Psyllid ID: psy4205

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-----
MSYSSQEGQEKQLDRIEEGMDQINADMKEAEKNLTGMEKCCGICVLPCNKSASFKEDEGTWKGNDDGKVVNNQPQRVMDDRNGLGPQAGYIGKITNDARENEMEENMGQVNTMIGNLRNMAIDMGSELENQNRQIDRINRKVKSASFKEDEGTWKGNDDGKVVNNQPQRVMDDRNEVVTYYNFRFLLTLSHPFVPRSASFKEDEGTWKGNDDGKVVNNQPQRVMDDRNGLGPQAGYIGKITNDARENEMEENMGQVNTMIGNLRNMAIDMGSELENQNRQIDRINRKVKFRYRCRYVRKISDICLMNRELKLYRI
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHcccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEcccccccccccccHHccccccccEEcccccEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEcccccEEEEHHHEEEEEccccccccccccccccccccccccccEcccccccEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHEEccEEEEEEc
msyssqegqEKQLDRIEEGMDQINADMKEAEKNLtgmekccgicvlpcnksasfkedegtwkgnddgkvvnnqpqrvmddrnglgpqagyigkiTNDARENEMEENMGQVNTMIGNLRNMAIDMGSELENQNRQIDRINRkvksasfkedegtwkgnddgkvvnnqpqrvmddrneVVTYYNFRFLLtlshpfvprsasfkedegtwkgnddgkvvnnqpqrvmddrnglgpqagyigkiTNDARENEMEENMGQVNTMIGNLRNMAIDMGSELENQNRQIDRINRKVKFRYRCRYVRKISDICLMNRELKLYRI
msyssqegqeKQLDRIEEGMDQINADMKEAEKNLTGMEKCCGICVLPCNKSASFKedegtwkgnddgkvvnnqpqrvmddrnglgpqagyIGKITNDARENEMEENMGQVNTMIGNLRNMAIDMGSELenqnrqidrinrkvksasfkedegtwkgnddgkvvnnqpqrvmddrNEVVTYYNFRFLLTLSHPFVPRSASFkedegtwkgnddgkvvnnqpqrvmddrnglgpqagyIGKITNDARENEMEENMGQVNTMIGNLRNMAIDMGSelenqnrqidrinrkvkfryrcryvrkisdiclmnrelklyri
MSYSSQEGQEKQLDRIEEGMDQINADMKEAEKNLTGMEKCCGICVLPCNKSASFKEDEGTWKGNDDGKVVNNQPQRVMDDRNGLGPQAGYIGKITNDARENEMEENMGQVNTMIGNLRNMAIDMGSELENQNRQIDRINRKVKSASFKEDEGTWKGNDDGKVVNNQPQRVMDDRNEVVTYYNFRFLLTLSHPFVPRSASFKEDEGTWKGNDDGKVVNNQPQRVMDDRNGLGPQAGYIGKITNDARENEMEENMGQVNTMIGNLRNMAIDMGSELENQNRQIDRINRKVKFRYRCRYVRKISDICLMNRELKLYRI
**********************************TGMEKCCGICVLPCNKS**************************************************************************************************************************RNEVVTYYNFRFLLTLSHPFVP****************************************************************IGNL****************QIDRINRKVKFRYRCRYVRKISDICLMNRELKLY**
MSYSS**GQ**********MDQINADMKEAEKNLTGMEKCCGICVLPCN****************************************************EMEENMGQVNTMIGNLRNMAIDMGSELENQNRQIDRINRKVKSASFKE**********************DDRNEVVTYYNFRFLLTLSHP************************************************************MGQVNTMIGNLRNMAIDMGSELENQNRQIDRINRKVKFRYRCRYVRKISDICLMNRELKLY**
*************DRIEEGMDQINADMKEAEKNLTGMEKCCGICVLPCNKSASFKEDEGTWKGNDDGKVVNNQPQRVMDDRNGLGPQAGYIGKITNDARENEMEENMGQVNTMIGNLRNMAIDMGSELENQNRQIDRINRKVKSASFKEDEGTWKGNDDGKVVNNQPQRVMDDRNEVVTYYNFRFLLTLSHPFVPRSASFKEDEGTWKGNDDGKVVNNQPQRVMDDRNGLGPQAGYIGKITNDARENEMEENMGQVNTMIGNLRNMAIDMGSELENQNRQIDRINRKVKFRYRCRYVRKISDICLMNRELKLYRI
*SYSSQEGQEKQLDRIEEGMDQINADMKEAEKNLTGMEKCCGICVLPCNKSASFKEDEGTWKGNDDGKVVNNQPQRVMDDRN*LGPQ*GYIGKITNDARENEMEENMGQVNTMIGNLRNMAIDMGSELENQNRQIDRINRKVKSASFKEDEGTWKGNDDGKVVNNQPQRVMDDRNEVVTYYNFRFLLTLSHPFVPRSASFKEDEGTW********VNN*PQR************GYIGKITNDARENEMEENMGQVNTMIGNLRNMAIDMGSELENQNRQIDRINRKVKFRYRCRYVRKISDICLMNRELKLYRI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxCGICVLPCNKSASFKEDEGTWKGNDDGKVVNNQPQRVMDDRNGLGPQAGYIGKITNDARENEMEENMGQVNTMIGNLRNMxxxxxxxxxxxxxxxxxxxxxxxxxxxxEDEGTWKGNDDGKVVNNQPQRVMDDRNEVVTYYNFRFLLTLSHPFVPRSASFKEDEGTWKGNDDGKVVNNQPQRVMDDRNGLGPQAGYIGKITNDARENEMEENMGQVNTMIGNLRNMxxxxxxxxxxxxxxxxxxxxxVKFRYRCRYVRKISDICLMNRELKLYRI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query315 2.2.26 [Sep-21-2011]
P36975212 Synaptosomal-associated p yes N/A 0.431 0.641 0.897 9e-67
P60881206 Synaptosomal-associated p yes N/A 0.469 0.718 0.557 4e-39
Q5R1X1206 Synaptosomal-associated p yes N/A 0.469 0.718 0.557 4e-39
P60879206 Synaptosomal-associated p yes N/A 0.469 0.718 0.557 4e-39
P60877206 Synaptosomal-associated p yes N/A 0.469 0.718 0.557 4e-39
P60880206 Synaptosomal-associated p yes N/A 0.469 0.718 0.557 4e-39
P60878206 Synaptosomal-associated p yes N/A 0.469 0.718 0.557 4e-39
Q17QQ3206 Synaptosomal-associated p yes N/A 0.469 0.718 0.557 4e-39
Q5NVG5206 Synaptosomal-associated p yes N/A 0.466 0.713 0.554 3e-38
P36976210 Synaptosomal-associated p N/A N/A 0.409 0.614 0.601 2e-37
>sp|P36975|SNP25_DROME Synaptosomal-associated protein 25 OS=Drosophila melanogaster GN=Snap25 PE=2 SV=1 Back     alignment and function desciption
 Score =  253 bits (647), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 122/136 (89%), Positives = 131/136 (96%)

