Psyllid ID: psy4210


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70-
MTLTLSSNPSHLELVYPVNLGKTKAFQFLTNDNAGDRIAHPKLSNSSLMITLGIGLPMFLYTEILHSQEKV
cEEEEEccccccHHHccEEHHHHHHHHHHcccccccEEEEEEEEcHHHcccccHHHHHHcccccccccccc
ccEEEEcccccEEEEcccccccccEEEEEccccccccEEcccccccHHHHHHcccHHHHHHHHHHHccccc
mtltlssnpshlelvypvnlgktkafqfltndnagdriahpklsnsslMITLGIGLPMFLYTEILHSQEKV
mtltlssnpshleLVYPVNLGKTKAFQFLTNDNAGDRIAHPKLSNSSLMITLGIGLPMFLYTEILHSQEKV
MTLTLSSNPSHLELVYPVNLGKTKAFQFLTNDNAGDRIAHPKLSNSSLMITLGIGLPMFLYTEILHSQEKV
***********LELVYPVNLGKTKAFQFLTNDNAGDRIAHPKLSNSSLMITLGIGLPMFLYTEIL******
MTLTLSSNPSHLELVYPVNLGKTKAFQFLTNDNAGDRIAHPKLSNSSLMITLGIGLPMFLYTEIL******
********PSHLELVYPVNLGKTKAFQFLTNDNAGDRIAHPKLSNSSLMITLGIGLPMFLYTEILHSQEKV
*TLTLSSNPSHLELVYPVNLGKTKAFQFLTNDNAGDRIAHPKLSNSSLMITLGIGLPMFLYTEILHS****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLTLSSNPSHLELVYPVNLGKTKAFQFLTNDNAGDRIAHPKLSNSSLMITLGIGLPMFLYTEILHSQEKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query71 2.2.26 [Sep-21-2011]
Q68EW0 1018 2-oxoglutarate dehydrogen N/A N/A 0.535 0.037 0.552 0.0001
Q5RCB8 1023 2-oxoglutarate dehydrogen yes N/A 0.901 0.062 0.375 0.0002
Q02218 1023 2-oxoglutarate dehydrogen no N/A 0.901 0.062 0.375 0.0002
Q5XI78 1023 2-oxoglutarate dehydrogen yes N/A 0.901 0.062 0.375 0.0002
Q60597 1023 2-oxoglutarate dehydrogen yes N/A 0.901 0.062 0.375 0.0002
Q60HE2 1023 2-oxoglutarate dehydrogen N/A N/A 0.901 0.062 0.375 0.0002
Q148N0 1023 2-oxoglutarate dehydrogen yes N/A 0.901 0.062 0.375 0.0002
Q5R9L8 1010 2-oxoglutarate dehydrogen no N/A 0.535 0.037 0.552 0.0003
Q9ULD0 1010 2-oxoglutarate dehydrogen no N/A 0.535 0.037 0.552 0.0003
Q6P6Z8 1021 2-oxoglutarate dehydrogen N/A N/A 0.535 0.037 0.526 0.0006
>sp|Q68EW0|OGDHL_XENLA 2-oxoglutarate dehydrogenase-like, mitochondrial OS=Xenopus laevis GN=ogdhl PE=2 SV=1 Back     alignment and function desciption
 Score = 45.1 bits (105), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 27/38 (71%)

Query: 1   MTLTLSSNPSHLELVYPVNLGKTKAFQFLTNDNAGDRI 38
           +TL+L +NPSHLE V PV  GKTKA QF   D  G+++
Sbjct: 361 ITLSLVANPSHLEAVDPVVQGKTKAEQFYRGDTEGNKV 398





