---|
| >2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2x3e_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, transferase, acyltransferase, lipid synthesis, multifun enzyme; 1.81A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3gwa_A 3-oxoacyl-(acyl-carrier-protein) synthase III; structural genomics, synthetase; 1.60A {Burkholderia pseudomallei} PDB: 3gwe_A | Back alignment and structure |
|---|
| >2gel_A Putative GRAM negative resuscitation promoting FA; YEAZ, RPF, actin-like-fold, glycoprotease, chaperone; 2.05A {Salmonella typhimurium} PDB: 2gem_A 1okj_A | Back alignment and structure |
|---|
| >1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2 | Back alignment and structure |
|---|
| >3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A | Back alignment and structure |
|---|
| >4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A* | Back alignment and structure |
|---|
| >3lma_A Stage V sporulation protein AD (spovad); NESG, structural genomics, PSI-2, protein structure initiative; 1.99A {Bacillus licheniformis} PDB: 3lm6_A | Back alignment and structure |
|---|
| >3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >1ub7_A 3-oxoacyl-[acyl-carrier protein] synthase; fatty acid synthesis, beta-ketoacyl-ACP synthase III, FABH; 2.30A {Thermus thermophilus} SCOP: c.95.1.2 c.95.1.2 | Back alignment and structure |
|---|
| >4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} | Back alignment and structure |
|---|
| >4ewp_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; transferase; 2.20A {Micrococcus luteus nctc 2665} | Back alignment and structure |
|---|
| >3r6m_A YEAZ, resuscitation promoting factor; actin/HSP70 nucleotide-binding fold, bacterial resuscitation BUT non-culturable state, Y YJEE; 3.10A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1xho_A Chorismate mutase; southeast collaboratory for structural genomics, secsg, protein structure initiative, PSI, structural genomics; 2.20A {Clostridium thermocellum} SCOP: d.79.1.2 | Back alignment and structure |
|---|
| >1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 160 | ||||
| d1m3ka1 | 268 | c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea | 2e-31 | |
| d1ulqa1 | 273 | c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {T | 2e-29 | |
| d1afwa1 | 269 | c.95.1.1 (A:25-293) Thiolase {Baker's yeast (Sacch | 1e-20 | |
| d1wdkc1 | 262 | c.95.1.1 (C:2-263) Fatty oxidation complex beta su | 8e-20 |
| >d1m3ka1 c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Length = 268 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thiolase-like superfamily: Thiolase-like family: Thiolase-related domain: Biosynthetic thiolase species: Zoogloea ramigera [TaxId: 350]
Score = 111 bits (279), Expect = 2e-31
Identities = 57/125 (45%), Positives = 77/125 (61%)
Query: 36 SDNDVVIVSAARTPIGSFLGSLSELKAHDLGSTAIKEVLKRANVLPNEISEVILGQALTA 95
S +VI SAART +GSF G+ + AH+LG+T I VL+RA V E++EVILGQ L A
Sbjct: 1 STPSIVIASAARTAVGSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPA 60
Query: 96 GQGQNPARQASIKANIPNEVPASLVNMLCGSGLKSVTLTSRQQVLLTLHWLGNGAQYHIT 155
G+GQNPARQA++KA +P E A +N L GSGL++V L +Q + G ++
Sbjct: 61 GEGQNPARQAAMKAGVPQEATAWGMNQLAGSGLRAVALGMQQIATGDASIIVAGGMESMS 120
Query: 156 ADAHG 160
H
Sbjct: 121 MAPHC 125
|
| >d1ulqa1 c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} Length = 273 | Back information, alignment and structure |
|---|
| >d1afwa1 c.95.1.1 (A:25-293) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 269 | Back information, alignment and structure |
|---|
| >d1wdkc1 c.95.1.1 (C:2-263) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} Length = 262 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 160 | |||
| d1afwa1 | 269 | Thiolase {Baker's yeast (Saccharomyces cerevisiae) | 100.0 | |
| d1m3ka1 | 268 | Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 | 100.0 | |
| d1wdkc1 | 262 | Fatty oxidation complex beta subunit (3-ketoacyl-C | 100.0 | |
| d1ulqa1 | 273 | Beta-ketoadipyl CoA thiolase {Thermus thermophilus | 100.0 | |
| d1hnja1 | 174 | Ketoacyl-ACP synthase III (FabH) {Escherichia coli | 99.72 | |
| d1u6ea1 | 184 | Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu | 99.7 | |
| d1mzja1 | 181 | Priming beta-ketosynthase from the r1128 polyketid | 99.69 | |
| d1ub7a1 | 172 | Ketoacyl-ACP synthase III (FabH) {Thermus thermoph | 99.67 | |
| d1u0ma1 | 200 | Putative polyketide synthase SCO1206 {Streptomyces | 99.56 | |
| d1teda_ | 372 | Polyketide synthase PKS18 {Mycobacterium tuberculo | 99.48 | |
| d1xpma1 | 166 | 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Stap | 99.43 | |
| d1bi5a1 | 235 | Chalcone synthase {Alfalfa (Medicago sativa) [TaxI | 99.39 | |
| d1ox0a1 | 256 | Beta-ketoacyl-ACP synthase II {Streptococcus pneum | 99.1 | |
| d1tqya1 | 216 | Actinorhodin polyketide putative beta-ketoacyl syn | 98.98 | |