Query: 9   QEKQLDRIEEGMDQINADMKEAEKNLTGMEKCCGICVLPCNKSASFKEDEGTWKGNDDGK 68
           Q +QLDRIEEGMDQINADM+EAEKNL+GMEKCCGICVLPCNKS SFKED+GTWKGNDDGK
Sbjct: 60  QGEQLDRIEEGMDQINADMREAEKNLSGMEKCCGICVLPCNKSQSFKEDDGTWKGNDDGK 119

Query: 69  VVNNQPQRVMDDRNGLGPQAGYIGKITNDARENEMEENMGQVNTMIGNLRNMAIDMGSEL 128
           VVNNQPQRVMDDRNG+  QAGYIG+ITNDARE+EMEENMGQVNTMIGNLRNMA+DMGSEL
Sbjct: 120 VVNNQPQRVMDDRNGMMAQAGYIGRITNDAREDEMEENMGQVNTMIGNLRNMALDMGSEL 179

Query: 129 ENQNRQIDRINRKVKS 144
           ENQNRQIDRINRK +S
Sbjct: 180 ENQNRQIDRINRKGES 195
May play an important role in the synaptic function of specific neuronal systems. Associates with proteins involved in vesicle docking and membrane fusion.
Drosophila melanogaster (taxid: 7227)
>sp|P60881|SNP25_RAT Synaptosomal-associated protein 25 OS=Rattus norvegicus GN=Snap25 PE=1 SV=1 Back     alignment and function description
>sp|Q5R1X1|SNP25_PANTR Synaptosomal-associated protein 25 OS=Pan troglodytes GN=SNAP25 PE=2 SV=1 Back     alignment and function description
>sp|P60879|SNP25_MOUSE Synaptosomal-associated protein 25 OS=Mus musculus GN=Snap25 PE=1 SV=1 Back     alignment and function description
>sp|P60877|SNP25_MACMU Synaptosomal-associated protein 25 OS=Macaca mulatta GN=SNAP25 PE=2 SV=1 Back     alignment and function description
>sp|P60880|SNP25_HUMAN Synaptosomal-associated protein 25 OS=Homo sapiens GN=SNAP25 PE=1 SV=1 Back     alignment and function description
>sp|P60878|SNP25_CHICK Synaptosomal-associated protein 25 OS=Gallus gallus GN=SNAP25 PE=1 SV=1 Back     alignment and function description
>sp|Q17QQ3|SNP25_BOVIN Synaptosomal-associated protein 25 OS=Bos taurus GN=SNAP25 PE=1 SV=1 Back     alignment and function description
>sp|Q5NVG5|SNP25_PONAB Synaptosomal-associated protein 25 OS=Pongo abelii GN=SNAP25 PE=2 SV=1 Back     alignment and function description
>sp|P36976|SNP25_TORMA Synaptosomal-associated protein 25 OS=Torpedo marmorata GN=snap25 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query315
383863619214 PREDICTED: synaptosomal-associated prote 0.431 0.635 0.933 3e-68
345489459214 PREDICTED: synaptosomal-associated prote 0.431 0.635 0.933 5e-68
347965810213 AGAP001394-PB [Anopheles gambiae str. PE 0.444 0.657 0.9 6e-68
158302121213 AGAP001394-PA [Anopheles gambiae str. PE 0.444 0.657 0.9 7e-68
307192558173 Synaptosomal-associated protein 25 [Harp 0.438 0.797 0.920 9e-68
157106571213 synaptosomal associated protein [Aedes a 0.422 0.624 0.939 1e-67
328788561213 PREDICTED: synaptosomal-associated prote 0.431 0.638 0.926 2e-67
380025695213 PREDICTED: synaptosomal-associated prote 0.431 0.638 0.926 2e-67
340713966214 PREDICTED: synaptosomal-associated prote 0.431 0.635 0.926 3e-67
340713968214 PREDICTED: synaptosomal-associated prote 0.431 0.635 0.926 4e-67
>gi|383863619|ref|XP_003707277.1| PREDICTED: synaptosomal-associated protein 25-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  265 bits (676), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 131/136 (96%)

Query: 9   QEKQLDRIEEGMDQINADMKEAEKNLTGMEKCCGICVLPCNKSASFKEDEGTWKGNDDGK 68
           Q +QLDRIEEGMDQINADM+EAEKNLTGMEKCCG+CVLPCNKSASFKEDEGTWKGNDDGK
Sbjct: 62  QGEQLDRIEEGMDQINADMREAEKNLTGMEKCCGLCVLPCNKSASFKEDEGTWKGNDDGK 121

Query: 69  VVNNQPQRVMDDRNGLGPQAGYIGKITNDARENEMEENMGQVNTMIGNLRNMAIDMGSEL 128
           VVNNQPQRVMDDRNGLGPQ GYI KITNDARE EMEENMGQVNTMIGNLRNMAIDMGSEL
Sbjct: 122 VVNNQPQRVMDDRNGLGPQGGYIAKITNDARETEMEENMGQVNTMIGNLRNMAIDMGSEL 181

Query: 129 ENQNRQIDRINRKVKS 144
           ENQNRQIDRINRK +S
Sbjct: 182 ENQNRQIDRINRKGES 197

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|345489459|ref|XP_001606157.2| PREDICTED: synaptosomal-associated protein 25 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|347965810|ref|XP_003435817.1| AGAP001394-PB [Anopheles gambiae str. PEST] gi|333470342|gb|EGK97596.1| AGAP001394-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|158302121|ref|XP_321742.4| AGAP001394-PA [Anopheles gambiae str. PEST] gi|157012799|gb|EAA01106.5| AGAP001394-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|307192558|gb|EFN75746.1| Synaptosomal-associated protein 25 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|157106571|ref|XP_001649383.1| synaptosomal associated protein [Aedes aegypti] gi|108879802|gb|EAT44027.1| AAEL004559-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|328788561|ref|XP_394588.4| PREDICTED: synaptosomal-associated protein 25-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|380025695|ref|XP_003696604.1| PREDICTED: synaptosomal-associated protein 25-like [Apis florea] Back     alignment and taxonomy information
>gi|340713966|ref|XP_003395504.1| PREDICTED: synaptosomal-associated protein 25-like isoform 1 [Bombus terrestris] gi|350421183|ref|XP_003492762.1| PREDICTED: synaptosomal-associated protein 25-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340713968|ref|XP_003395505.1| PREDICTED: synaptosomal-associated protein 25-like isoform 2 [Bombus terrestris] gi|350421179|ref|XP_003492761.1| PREDICTED: synaptosomal-associated protein 25-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query315
FB|FBgn0011288212 Snap25 "Synapse protein 25" [D 0.438 0.650 0.884 2.9e-64
FB|FBgn0028401212 Snap24 "Synapse protein 24" [D 0.479 0.712 0.636 2.8e-50
WB|WBGene00004364234 ric-4 [Caenorhabditis elegans 0.434 0.585 0.585 2e-40
UNIPROTKB|P60878206 SNAP25 "Synaptosomal-associate 0.450 0.689 0.580 1.1e-39
UNIPROTKB|Q17QQ3206 SNAP25 "Synaptosomal-associate 0.450 0.689 0.580 1.1e-39
UNIPROTKB|E2RPM2206 SNAP25 "Synaptosomal-associate 0.450 0.689 0.580 1.1e-39
UNIPROTKB|P60880206 SNAP25 "Synaptosomal-associate 0.450 0.689 0.580 1.1e-39
UNIPROTKB|I3LAV3206 SNAP25 "Synaptosomal-associate 0.450 0.689 0.580 1.1e-39
UNIPROTKB|P60877206 SNAP25 "Synaptosomal-associate 0.450 0.689 0.580 1.1e-39
UNIPROTKB|Q5R1X1206 SNAP25 "Synaptosomal-associate 0.450 0.689 0.580 1.1e-39
FB|FBgn0011288 Snap25 "Synapse protein 25" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 655 (235.6 bits), Expect = 2.9e-64, P = 2.9e-64
 Identities = 122/138 (88%), Positives = 132/138 (95%)