Xenopus laevis (taxid: 8355)
EC: 1EC: .EC: 2EC: .EC: 4EC: .EC: -
>sp|Q5RCB8|ODO1_PONAB 2-oxoglutarate dehydrogenase, mitochondrial OS=Pongo abelii GN=OGDH PE=2 SV=1 Back     alignment and function description
>sp|Q02218|ODO1_HUMAN 2-oxoglutarate dehydrogenase, mitochondrial OS=Homo sapiens GN=OGDH PE=1 SV=3 Back     alignment and function description
>sp|Q5XI78|ODO1_RAT 2-oxoglutarate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Ogdh PE=1 SV=1 Back     alignment and function description
>sp|Q60597|ODO1_MOUSE 2-oxoglutarate dehydrogenase, mitochondrial OS=Mus musculus GN=Ogdh PE=1 SV=3 Back     alignment and function description
>sp|Q60HE2|ODO1_MACFA 2-oxoglutarate dehydrogenase, mitochondrial OS=Macaca fascicularis GN=OGDH PE=2 SV=1 Back     alignment and function description
>sp|Q148N0|ODO1_BOVIN 2-oxoglutarate dehydrogenase, mitochondrial OS=Bos taurus GN=OGDH PE=2 SV=1 Back     alignment and function description
>sp|Q5R9L8|OGDHL_PONAB 2-oxoglutarate dehydrogenase-like, mitochondrial OS=Pongo abelii GN=OGDHL PE=2 SV=2 Back     alignment and function description
>sp|Q9ULD0|OGDHL_HUMAN 2-oxoglutarate dehydrogenase-like, mitochondrial OS=Homo sapiens GN=OGDHL PE=1 SV=3 Back     alignment and function description
>sp|Q6P6Z8|ODO1_XENLA 2-oxoglutarate dehydrogenase, mitochondrial OS=Xenopus laevis GN=ogdh PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query71
198429807 960 PREDICTED: similar to MGC80496 protein [ 0.535 0.039 0.605 0.0001
432876376 1122 PREDICTED: 2-oxoglutarate dehydrogenase, 0.901 0.057 0.421 0.0005
47210299 1070 unnamed protein product [Tetraodon nigro 0.901 0.059 0.421 0.0005
>gi|198429807|ref|XP_002121080.1| PREDICTED: similar to MGC80496 protein [Ciona intestinalis] Back     alignment and taxonomy information
 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/38 (60%), Positives = 28/38 (73%)

Query: 1   MTLTLSSNPSHLELVYPVNLGKTKAFQFLTNDNAGDRI 38
           + L+L +NPSHLE V PV  GKTKA QF  NDN GD++
Sbjct: 377 INLSLCANPSHLEAVDPVVQGKTKAEQFYLNDNEGDKV 414




Source: Ciona intestinalis

Species: Ciona intestinalis

Genus: Ciona

Family: Cionidae

Order: Enterogona

Class: Ascidiacea

Phylum: Chordata

Superkingdom: Eukaryota

>gi|432876376|ref|XP_004073018.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|47210299|emb|CAF94599.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query71
ZFIN|ZDB-GENE-030131-2143 1024 ogdha "oxoglutarate (alpha-ket 0.901 0.062 0.406 8.9e-05
UNIPROTKB|E1BTL0 1014 OGDHL "Uncharacterized protein 0.535 0.037 0.578 0.00011
ZFIN|ZDB-GENE-090311-8 1023 ogdhb "oxoglutarate (alpha-ket 0.901 0.062 0.406 0.00011
UNIPROTKB|H9GW68 798 OGDH "Uncharacterized protein" 0.901 0.080 0.375 0.00023
UNIPROTKB|E9PFG7 873 OGDH "2-oxoglutarate dehydroge 0.901 0.073 0.375 0.00025
UNIPROTKB|F5H801 974 OGDH "2-oxoglutarate dehydroge 0.901 0.065 0.375 0.00029
UNIPROTKB|D4A7P8 1013 Ogdh "2-oxoglutarate dehydroge 0.901 0.063 0.375 0.0003
UNIPROTKB|Q148N0 1023 OGDH "2-oxoglutarate dehydroge 0.901 0.062 0.375 0.0003
UNIPROTKB|Q02218 1023 OGDH "2-oxoglutarate dehydroge 0.901 0.062 0.375 0.0003
UNIPROTKB|Q5RCB8 1023 OGDH "2-oxoglutarate dehydroge 0.901 0.062 0.375 0.0003
ZFIN|ZDB-GENE-030131-2143 ogdha "oxoglutarate (alpha-ketoglutarate) dehydrogenase a (lipoamide)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 107 (42.7 bits), Expect = 8.9e-05, P = 8.9e-05
 Identities = 26/64 (40%), Positives = 35/64 (54%)