| d1tqyb1 | 208 | Actinorhodin polyketide putative beta-ketoacyl syn | 98.84 | |
| d1j3na1 | 249 | Beta-ketoacyl-ACP synthase II {Thermus thermophilu | 98.8 | |
| d2gfva1 | 250 | Beta-ketoacyl-ACP synthase II {Escherichia coli [T | 98.79 | |
| d1e5ma1 | 250 | Beta-ketoacyl-ACP synthase II {Synechocystis sp. [ | 98.69 | |
| d2ix4a1 | 270 | Beta-ketoacyl-ACP synthase II {Thale cress (Arabid | 98.15 | |
| d2vbaa1 | 253 | Beta-ketoacyl-ACP synthase I {Escherichia coli [Ta | 98.12 | |
| d1u6ea2 | 148 | Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu | 94.65 | |
| d1ub7a2 | 149 | Ketoacyl-ACP synthase III (FabH) {Thermus thermoph | 94.59 | |
| d1hnja2 | 143 | Ketoacyl-ACP synthase III (FabH) {Escherichia coli | 92.51 | |
| d1mzja2 | 153 | Priming beta-ketosynthase from the r1128 polyketid | 92.03 | |
| d1okja1 | 106 | Hypothetical protein YeaZ {Escherichia coli [TaxId | 88.17 | |
| d1xhoa_ | 112 | Chorismate mutase {Clostridium thermocellum [TaxId | 87.91 | |
| d2a6aa1 | 103 | Hypothetical protein TM0874 {Thermotoga maritima [ | 86.03 |
| >d1afwa1 c.95.1.1 (A:25-293) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thiolase-like superfamily: Thiolase-like family: Thiolase-related domain: Thiolase species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00 E-value=3.9e-35 Score=240.30 Aligned_cols=128 Identities=27% Similarity=0.346 Sum_probs=121.9
Q ss_pred ccccccCCCceEEEeeeeccccc-cCccCCCCCHHHHHHHHHHHHHHHc----CCCccccCceEEEeeecCCCCCChHHH
Q psy4156 30 RSTMVLSDNDVVIVSAARTPIGS-FLGSLSELKAHDLGSTAIKEVLKRA----NVLPNEISEVILGQALTAGQGQNPARQ 104 (160)
Q Consensus 30 ~~~~~~~m~~V~Ivg~~rTpfg~-~~g~~~~~~~~dL~~~A~~~aL~~a----gI~~~~ID~vi~G~~~~~~~g~~~ar~ 104 (160)
||+|+++++||||+++.|||||| ++|.|++++++||+..+++++++|+ +++|++||.+++||+.+.+++++++|+
T Consensus 2 ~~~~~~~~~dvvIv~a~RTP~gr~~~G~l~~~~~~~L~~~~i~~~l~r~~~~~~idp~~Id~vi~G~v~~~g~~~~~aR~ 81 (269)
T d1afwa1 2 NSLLEKRPEDVVIVAANRSAIGKGFKGAFKDVNTDYLLYNFLNEFIGRFPEPLRADLNLIEEVACGNVLNVGAGATEHRA 81 (269)
T ss_dssp TTTTSCCTTCEEEEEEEECCCEETTTSTTTTCCHHHHHHHHHHHHHHTSCHHHHTCGGGCCCEEEECSSSBGGGHHHHHH
T ss_pred chhhhCCCCCEEEEcceeCcceeCCCCCCCCCCHHHHHHHHHHHHHHhCCccccCChhhcCEEEeccccccccccccchh
Confidence 68899999999999999999998 6899999999999999999999875 699999999999999987777889999
Q ss_pred HHHHcCCCCCCceEEEcccCccHHHHHHHHHHHHHcCCCcEEEEEeecccccC
Q psy4156 105 ASIKANIPNEVPASLVNMLCGSGLKSVTLTSRQQVLLTLHWLGNGAQYHITAD 157 (160)
Q Consensus 105 ~al~~GLp~~vPa~~V~~aCaSGl~Al~~Aa~~I~sG~~~vlivgG~E~mt~~ 157 (160)
+++.+|+|.++|+++||++|+||++|+.+|++.|++|.++++|+||+|+||..
T Consensus 82 ~al~aglp~~vpa~tVnr~CaSg~~Ai~~Aa~~I~~G~~divlagG~EsmS~~ 134 (269)
T d1afwa1 82 ACLASGIPYSTPFVALNRQCSSGLTAVNDIANKIKVGQIDIGLALGVESMTNN 134 (269)
T ss_dssp HHHHTTCCTTSCEEEEECGGGHHHHHHHHHHHHHHTTSCSEEEEEEEEEHHHH
T ss_pred hhhhccccccccchhccccchHHHHHHHHHHHHHhhccccceeeeeccccccc
Confidence 99999999999999999999999999999999999999999999999999963
|
| >d1m3ka1 c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} | Back information, alignment and structure |
|---|
| >d1wdkc1 c.95.1.1 (C:2-263) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1ulqa1 c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hnja1 c.95.1.2 (A:1-174) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mzja1 c.95.1.2 (A:3-183) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} | Back information, alignment and structure |
|---|
| >d1ub7a1 c.95.1.2 (A:2-173) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1u0ma1 c.95.1.2 (A:2-201) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xpma1 c.95.1.2 (A:2-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1bi5a1 c.95.1.2 (A:1-235) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1tqya1 c.95.1.1 (A:3-218) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1tqyb1 c.95.1.1 (B:2-209) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1j3na1 c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2gfva1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e5ma1 c.95.1.1 (A:6-255) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} | Back information, alignment and structure |
|---|
| >d2ix4a1 c.95.1.1 (A:31-300) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2vbaa1 c.95.1.1 (A:1-253) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u6ea2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ub7a2 c.95.1.2 (A:174-322) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hnja2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mzja2 c.95.1.2 (A:184-336) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} | Back information, alignment and structure |
|---|
| >d1okja1 c.55.1.9 (A:1-106) Hypothetical protein YeaZ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xhoa_ d.79.1.2 (A:) Chorismate mutase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d2a6aa1 c.55.1.9 (A:1-103) Hypothetical protein TM0874 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|