Query:     7 EGQEKQLDRIEEGMDQINADMKEAEKNLTGMEKCCGICVLPCNKSASFKEDEGTWKGNDD 66
             + Q +QLDRIEEGMDQINADM+EAEKNL+GMEKCCGICVLPCNKS SFKED+GTWKGNDD
Sbjct:    58 DDQGEQLDRIEEGMDQINADMREAEKNLSGMEKCCGICVLPCNKSQSFKEDDGTWKGNDD 117

Query:    67 GKVVNNQPQRVMDDRNGLGPQAGYIGKITNDARENEMEENMGQVNTMIGNLRNMAIDMGS 126
             GKVVNNQPQRVMDDRNG+  QAGYIG+ITNDARE+EMEENMGQVNTMIGNLRNMA+DMGS
Sbjct:   118 GKVVNNQPQRVMDDRNGMMAQAGYIGRITNDAREDEMEENMGQVNTMIGNLRNMALDMGS 177

Query:   127 ELENQNRQIDRINRKVKS 144
             ELENQNRQIDRINRK +S
Sbjct:   178 ELENQNRQIDRINRKGES 195
GO:0005484 "SNAP receptor activity" evidence=ISS;NAS
GO:0005886 "plasma membrane" evidence=IDA;NAS
GO:0016081 "synaptic vesicle docking involved in exocytosis" evidence=NAS
GO:0005483 "soluble NSF attachment protein activity" evidence=NAS
GO:0016192 "vesicle-mediated transport" evidence=NAS
GO:0007269 "neurotransmitter secretion" evidence=NAS
GO:0006893 "Golgi to plasma membrane transport" evidence=ISS
GO:0007268 "synaptic transmission" evidence=NAS
GO:0045202 "synapse" evidence=NAS
GO:0048172 "regulation of short-term neuronal synaptic plasticity" evidence=IDA
GO:0016082 "synaptic vesicle priming" evidence=IDA
GO:0048489 "synaptic vesicle transport" evidence=IDA
FB|FBgn0028401 Snap24 "Synapse protein 24" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00004364 ric-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|P60878 SNAP25 "Synaptosomal-associated protein 25" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q17QQ3 SNAP25 "Synaptosomal-associated protein 25" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RPM2 SNAP25 "Synaptosomal-associated protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P60880 SNAP25 "Synaptosomal-associated protein 25" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LAV3 SNAP25 "Synaptosomal-associated protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P60877 SNAP25 "Synaptosomal-associated protein 25" [Macaca mulatta (taxid:9544)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R1X1 SNAP25 "Synaptosomal-associated protein 25" [Pan troglodytes (taxid:9598)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q17QQ3SNP25_BOVINNo assigned EC number0.55700.46980.7184yesN/A
P36975SNP25_DROMENo assigned EC number0.89700.43170.6415yesN/A
Q5R1X1SNP25_PANTRNo assigned EC number0.55700.46980.7184yesN/A
Q5NVG5SNP25_PONABNo assigned EC number0.55400.46660.7135yesN/A
P60880SNP25_HUMANNo assigned EC number0.55700.46980.7184yesN/A
P60881SNP25_RATNo assigned EC number0.55700.46980.7184yesN/A
P60877SNP25_MACMUNo assigned EC number0.55700.46980.7184yesN/A
P60879SNP25_MOUSENo assigned EC number0.55700.46980.7184yesN/A
P60878SNP25_CHICKNo assigned EC number0.55700.46980.7184yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query315
pfam0083557 pfam00835, SNAP-25, SNAP-25 family 1e-13
pfam0083557 pfam00835, SNAP-25, SNAP-25 family 3e-11
pfam0573962 pfam05739, SNARE, SNARE domain 3e-09
cd0019360 cd00193, t_SNARE, Soluble NSF (N-ethylmaleimide-se 8e-09
smart0039766 smart00397, t_SNARE, Helical region found in SNARE 9e-09
pfam0573962 pfam05739, SNARE, SNARE domain 1e-08
cd0019360 cd00193, t_SNARE, Soluble NSF (N-ethylmaleimide-se 1e-08
smart0039766 smart00397, t_SNARE, Helical region found in SNARE 1e-08
pfam0083557 pfam00835, SNAP-25, SNAP-25 family 2e-05
>gnl|CDD|216143 pfam00835, SNAP-25, SNAP-25 family Back     alignment and domain information 
 Score = 64.1 bits (156), Expect = 1e-13
 Identities = 31/57 (54%), Positives = 38/57 (66%), Gaps = 5/57 (8%)

Query: 47 PCNKSASFK---EDEGTWKGNDDGKVVNNQP-QRVMDDRNGL-GPQAGYIGKITNDA 98
          P NK  +FK   + +  WK NDDGKVV++QP  RV DDR  + GP  GYI +ITNDA
Sbjct: 1  PWNKIKNFKSGTDKKKAWKNNDDGKVVSSQPRSRVEDDREPMSGPSGGYITRITNDA 57