Query:     1 MTLTLSSNPSHLELVYPVNLGKTKAFQFLTNDNAGDRIAHPKLSNSSLMITLGIGLPMFL 60
             +TL+L +NPSHLE V PV  GKTKA QF + D  G R+    L   +     GI    F 
Sbjct:   366 ITLSLVANPSHLEAVNPVVQGKTKAEQFYSGDTDGKRVMSILLHGDAAFAGQGIVYETFH 425

Query:    61 YTEI 64
              +++
Sbjct:   426 LSDL 429




GO:0030976 "thiamine pyrophosphate binding" evidence=IEA
GO:0006099 "tricarboxylic acid cycle" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0016624 "oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor" evidence=IEA
GO:0004591 "oxoglutarate dehydrogenase (succinyl-transferring) activity" evidence=IEA
UNIPROTKB|E1BTL0 OGDHL "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090311-8 ogdhb "oxoglutarate (alpha-ketoglutarate) dehydrogenase b (lipoamide)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|H9GW68 OGDH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E9PFG7 OGDH "2-oxoglutarate dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F5H801 OGDH "2-oxoglutarate dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D4A7P8 Ogdh "2-oxoglutarate dehydrogenase, mitochondrial" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q148N0 OGDH "2-oxoglutarate dehydrogenase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q02218 OGDH "2-oxoglutarate dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RCB8 OGDH "2-oxoglutarate dehydrogenase, mitochondrial" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query71
cd02016265 cd02016, TPP_E1_OGDC_like, Thiamine pyrophosphate 7e-10
PRK09404 924 PRK09404, sucA, 2-oxoglutarate dehydrogenase E1 co 9e-08
COG0567 906 COG0567, SucA, 2-oxoglutarate dehydrogenase comple 6e-07
TIGR00239 929 TIGR00239, 2oxo_dh_E1, 2-oxoglutarate dehydrogenas 5e-05
>gnl|CDD|238974 cd02016, TPP_E1_OGDC_like, Thiamine pyrophosphate (TPP) family, E1 of OGDC-like subfamily, TPP-binding module; composed of proteins similar to the E1 component of the 2-oxoglutarate dehydrogenase multienzyme complex (OGDC) Back     alignment and domain information
 Score = 52.1 bits (126), Expect = 7e-10
 Identities = 18/38 (47%), Positives = 25/38 (65%)

Query: 1   MTLTLSSNPSHLELVYPVNLGKTKAFQFLTNDNAGDRI 38
           + L+L+ NPSHLE V PV +GKT+A Q    D   D++
Sbjct: 104 VHLSLAPNPSHLEAVNPVVMGKTRAKQDYRGDGERDKV 141


OGDC catalyzes the oxidative decarboxylation of 2-oxoglutarate to succinyl-CoA and carbon dioxide, a key reaction of the tricarboxylic acid cycle. Length = 265