SNAP-25 (synaptosome-associated protein 25 kDa) proteins are components of SNARE complexes. Members of this family contain a cluster of cysteine residues that can be palmitoylated for membrane attachment. Length = 57
>gnl|CDD|216143 pfam00835, SNAP-25, SNAP-25 family Back     alignment and domain information
>gnl|CDD|203323 pfam05739, SNARE, SNARE domain Back     alignment and domain information
>gnl|CDD|238115 cd00193, t_SNARE, Soluble NSF (N-ethylmaleimide-sensitive fusion protein)-Attachment protein (SNAP) REceptor domain; these alpha-helical motifs form twisted and parallel heterotetrameric helix bundles; the core complex contains one helix from a protein that is anchored in the vesicle membrane (synaptobrevin), one helix from a protein of the target membrane (syntaxin), and two helices from another protein anchored in the target membrane (SNAP-25); their interaction forms a core which is composed of a polar zero layer, a flanking leucine-zipper layer acts as a water tight shield to isolate ionic interactions in the zero layer from the surrounding solvent Back     alignment and domain information
>gnl|CDD|197699 smart00397, t_SNARE, Helical region found in SNAREs Back     alignment and domain information
>gnl|CDD|203323 pfam05739, SNARE, SNARE domain Back     alignment and domain information
>gnl|CDD|238115 cd00193, t_SNARE, Soluble NSF (N-ethylmaleimide-sensitive fusion protein)-Attachment protein (SNAP) REceptor domain; these alpha-helical motifs form twisted and parallel heterotetrameric helix bundles; the core complex contains one helix from a protein that is anchored in the vesicle membrane (synaptobrevin), one helix from a protein of the target membrane (syntaxin), and two helices from another protein anchored in the target membrane (SNAP-25); their interaction forms a core which is composed of a polar zero layer, a flanking leucine-zipper layer acts as a water tight shield to isolate ionic interactions in the zero layer from the surrounding solvent Back     alignment and domain information
>gnl|CDD|197699 smart00397, t_SNARE, Helical region found in SNAREs Back     alignment and domain information
>gnl|CDD|216143 pfam00835, SNAP-25, SNAP-25 family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 315
KOG3065|consensus273 100.0
KOG3065|consensus273 99.84
PF0083561 SNAP-25: SNAP-25 family; InterPro: IPR000928 SNAP- 99.39
PF0573963 SNARE: SNARE domain; InterPro: IPR000727 The proce 98.79
cd0019360 t_SNARE Soluble NSF (N-ethylmaleimide-sensitive fu 98.59
smart0039766 t_SNARE Helical region found in SNAREs. All alpha- 98.47
PF0083561 SNAP-25: SNAP-25 family; InterPro: IPR000928 SNAP- 98.4
PF0573963 SNARE: SNARE domain; InterPro: IPR000727 The proce 98.16
cd0019360 t_SNARE Soluble NSF (N-ethylmaleimide-sensitive fu 97.92
KOG3202|consensus235 97.91
smart0039766 t_SNARE Helical region found in SNAREs. All alpha- 97.83
KOG3385|consensus118 97.08
KOG3385|consensus118 96.97
KOG3202|consensus235 96.68
PF1235266 V-SNARE_C: Snare region anchored in the vesicle me 96.54
KOG1666|consensus220 92.57
PF1235266 V-SNARE_C: Snare region anchored in the vesicle me 89.37
PF09753251 Use1: Membrane fusion protein Use1; InterPro: IPR0 85.86
PRK0084677 hypothetical protein; Provisional 80.31
>KOG3065|consensus Back     alignment and domain information 
Probab=100.00  E-value=8.4e-35  Score=274.29  Aligned_cols=156  Identities=32%  Similarity=0.493  Sum_probs=129.7

Q ss_pred             chhhhhhHHHHHHHHHhhHHHHHHHHHHHHHhhccccccccccccCCCCCCCccc---ccccccC---CCCCCccCCCCc
Q psy4205           2 SYSSQEGQEKQLDRIEEGMDQINADMKEAEKNLTGMEKCCGICVLPCNKSASFKE---DEGTWKG---NDDGKVVNNQPQ   75 (315)
Q Consensus         2 ~l~eL~eQGEQL~Rte~~LD~In~DLk~aEK~L~sLks~cGlf~~pw~~~k~~e~---~k~~~~~---~e~~~v~ssqP~   75 (315)
                      +|++|++|||||+|||++||+|+.||+++||||++|++|||+++|||++++.++.   +..+|+.   .....+.+.+|.
T Consensus        98 Tl~~L~~Q~eQL~rte~~lD~i~~d~~~~er~l~~l~~~~g~~~~p~~~~~~~~p~e~~~~~~~~~~~~~~e~~~~~~~~  177 (273)
T KOG3065|consen   98 TLVMLSEQGEQLERTEKNLDDIKVDLKRAERNLTELKGLFGLLVKPFKKKRVREPTETSLKQRSISKRRMDETLIRAKPG  177 (273)
T ss_pred             HHHHHHHhHHHHHhHHhhhhhhHHHHHHHHHHHHHHHHHhcccCCccccCCCCCcchhcccccCcchhhhhHHHHhhhcc
Confidence            6899999999999999999999999999999999999999999999999887665   3344432   222234444443


Q ss_pred             --cccCCCC----CCCCCCCCC-----cccCchHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHhhhhh
Q psy4205          76 --RVMDDRN----GLGPQAGYI-----GKITNDARENEMEENMGQVNTMIGNLRNMAIDMGSELENQNRQIDRINRKVKS  144 (315)
Q Consensus        76 --r~~~~~~----~~~~sg~yi-----krit~d~~e~EmD~NLd~ls~~L~rLK~mA~dMg~EId~QN~~LDrI~~Kvd~  144 (315)
                        +....+.    ..+.+++|+     +.++++++++|||+||++|+.+|++||+||++||+|||+||++||||++|||+
T Consensus       178 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~~~edeiD~NL~qis~~lg~LK~mA~dmg~Eie~Qn~~Ld~I~~k~d~  257 (273)
T KOG3065|consen  178 ELRSAAERSPSEKRTGLQGARSSLKARAYQTEPAAEDEIDENLDQLSAILGRLKNMALDMGSEIESQNERLDRIEDKVDR  257 (273)
T ss_pred             cccccccccccccCcCCcccchhhhhhhhccCChhhhHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHhHHHhHHHHHHHh
Confidence              2211111    124566777     77889999999999999999999999999999999999999999999999999


Q ss_pred             hhhhhhhhcccCC
Q psy4205         145 ASFKEDEGTWKGN  157 (315)
Q Consensus       145 ~d~rI~~aNkr~~  157 (315)
                      ++.+|+.+|+|++
T Consensus       258 ~d~~v~~~n~R~~  270 (273)
T KOG3065|consen  258 LDLRVDKANKRAK  270 (273)
T ss_pred             hhhHHHHHHHHHH
Confidence            9999999999964

>KOG3065|consensus Back     alignment and domain information
>PF00835 SNAP-25: SNAP-25 family; InterPro: IPR000928 SNAP-25 (synaptosome-associated protein 25 kDa) proteins are components of SNARE complexes, which are proposed to account for the specificity of membrane fusion and to directly execute fusion by forming a tight complex (the SNARE or core complex) that brings the synaptic vesicle and plasma membranes together Back     alignment and domain information
>PF05739 SNARE: SNARE domain; InterPro: IPR000727 The process of vesicular fusion with target membranes depends on a set of SNAREs (SNAP-Receptors), which are associated with the fusing membranes [, ] Back     alignment and domain information
>cd00193 t_SNARE Soluble NSF (N-ethylmaleimide-sensitive fusion protein)-Attachment protein (SNAP) REceptor domain; these alpha-helical motifs form twisted and parallel heterotetrameric helix bundles; the core complex contains one helix from a protein that is anchored in the vesicle membrane (synaptobrevin), one helix from a protein of the target membrane (syntaxin), and two helices from another protein anchored in the target membrane (SNAP-25); their interaction forms a core which is composed of a polar zero layer, a flanking leucine-zipper layer acts as a water tight shield to isolate ionic interactions in the zero layer from the surrounding solvent Back     alignment and domain information
>smart00397 t_SNARE Helical region found in SNAREs Back     alignment and domain information
>PF00835 SNAP-25: SNAP-25 family; InterPro: IPR000928 SNAP-25 (synaptosome-associated protein 25 kDa) proteins are components of SNARE complexes, which are proposed to account for the specificity of membrane fusion and to directly execute fusion by forming a tight complex (the SNARE or core complex) that brings the synaptic vesicle and plasma membranes together Back     alignment and domain information
>PF05739 SNARE: SNARE domain; InterPro: IPR000727 The process of vesicular fusion with target membranes depends on a set of SNAREs (SNAP-Receptors), which are associated with the fusing membranes [, ] Back     alignment and domain information
>cd00193 t_SNARE Soluble NSF (N-ethylmaleimide-sensitive fusion protein)-Attachment protein (SNAP) REceptor domain; these alpha-helical motifs form twisted and parallel heterotetrameric helix bundles; the core complex contains one helix from a protein that is anchored in the vesicle membrane (synaptobrevin), one helix from a protein of the target membrane (syntaxin), and two helices from another protein anchored in the target membrane (SNAP-25); their interaction forms a core which is composed of a polar zero layer, a flanking leucine-zipper layer acts as a water tight shield to isolate ionic interactions in the zero layer from the surrounding solvent Back     alignment and domain information
>KOG3202|consensus Back     alignment and domain information
>smart00397 t_SNARE Helical region found in SNAREs Back     alignment and domain information
>KOG3385|consensus Back     alignment and domain information
>KOG3385|consensus Back     alignment and domain information
>KOG3202|consensus Back     alignment and domain information
>PF12352 V-SNARE_C: Snare region anchored in the vesicle membrane C-terminus; PDB: 1GL2_C 2NPS_C Back     alignment and domain information
>KOG1666|consensus Back     alignment and domain information
>PF12352 V-SNARE_C: Snare region anchored in the vesicle membrane C-terminus; PDB: 1GL2_C 2NPS_C Back     alignment and domain information
>PF09753 Use1: Membrane fusion protein Use1; InterPro: IPR019150 This entry represents a family of proteins, approximately 300 residues in length, involved in vesicle transport Back     alignment and domain information
>PRK00846 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query315
1l4a_D87 X-Ray Structure Of The Neuronal ComplexinSNARE COMP 2e-20
1l4a_D87 X-Ray Structure Of The Neuronal ComplexinSNARE COMP 3e-19
1sfc_D87 Neuronal Synaptic Fusion Complex Length = 87 7e-17
1sfc_D87 Neuronal Synaptic Fusion Complex Length = 87 7e-16
3rk2_D65 Truncated Snare Complex Length = 65 2e-11
3rk2_D65 Truncated Snare Complex Length = 65 2e-10
3hd7_D68 Helical Extension Of The Neuronal Snare Complex Int 2e-11
3hd7_D68 Helical Extension Of The Neuronal Snare Complex Int 2e-10
1n7s_D66 High Resolution Structure Of A Truncated Neuronal S 2e-11
1n7s_D66 High Resolution Structure Of A Truncated Neuronal S 3e-10
1kil_D66 Three-Dimensional Structure Of The ComplexinSNARE C 3e-11
1kil_D66 Three-Dimensional Structure Of The ComplexinSNARE C 3e-10
1urq_D69 Crystal Structure Of Neuronal Q-Snares In Complex W 5e-11
1urq_D69 Crystal Structure Of Neuronal Q-Snares In Complex W 5e-10
3zur_A 960 Crystal Structure Of An Engineered Botulinum Neurot 2e-09
3zur_A 960 Crystal Structure Of An Engineered Botulinum Neurot 1e-08
1xtg_B59 Crystal Structure Of Neurotoxin BontA COMPLEXED WIT 1e-08
1xtg_B59 Crystal Structure Of Neurotoxin BontA COMPLEXED WIT 1e-07
3zus_A 927 Crystal Structure Of An Engineered Botulinum Neurot 6e-07
3zus_A 927 Crystal Structure Of An Engineered Botulinum Neurot 6e-07
1l4a_C83 X-Ray Structure Of The Neuronal ComplexinSNARE COMP 1e-06
1jth_A82 Crystal Structure And Biophysical Properties Of A C 2e-05
1urq_C80 Crystal Structure Of Neuronal Q-Snares In Complex W 5e-04
1n7s_C79 High Resolution Structure Of A Truncated Neuronal S 5e-04
3rk2_C81 Truncated Snare Complex Length = 81 6e-04
1kil_C74 Three-Dimensional Structure Of The ComplexinSNARE C 6e-04
1sfc_C83 Neuronal Synaptic Fusion Complex Length = 83 6e-04
>pdb|1L4A|D Chain D, X-Ray Structure Of The Neuronal ComplexinSNARE COMPLEX From The Squid Loligo Pealei Length = 87 Back     alignment and structure 
Iteration: 1