>gnl|CDD|236499 PRK09404, sucA, 2-oxoglutarate dehydrogenase E1 component; Reviewed Back     alignment and domain information
>gnl|CDD|223641 COG0567, SucA, 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|161785 TIGR00239, 2oxo_dh_E1, 2-oxoglutarate dehydrogenase, E1 component Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 71
KOG0450|consensus 1017 99.97
COG0567 906 SucA 2-oxoglutarate dehydrogenase complex, dehydro 99.96
KOG0451|consensus 913 99.95
PRK12270 1228 kgd alpha-ketoglutarate decarboxylase; Reviewed 99.95
cd02016265 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) fami 99.89
TIGR00239 929 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 compon 99.89
PRK09404 924 sucA 2-oxoglutarate dehydrogenase E1 component; Re 99.86
PF00676 300 E1_dh: Dehydrogenase E1 component; InterPro: IPR00 98.83
PLN02269 362 Pyruvate dehydrogenase E1 component subunit alpha 98.1
cd02000 293 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) 97.64
TIGR03182 315 PDH_E1_alph_y pyruvate dehydrogenase E1 component, 97.51
PLN02374 433 pyruvate dehydrogenase (acetyl-transferring) 95.15
KOG0225|consensus 394 94.45
TIGR03181 341 PDH_E1_alph_x pyruvate dehydrogenase E1 component, 94.26
PF13292 270 DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate syn 94.1
COG1154 627 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme m 92.79
PLN02225 701 1-deoxy-D-xylulose-5-phosphate synthase 91.5
CHL00149 341 odpA pyruvate dehydrogenase E1 component alpha sub 90.52
cd02007195 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS s 89.22
PRK12315 581 1-deoxy-D-xylulose-5-phosphate synthase; Provision 86.34
PLN02234 641 1-deoxy-D-xylulose-5-phosphate synthase 84.37
COG1071 358 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex 82.92
>KOG0450|consensus Back     alignment and domain information
Probab=99.97  E-value=3.4e-32  Score=225.47  Aligned_cols=66  Identities=35%  Similarity=0.541  Sum_probs=64.5

Q ss_pred             CeEEeecCCCCccccCceeeeeeehhhhhccCCCCCeEEeEeeecchhccCcchhHHhhhhccCcC
Q psy4210           1 MTLTLSSNPSHLELVYPVNLGKTKAFQFLTNDNAGDRIAHPKLSNSSLMITLGIGLPMFLYTEILH   66 (71)
Q Consensus         1 v~v~l~~NPSHLEaVnPVv~Gk~RA~Q~~~~d~~~~~vlpiliHGDAAf~GQGvv~Etl~ls~lph   66 (71)
                      |+++|++|||||||+||||+|||||+|++.+|.+++|+|.|||||||||||||||||||.||+||.
T Consensus       365 i~LslVANPSHLEA~DPVV~GKtrA~q~y~~D~~~~k~m~ILiHGDaaFAgQGVVyET~hls~LP~  430 (1017)
T KOG0450|consen  365 ITLSLVANPSHLEAVDPVVMGKTRAEQFYTGDEEGKKVMGILIHGDAAFAGQGVVYETFHLSDLPS  430 (1017)
T ss_pred             eEEEEecCchhhcccCceeechHHHHHHhccccccceeEEEEEecchhhccCceEEEeeccccCCC
Confidence            689999999999999999999999999999999999999999999999999999999999999995



>COG0567 SucA 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>KOG0451|consensus Back     alignment and domain information
>PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>cd02016 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) family, E1 of OGDC-like subfamily, TPP-binding module; composed of proteins similar to the E1 component of the 2-oxoglutarate dehydrogenase multienzyme complex (OGDC) Back     alignment and domain information
>TIGR00239 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 component Back     alignment and domain information
>PRK09404 sucA 2-oxoglutarate dehydrogenase E1 component; Reviewed Back     alignment and domain information
>PF00676 E1_dh: Dehydrogenase E1 component; InterPro: IPR001017 This entry includes a number of dehydrogenases all of which use thiamine pyrophosphate as a cofactor and are members of a multienzyme complex Back     alignment and domain information
>PLN02269 Pyruvate dehydrogenase E1 component subunit alpha Back     alignment and domain information
>cd02000 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information
>TIGR03182 PDH_E1_alph_y pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>PLN02374 pyruvate dehydrogenase (acetyl-transferring) Back     alignment and domain information
>KOG0225|consensus Back     alignment and domain information
>TIGR03181 PDH_E1_alph_x pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>PF13292 DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate synthase; PDB: 2O1X_C 2O1S_B Back     alignment and domain information
>COG1154 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism] Back     alignment and domain information
>PLN02225 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>CHL00149 odpA pyruvate dehydrogenase E1 component alpha subunit; Reviewed Back     alignment and domain information
>cd02007 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis Back     alignment and domain information
>PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PLN02234 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>COG1071 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query71
2jgd_A 933 2-oxoglutarate dehydrogenase E1 component; flavopr 1e-09
2yic_A 868 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.9 5e-08
2xt6_A 1113 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET 7e-08
>2jgd_A 2-oxoglutarate dehydrogenase E1 component; flavoprotein, oxidoreductase, thiamine diphosphate, thiamine pyrophosphate, adenosine monophosphate; HET: AMP; 2.6A {Escherichia coli} PDB: 2jgd_B* Length = 933 Back     alignment and structure
 Score = 51.1 bits (123), Expect = 1e-09
 Identities = 13/38 (34%), Positives = 24/38 (63%)