 Score = 96.7 bits (239), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 62/77 (80%)
Query: 80  DRNGLGPQAGYIGKITNDARENEMEENMGQVNTMIGNLRNMAIDMGSELENQNRQIDRIN 139
           D+NG+GP +GY+ +ITNDARE++ME NM +V++MIGNLRNMAIDMG+E+ +QNRQ+DRI 
Sbjct: 5   DQNGMGPSSGYVTRITNDAREDDMENNMKEVSSMIGNLRNMAIDMGNEIGSQNRQVDRIQ 64
Query: 140 RKVKSASFKEDEGTWKG 156
           +K +S   + DE   K 
Sbjct: 65  QKAESNESRIDEANKKA 81
>pdb|1L4A|D Chain D, X-Ray Structure Of The Neuronal ComplexinSNARE COMPLEX From The Squid Loligo Pealei Length = 87 Back     alignment and structure
>pdb|1SFC|D Chain D, Neuronal Synaptic Fusion Complex Length = 87 Back     alignment and structure
>pdb|1SFC|D Chain D, Neuronal Synaptic Fusion Complex Length = 87 Back     alignment and structure
>pdb|3RK2|D Chain D, Truncated Snare Complex Length = 65 Back     alignment and structure
>pdb|3RK2|D Chain D, Truncated Snare Complex Length = 65 Back     alignment and structure
>pdb|3HD7|D Chain D, Helical Extension Of The Neuronal Snare Complex Into The Membrane, Spacegroup C 1 2 1 Length = 68 Back     alignment and structure
>pdb|3HD7|D Chain D, Helical Extension Of The Neuronal Snare Complex Into The Membrane, Spacegroup C 1 2 1 Length = 68 Back     alignment and structure
>pdb|1N7S|D Chain D, High Resolution Structure Of A Truncated Neuronal Snare Complex Length = 66 Back     alignment and structure
>pdb|1N7S|D Chain D, High Resolution Structure Of A Truncated Neuronal Snare Complex Length = 66 Back     alignment and structure
>pdb|1KIL|D Chain D, Three-Dimensional Structure Of The ComplexinSNARE COMPLEX Length = 66 Back     alignment and structure
>pdb|1KIL|D Chain D, Three-Dimensional Structure Of The ComplexinSNARE COMPLEX Length = 66 Back     alignment and structure
>pdb|1URQ|D Chain D, Crystal Structure Of Neuronal Q-Snares In Complex With R-Snare Motif Of Tomosyn Length = 69 Back     alignment and structure
>pdb|1URQ|D Chain D, Crystal Structure Of Neuronal Q-Snares In Complex With R-Snare Motif Of Tomosyn Length = 69 Back     alignment and structure
>pdb|3ZUR|A Chain A, Crystal Structure Of An Engineered Botulinum Neurotoxin Type A-Snare23 Derivative, Lc0-A-Snap25-Hn-A Length = 960 Back     alignment and structure
>pdb|3ZUR|A Chain A, Crystal Structure Of An Engineered Botulinum Neurotoxin Type A-Snare23 Derivative, Lc0-A-Snap25-Hn-A Length = 960 Back     alignment and structure
>pdb|1XTG|B Chain B, Crystal Structure Of Neurotoxin BontA COMPLEXED WITH Synaptosomal-Associated Protein 25 Length = 59 Back     alignment and structure
>pdb|1XTG|B Chain B, Crystal Structure Of Neurotoxin BontA COMPLEXED WITH Synaptosomal-Associated Protein 25 Length = 59 Back     alignment and structure
>pdb|3ZUS|A Chain A, Crystal Structure Of An Engineered Botulinum Neurotoxin Type A-Snare23 Derivative, Lc-A-Snap23-Hn-A Length = 927 Back     alignment and structure
>pdb|3ZUS|A Chain A, Crystal Structure Of An Engineered Botulinum Neurotoxin Type A-Snare23 Derivative, Lc-A-Snap23-Hn-A Length = 927 Back     alignment and structure
>pdb|1L4A|C Chain C, X-Ray Structure Of The Neuronal ComplexinSNARE COMPLEX From The Squid Loligo Pealei Length = 83 Back     alignment and structure
>pdb|1JTH|A Chain A, Crystal Structure And Biophysical Properties Of A Complex Between The N-Terminal Region Of Snap25 And The Snare Region Of Syntaxin 1a Length = 82 Back     alignment and structure
>pdb|1URQ|C Chain C, Crystal Structure Of Neuronal Q-Snares In Complex With R-Snare Motif Of Tomosyn Length = 80 Back     alignment and structure
>pdb|1N7S|C Chain C, High Resolution Structure Of A Truncated Neuronal Snare Complex Length = 79 Back     alignment and structure
>pdb|3RK2|C Chain C, Truncated Snare Complex Length = 81 Back     alignment and structure
>pdb|1KIL|C Chain C, Three-Dimensional Structure Of The ComplexinSNARE COMPLEX Length = 74 Back     alignment and structure
>pdb|1SFC|C Chain C, Neuronal Synaptic Fusion Complex Length = 83 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query315
1l4a_D87 S-SNAP25 fusion protein; snare, snare complex, mem 3e-20
1l4a_D87 S-SNAP25 fusion protein; snare, snare complex, mem 1e-19
1sfc_D87 Protein (SNAP-25B), protein (synaptobrevin 2); mem 4e-19
1sfc_D87 Protein (SNAP-25B), protein (synaptobrevin 2); mem 1e-18
1n7s_D66 SNAP-25A; neuronal snare protein complex, four hel 3e-13
1n7s_D66 SNAP-25A; neuronal snare protein complex, four hel 7e-13
3b5n_D64 Protein transport protein SEC9; snare complex, syn 2e-08
3b5n_D64 Protein transport protein SEC9; snare complex, syn 2e-08
1nhl_A54 Synaptosomal-associated protein 23; snare, coiled- 3e-06
1n7s_C79 SNAP-25A; neuronal snare protein complex, four hel 4e-06
1l4a_C83 S-SNAP25 fusion protein; snare, snare complex, mem 2e-05
>1l4a_D S-SNAP25 fusion protein; snare, snare complex, membrane fusion, neurotransmission, endocytosis/exocytosis complex; 2.95A {Loligo pealei} SCOP: h.1.15.1 Length = 87 Back     alignment and structure
 Score = 82.4 bits (203), Expect = 3e-20
 Identities = 45/81 (55%), Positives = 63/81 (77%)

Query: 77  VMDDRNGLGPQAGYIGKITNDARENEMEENMGQVNTMIGNLRNMAIDMGSELENQNRQID 136
            + D+NG+GP +GY+ +ITNDARE++ME NM +V++MIGNLRNMAIDMG+E+ +QNRQ+D
Sbjct: 2   TVGDQNGMGPSSGYVTRITNDAREDDMENNMKEVSSMIGNLRNMAIDMGNEIGSQNRQVD 61

Query: 137 RINRKVKSASFKEDEGTWKGN 157
           RI +K +S   + DE   K  
Sbjct: 62  RIQQKAESNESRIDEANKKAT 82
>1l4a_D S-SNAP25 fusion protein; snare, snare complex, membrane fusion, neurotransmission, endocytosis/exocytosis complex; 2.95A {Loligo pealei} SCOP: h.1.15.1 Length = 87 Back     alignment and structure
>1sfc_D Protein (SNAP-25B), protein (synaptobrevin 2); membrane fusion protein complex, transport protein; 2.40A {Rattus norvegicus} SCOP: h.1.15.1 Length = 87 Back     alignment and structure
>1sfc_D Protein (SNAP-25B), protein (synaptobrevin 2); membrane fusion protein complex, transport protein; 2.40A {Rattus norvegicus} SCOP: h.1.15.1 Length = 87 Back     alignment and structure
>1n7s_D SNAP-25A; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 3rk2_D 3rk3_D 3rl0_D 1kil_D 3hd7_D* 3hd9_D 3ipd_D 1urq_D 1xtg_B Length = 66 Back     alignment and structure
>1n7s_D SNAP-25A; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 3rk2_D 3rk3_D 3rl0_D 1kil_D 3hd7_D* 3hd9_D 3ipd_D 1urq_D 1xtg_B Length = 66 Back     alignment and structure
>3b5n_D Protein transport protein SEC9; snare complex, syntaxin, synaptobrevin, SNAP-25, SSO1P, SNC1P, SEC9P, SSO1, SNC1, coiled coil; 1.60A {Saccharomyces cerevisiae} Length = 64 Back     alignment and structure
>3b5n_D Protein transport protein SEC9; snare complex, syntaxin, synaptobrevin, SNAP-25, SSO1P, SNC1P, SEC9P, SSO1, SNC1, coiled coil; 1.60A {Saccharomyces cerevisiae} Length = 64 Back     alignment and structure
>1nhl_A Synaptosomal-associated protein 23; snare, coiled-coil, protein transport; 2.30A {Homo sapiens} SCOP: h.1.15.1 Length = 54 Back     alignment and structure
>1n7s_C SNAP-25A; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 1sfc_C 1urq_C 3hd7_C* 3hd9_C 3ipd_C 3rk2_C 3rk3_C 3rl0_C 1kil_C 1jth_A Length = 79 Back     alignment and structure
>1l4a_C S-SNAP25 fusion protein; snare, snare complex, membrane fusion, neurotransmission, endocytosis/exocytosis complex; 2.95A {Loligo pealei} SCOP: h.1.15.1 Length = 83 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query315
1l4a_D87 S-SNAP25 fusion protein; snare, snare complex, mem 99.78
1sfc_D87 Protein (SNAP-25B), protein (synaptobrevin 2); mem 99.76
1l4a_D87 S-SNAP25 fusion protein; snare, snare complex, mem 99.76
1sfc_D87 Protein (SNAP-25B), protein (synaptobrevin 2); mem 99.75
3b5n_D64 Protein transport protein SEC9; snare complex, syn 99.73
3b5n_D64 Protein transport protein SEC9; snare complex, syn 99.64
1n7s_D66 SNAP-25A; neuronal snare protein complex, four hel 99.57
1n7s_D66 SNAP-25A; neuronal snare protein complex, four hel 99.35
1gl2_D65 Syntaxin 8, vesicle transport V-snare protein VTI1 99.31
2nps_D82 Syntaxin-6; vesicle fusion, snare complex, early e 99.18
1l4a_C83 S-SNAP25 fusion protein; snare, snare complex, mem 99.05
3b5n_C70 Protein transport protein SEC9; snare complex, syn 99.01
1nhl_A54 Synaptosomal-associated protein 23; snare, coiled- 99.0
1gl2_D65 Syntaxin 8, vesicle transport V-snare protein VTI1 98.88
1n7s_C79 SNAP-25A; neuronal snare protein complex, four hel 98.84
2nps_D82 Syntaxin-6; vesicle fusion, snare complex, early e 98.69
1gl2_C65 VTI1B, vesicle transport V-snare protein VTI1-like 98.02
2nps_C81 Vesicle transport through interaction with T- snar 97.28
3hd7_B109 Syntaxin-1A; membrane protein, coiled-coil, 4-heli 95.0
2nps_B71 Syntaxin 13, vesicle-associated membrane protein 4 91.91
1jth_B77 Syntaxin 1A; coiled-coil, polar layer, endocytosis 91.17
1gl2_B65 Syntaxin 7; membrane protein, membrane fusion prot 90.91
3b5n_B69 Protein SSO1; snare complex, syntaxin, synaptobrev 90.46
1n7s_B68 Syntaxin 1A; neuronal snare protein complex, four 89.42
1sfc_B83 Protein (syntaxin 1A), protein (synaptobrevin 2); 88.92
2nps_B71 Syntaxin 13, vesicle-associated membrane protein 4 86.28
1gl2_B65 Syntaxin 7; membrane protein, membrane fusion prot 85.81
1n7s_B68 Syntaxin 1A; neuronal snare protein complex, four 84.39
3b5n_B69 Protein SSO1; snare complex, syntaxin, synaptobrev 84.21
1jth_B77 Syntaxin 1A; coiled-coil, polar layer, endocytosis 83.24
>1l4a_D S-SNAP25 fusion protein; snare, snare complex, membrane fusion, neurotransmission, endocytosis/exocytosis complex; 2.95A {Loligo pealei} SCOP: h.1.15.1 Back     alignment and structure
Probab=99.78  E-value=2.4e-19  Score=142.44  Aligned_cols=74  Identities=58%  Similarity=0.940  Sum_probs=69.7