Query: 1   MTLTLSSNPSHLELVYPVNLGKTKAFQFLTNDNAGDRI 38
           + L L+ NPSHLE+V PV +G  +A     ++ + +++
Sbjct: 312 VHLALAFNPSHLEIVSPVVIGSVRARLDRLDEPSSNKV 349


>2yic_A 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.96A {Mycobacterium smegmatis} PDB: 2xta_A* 2y0p_A* 2xt9_A* 2yid_A* Length = 868 Back     alignment and structure
>2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Length = 1113 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query71
2yic_A 868 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.9 99.57
2jgd_A 933 2-oxoglutarate dehydrogenase E1 component; flavopr 99.57
2xt6_A 1113 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET 99.52
1w85_A 368 Pyruvate dehydrogenase E1 component, alpha subunit 98.45
2bfd_A 400 2-oxoisovalerate dehydrogenase alpha subunit; oxid 98.2
1qs0_A 407 2-oxoisovalerate dehydrogenase alpha-subunit; hete 98.2
1umd_A 367 E1-alpha, 2-OXO acid dehydrogenase alpha subunit; 98.08
2ozl_A 365 PDHE1-A type I, pyruvate dehydrogenase E1 componen 98.07
3mos_A 616 Transketolase, TK; thiamin diphosphate TPP THDP en 83.55
>2yic_A 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.96A {Mycobacterium smegmatis} PDB: 2xta_A* 2y0p_A* 2xt9_A* 2yid_A* Back     alignment and structure
Probab=99.57  E-value=3.6e-16  Score=128.16  Aligned_cols=66  Identities=24%  Similarity=0.252  Sum_probs=58.9

Q ss_pred             CeEEeecCCCCccccCceeeeeeehhhhhccCCCC-----CeEEeEeeecchhccCcchhHHhhhhccCcC
Q psy4210           1 MTLTLSSNPSHLELVYPVNLGKTKAFQFLTNDNAG-----DRIAHPKLSNSSLMITLGIGLPMFLYTEILH   66 (71)
Q Consensus         1 v~v~l~~NPSHLEaVnPVv~Gk~RA~Q~~~~d~~~-----~~vlpiliHGDAAf~GQGvv~Etl~ls~lph   66 (71)
                      +++++++|||||+++.|+++|.++|+|++.++.++     .+.+++.+||||||++||+++|+|||+.+..
T Consensus       236 v~l~l~~n~s~Lg~~~P~A~G~A~A~k~~~~~~~~~~~~~~~~~vv~~~GDGa~~~eG~v~Ealn~A~~~~  306 (868)
T 2yic_A          236 IEVSLTANPSHLEAVDPVLEGLVRAKQDLLDTGEEGSDNRFSVVPLMLHGDAAFAGQGVVAETLNLALLRG  306 (868)
T ss_dssp             EEEEECCCCSSTTTTHHHHHHHHHHHHHHHTCSTTSSSCSCCEEEEEEEEHHHHHHCHHHHHHHTTTTCTT
T ss_pred             eeeeecCCCccccccccHHHHHHHHHHhhccCCcccccccCCceEEEEECCcccccccHHHHHHHHHHhcC
Confidence            46899999999999999999999999987654333     6789999999999999999999999998754