Q ss_pred             CCCCCCCCCcccCchHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhhhhhcccC
Q psy4205          83 GLGPQAGYIGKITNDARENEMEENMGQVNTMIGNLRNMAIDMGSELENQNRQIDRINRKVKSASFKEDEGTWKG  156 (315)
Q Consensus        83 ~~~~sg~yikrit~d~~e~EmD~NLd~ls~~L~rLK~mA~dMg~EId~QN~~LDrI~~Kvd~~d~rI~~aNkr~  156 (315)
                      +.+++|+|+++++++++++|+|++|++||.+|++||+||++||+||++||+.||+|.+++|.++.||+.+|+|.
T Consensus         8 ~~~~~~~~i~~~~~d~~e~eqD~~Ld~ls~~l~rLk~mA~~mg~Eld~Qn~~LD~i~~~~D~~~~rl~~~n~r~   81 (87)
T 1l4a_D            8 GMGPSSGYVTRITNDAREDDMENNMKEVSSMIGNLRNMAIDMGNEIGSQNRQVDRIQQKAESNESRIDEANKKA   81 (87)
T ss_dssp             ---CCSSSSCCSSCSHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHTHHHHHH
T ss_pred             CCCCCchHHhccchHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34688999999999999999999999999999999999999999999999999999999999999999999984
>1sfc_D Protein (SNAP-25B), protein (synaptobrevin 2); membrane fusion protein complex, transport protein; 2.40A {Rattus norvegicus} SCOP: h.1.15.1 Back     alignment and structure
>1l4a_D S-SNAP25 fusion protein; snare, snare complex, membrane fusion, neurotransmission, endocytosis/exocytosis complex; 2.95A {Loligo pealei} SCOP: h.1.15.1 Back     alignment and structure
>1sfc_D Protein (SNAP-25B), protein (synaptobrevin 2); membrane fusion protein complex, transport protein; 2.40A {Rattus norvegicus} SCOP: h.1.15.1 Back     alignment and structure
>3b5n_D Protein transport protein SEC9; snare complex, syntaxin, synaptobrevin, SNAP-25, SSO1P, SNC1P, SEC9P, SSO1, SNC1, coiled coil; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3b5n_D Protein transport protein SEC9; snare complex, syntaxin, synaptobrevin, SNAP-25, SSO1P, SNC1P, SEC9P, SSO1, SNC1, coiled coil; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1n7s_D SNAP-25A; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 3rk2_D 3rk3_D 3rl0_D 1kil_D 3hd7_D* 3hd9_D 3ipd_D 1urq_D 1xtg_B Back     alignment and structure
>1n7s_D SNAP-25A; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 3rk2_D 3rk3_D 3rl0_D 1kil_D 3hd7_D* 3hd9_D 3ipd_D 1urq_D 1xtg_B Back     alignment and structure
>1gl2_D Syntaxin 8, vesicle transport V-snare protein VTI1-like 1; membrane protein, membrane fusion protein complex, coiled coil, transmembrane; 1.9A {Rattus norvegicus} SCOP: h.1.15.1 Back     alignment and structure
>2nps_D Syntaxin-6; vesicle fusion, snare complex, early endosomal snare complex, VTI1A, VAMP4, transport protein; 2.50A {Homo sapiens} Back     alignment and structure
>1l4a_C S-SNAP25 fusion protein; snare, snare complex, membrane fusion, neurotransmission, endocytosis/exocytosis complex; 2.95A {Loligo pealei} SCOP: h.1.15.1 Back     alignment and structure
>3b5n_C Protein transport protein SEC9; snare complex, syntaxin, synaptobrevin, SNAP-25, SSO1P, SNC1P, SEC9P, SSO1, SNC1, coiled coil; 1.60A {Saccharomyces cerevisiae} SCOP: h.1.15.1 Back     alignment and structure
>1nhl_A Synaptosomal-associated protein 23; snare, coiled-coil, protein transport; 2.30A {Homo sapiens} SCOP: h.1.15.1 Back     alignment and structure
>1gl2_D Syntaxin 8, vesicle transport V-snare protein VTI1-like 1; membrane protein, membrane fusion protein complex, coiled coil, transmembrane; 1.9A {Rattus norvegicus} SCOP: h.1.15.1 Back     alignment and structure
>1n7s_C SNAP-25A; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 1sfc_C 1urq_C 3hd7_C* 3hd9_C 3ipd_C 3rk2_C 3rk3_C 3rl0_C 1kil_C 1jth_A Back     alignment and structure
>2nps_D Syntaxin-6; vesicle fusion, snare complex, early endosomal snare complex, VTI1A, VAMP4, transport protein; 2.50A {Homo sapiens} Back     alignment and structure
>1gl2_C VTI1B, vesicle transport V-snare protein VTI1-like 1; membrane protein, membrane fusion protein complex, coiled coil, transmembrane; 1.9A {Mus musculus} SCOP: h.1.15.1 Back     alignment and structure
>2nps_C Vesicle transport through interaction with T- snares homolog 1A; vesicle fusion, snare complex, early endosomal snare complex, VTI1A, VAMP4, transport protein; 2.50A {Rattus norvegicus} Back     alignment and structure
>3hd7_B Syntaxin-1A; membrane protein, coiled-coil, 4-helical bundle, cell juncti cytoplasmic vesicle, membrane, phosphoprotein; HET: GGG; 3.40A {Rattus norvegicus} PDB: 3hd9_B 3ipd_B Back     alignment and structure
>2nps_B Syntaxin 13, vesicle-associated membrane protein 4; vesicle fusion, snare complex, early endosomal snare complex, VTI1A, VAMP4, transport protein; 2.50A {Rattus norvegicus} Back     alignment and structure
>1jth_B Syntaxin 1A; coiled-coil, polar layer, endocytosis-exocytosis complex; 2.00A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 1hvv_A* 1urq_B Back     alignment and structure
>1gl2_B Syntaxin 7; membrane protein, membrane fusion protein complex, coiled coil, transmembrane; 1.9A {Mus musculus} SCOP: h.1.15.1 Back     alignment and structure
>3b5n_B Protein SSO1; snare complex, syntaxin, synaptobrevin, SNAP-25, SSO1P, SNC1P, SEC9P, SSO1, SNC1, coiled coil; 1.60A {Saccharomyces cerevisiae} SCOP: h.1.15.1 Back     alignment and structure
>1n7s_B Syntaxin 1A; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 3rk2_B 3rk3_B 3rl0_B 1kil_B Back     alignment and structure
>1sfc_B Protein (syntaxin 1A), protein (synaptobrevin 2); membrane fusion protein complex, transport protein; 2.40A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 1l4a_B Back     alignment and structure
>2nps_B Syntaxin 13, vesicle-associated membrane protein 4; vesicle fusion, snare complex, early endosomal snare complex, VTI1A, VAMP4, transport protein; 2.50A {Rattus norvegicus} Back     alignment and structure
>1gl2_B Syntaxin 7; membrane protein, membrane fusion protein complex, coiled coil, transmembrane; 1.9A {Mus musculus} SCOP: h.1.15.1 Back     alignment and structure
>1n7s_B Syntaxin 1A; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 3rk2_B 3rk3_B 3rl0_B 1kil_B Back     alignment and structure
>3b5n_B Protein SSO1; snare complex, syntaxin, synaptobrevin, SNAP-25, SSO1P, SNC1P, SEC9P, SSO1, SNC1, coiled coil; 1.60A {Saccharomyces cerevisiae} SCOP: h.1.15.1 Back     alignment and structure
>1jth_B Syntaxin 1A; coiled-coil, polar layer, endocytosis-exocytosis complex; 2.00A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 1hvv_A* 1urq_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query315
d1io1a_ 395 Phase 1 flagellin {Salmonella typhimurium [TaxId: 83.67
>d1io1a_ e.32.1.1 (A:) Phase 1 flagellin {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Phase 1 flagellin
superfamily: Phase 1 flagellin
family: Phase 1 flagellin
domain: Phase 1 flagellin
species: Salmonella typhimurium [TaxId: 90371]

Probab=83.67  E-value=0.81  Score=38.44  Aligned_cols=51  Identities=18%  Similarity=0.351  Sum_probs=44.2

Q ss_pred             HHHHHHHHHHHHHhHHHHHH-------------HHHHHHHHHHHHHHHHHhhhhhhhhhhhhhc
Q psy4205         103 MEENMGQVNTMIGNLRNMAI-------------DMGSELENQNRQIDRINRKVKSASFKEDEGT  153 (315)
Q Consensus       103 mD~NLd~ls~~L~rLK~mA~-------------dMg~EId~QN~~LDrI~~Kvd~~d~rI~~aN  153 (315)
                      .|-.|++++++|.|+|.||+             .+..||+...++|+||...++-+...|-.-+
T Consensus        22 ae~al~~~~~iL~r~reLavqaan~t~~~~dr~ai~~E~~~l~~ei~~ia~~T~fng~~Ll~Gs   85 (395)
T d1io1a_          22 TEGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLNEIDRVSGQTQFNGVKVLAQD   85 (395)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTCTTCCHHHHHHHHHHHHHHHHHHHHHHHHCCBTTBCTTTSC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhccCCCCHHHHHHHHHHHHHHHHHHHHHHHhCeeCCccccccc
Confidence            37899999999999999997             4679999999999999999888777775433