>2jgd_A 2-oxoglutarate dehydrogenase E1 component; flavoprotein, oxidoreductase, thiamine diphosphate, thiamine pyrophosphate, adenosine monophosphate; HET: AMP; 2.6A {Escherichia coli} PDB: 2jgd_B* Back     alignment and structure
>2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Back     alignment and structure
>1w85_A Pyruvate dehydrogenase E1 component, alpha subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.11 PDB: 3duf_A* 3dv0_A* 3dva_A* 1w88_A* Back     alignment and structure
>2bfd_A 2-oxoisovalerate dehydrogenase alpha subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.11 PDB: 1v16_A* 2bfc_A* 1v1r_A* 1olu_A* 2bfb_A* 1v1m_A* 2bew_A* 1dtw_A* 1olx_A* 1ols_A* 1wci_A* 1x80_A* 2beu_A* 1u5b_A* 2bev_A* 1v11_A* 1x7x_A* 1x7y_A* 1x7w_A* 1x7z_A* ... Back     alignment and structure
>1qs0_A 2-oxoisovalerate dehydrogenase alpha-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.11 PDB: 2bp7_A Back     alignment and structure
>1umd_A E1-alpha, 2-OXO acid dehydrogenase alpha subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.11 PDB: 1um9_A* 1umc_A* 1umb_A* Back     alignment and structure
>2ozl_A PDHE1-A type I, pyruvate dehydrogenase E1 component alpha subunit, somatic form; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.11 PDB: 1ni4_A* 3exe_A* 3exi_A 3exh_A* 3exg_A 3exf_A* Back     alignment and structure
>3mos_A Transketolase, TK; thiamin diphosphate TPP THDP enzyme catalysis sugar metaboli transferase; HET: TPP; 1.75A {Homo sapiens} PDB: 3ooy_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query71
d2ozla1 361 E1-beta subunit of pyruvate dehydrogenase (PP modu 97.23
d1umda_ 362 Branched-chain alpha-keto acid dehydrogenase, PP m 97.11
d2bfda1 395 Branched-chain alpha-keto acid dehydrogenase, PP m 96.09
d1w85a_ 365 Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus st 95.75
d1qs0a_ 407 2-oxoisovalerate dehydrogenase (E1B), PP module {P 93.95
>d2ozla1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thiamin diphosphate-binding fold (THDP-binding)
superfamily: Thiamin diphosphate-binding fold (THDP-binding)
family: Branched-chain alpha-keto acid dehydrogenase PP module
domain: E1-beta subunit of pyruvate dehydrogenase (PP module)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.23  E-value=2.5e-05  Score=56.52  Aligned_cols=52  Identities=10%  Similarity=0.059  Sum_probs=44.4

Q ss_pred             cCCCCccccCceeeeeeehhhhhccCCCCCeEEeEeeecchhccCcchhHHhhhhccC
Q psy4210           7 SNPSHLELVYPVNLGKTKAFQFLTNDNAGDRIAHPKLSNSSLMITLGIGLPMFLYTEI   64 (71)
Q Consensus         7 ~NPSHLEaVnPVv~Gk~RA~Q~~~~d~~~~~vlpiliHGDAAf~GQGvv~Etl~ls~l   64 (71)
                      .-.|++.+.-|++.|.+.|.+....     +-+.+...||||+. ||..+|+||++.+
T Consensus       133 ~~~~ivg~~~p~A~G~A~a~k~~~~-----~~v~~~~~GDGa~~-eG~f~Ealn~A~~  184 (361)
T d2ozla1         133 GGNGIVGAQVPLGAGIALACKYNGK-----DEVCLTLYGDGAAN-QGQIFEAYNMAAL  184 (361)
T ss_dssp             CCCCSTTTHHHHHHHHHHHHHHHTC-----CCCEEEEEETTGGG-CHHHHHHHHHHHH
T ss_pred             CccccccccchhHHHHHHHhhhccC-----CCeEEEEecCCCcc-Ccchhhhhhhhhh
Confidence            3468899999999999999988643     34889999999998 9999999999754



>d1umda_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bfda1 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w85a_ c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure